HHsearch alignment for GI: 254780163 and conserved domain: pfam01695

>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=97.84  E-value=0.00014  Score=52.10  Aligned_cols=108  Identities=23%  Similarity=0.397  Sum_probs=63.4

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC---CCCCCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             677874896676411668999999998548988345201445540467530---63431237899999998720389839
Q gi|254780163|r  223 RSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA---GTRYRGDFEERIKKIVKEIESYANAI  299 (798)
Q Consensus       223 R~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a---g~~~rg~fe~r~~~~~~~~~~~~~~i  299 (798)
T Consensus        45 ~~~~Nlll~G~~GtGKThLA~Ai~~~~~~~-------g~~v~f~~~~~L~~~l~~~~~~~~~~~~l----~~~~~--~dl  111 (178)
T pfam01695        45 EQAENLLLLGPPGVGKTHLACALGHQACRA-------GYSVLFTRTPDLVEQLKRARGDGRLARTL----QRLAK--ADL  111 (178)
T ss_pred             HCCCCEEEECCCCCCHHHHHHHHHHHHHHC-------CCEEEEEECHHHHHHHHHHHHCCCHHHHH----HHHHC--CCE
T ss_conf             158768998999987899999999999986-------98599996167999999875267499999----99625--897


Q ss_pred             EEECCHHHHHCCCCCCCCCCCHHHHHHHHH-CCCC-EEEEEEC--CHHHHHHHHH
Q ss_conf             997361663015544434477788887663-0266-0388730--4899999852
Q gi|254780163|r  300 LYIDEIHTLVGAGSASGISVDASNLLKPAL-SSGA-VRCIGST--TYSEYRQFFE  350 (798)
Q Consensus       300 lfideih~ligag~~~g~~~d~an~lkP~L-~rg~-~~~Igat--T~~ey~~~~e  350 (798)
T Consensus       112 LIiDDl------G~~~~s~-~~~~~lf~li~~Rye~~stIiTSN~~~~~W~~~~~  159 (178)
T pfam01695       112 LILDDI------GYLPLSQ-EAAHLLFELISDRYERRSTILTSNLPFGEWHEVFG  159 (178)
T ss_pred             EEEEHH------CCCCCCH-HHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHCC
T ss_conf             887200------1656898-99999999999997568868776899789987648