BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease
ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62]
         (798 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039840|gb|ACT56636.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 798

 Score = 1627 bits (4212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 798/798 (100%), Positives = 798/798 (100%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL
Sbjct: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS
Sbjct: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD
Sbjct: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
           LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA
Sbjct: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL
Sbjct: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ
Sbjct: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI
Sbjct: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY
Sbjct: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM
Sbjct: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM
Sbjct: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL
Sbjct: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA
Sbjct: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET
Sbjct: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780

Query: 781 EEKEVEDIKSDTDSLTIV 798
           EEKEVEDIKSDTDSLTIV
Sbjct: 781 EEKEVEDIKSDTDSLTIV 798


>gi|315122667|ref|YP_004063156.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496069|gb|ADR52668.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 796

 Score = 1366 bits (3536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/798 (82%), Positives = 734/798 (91%), Gaps = 2/798 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           MSFFSENLEKVLHQALVLA E+N+EYATLEHLLLALIDDSDAA VMLSCNV+L VLK+NL
Sbjct: 1   MSFFSENLEKVLHQALVLATEKNNEYATLEHLLLALIDDSDAAAVMLSCNVNLAVLKDNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           LNYIDNDSSNKLK+   VEC+PTSSFQRVVQRAV+HVQSTG+ +VTGANILVA F+EPDS
Sbjct: 61  LNYIDNDSSNKLKDDLHVECRPTSSFQRVVQRAVIHVQSTGKSVVTGANILVAFFAEPDS 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HATYFLQEQ+MTLYDAVNFISHGI K++EFANFQ  LN+ G+++GS  EGF  DY+ + +
Sbjct: 121 HATYFLQEQDMTLYDAVNFISHGIEKKREFANFQDSLNMGGATSGS--EGFGTDYKFQAN 178

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            N FPAL+AYC+DLTEK KKG +D+L+GR EEINRTIQILCRRSKNNPLYVGDPGVGKTA
Sbjct: 179 PNPFPALNAYCIDLTEKAKKGNIDVLIGRREEINRTIQILCRRSKNNPLYVGDPGVGKTA 238

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEGFAKQIVDGMVPD LLG R+FSLD+GNLIAGTRYRGDFEERIKK+VKEIE+   AIL
Sbjct: 239 IAEGFAKQIVDGMVPDSLLGTRVFSLDIGNLIAGTRYRGDFEERIKKMVKEIEACPGAIL 298

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           YIDEIHTLVG GS+SGISVDASNLLKPALSSG VRCIGSTTYSEYRQFFEKDKALVRRFQ
Sbjct: 299 YIDEIHTLVGTGSSSGISVDASNLLKPALSSGVVRCIGSTTYSEYRQFFEKDKALVRRFQ 358

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KID+ EPS ED IEI+KGIKPYFEEHHQLRYSKEAI+AAV LS+RHFTSRKLPDKAIDVI
Sbjct: 359 KIDIDEPSPEDTIEIIKGIKPYFEEHHQLRYSKEAIKAAVDLSIRHFTSRKLPDKAIDVI 418

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGASQILQP SKRRKF+TEKDIK+T+ASMNRSIH+T+ S DDDS+LSNLE+NL  VVY
Sbjct: 419 DEAGASQILQPASKRRKFLTEKDIKRTVASMNRSIHSTNISNDDDSILSNLEENLERVVY 478

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ EAIKKL  SIK+ARAGLS+P KPIGCYVFSGPTGVGKTEISKQLA  LG++LLRFDM
Sbjct: 479 GQSEAIKKLVCSIKLARAGLSNPQKPIGCYVFSGPTGVGKTEISKQLAVCLGIRLLRFDM 538

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEY+ERHAV+RLIGAPPGYVGF QGG+L+DSVDQNPYS+VLLDEIEK+HPDV+NILLQIM
Sbjct: 539 SEYIERHAVARLIGAPPGYVGFDQGGLLSDSVDQNPYSLVLLDEIEKAHPDVVNILLQIM 598

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           DYG+LTDQ+G+K+SFRNVILIMTTNAGALE S+A+IGFGSSRN+DADKEALRNF SPEFL
Sbjct: 599 DYGMLTDQNGRKVSFRNVILIMTTNAGALEASRAKIGFGSSRNEDADKEALRNFFSPEFL 658

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDSI+PF PLS +++RQVV KFIM+L+ QLQEKGISFHFSEEVI+WLV HGYDVKMGA
Sbjct: 659 NRLDSIVPFSPLSPEVMRQVVRKFIMQLDAQLQEKGISFHFSEEVISWLVKHGYDVKMGA 718

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RPLERIIKE++K+PLADEILFGKLKKGGG+VKV LNPDK+   PI FEIENS SNI+ E 
Sbjct: 719 RPLERIIKEYIKIPLADEILFGKLKKGGGIVKVFLNPDKNPLVPICFEIENSSSNIAFEA 778

Query: 781 EEKEVEDIKSDTDSLTIV 798
           EEKE EDIK+ TD LT++
Sbjct: 779 EEKEAEDIKNQTDPLTVI 796


>gi|222148870|ref|YP_002549827.1| ATP-dependent Clp protease ATP-binding subunit [Agrobacterium vitis
           S4]
 gi|221735856|gb|ACM36819.1| ATP-dependent Clp protease ATP-binding subunit [Agrobacterium vitis
           S4]
          Length = 830

 Score = 1040 bits (2690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/750 (66%), Positives = 618/750 (82%), Gaps = 5/750 (0%)

Query: 4   FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNY 63
           FS +LEK LHQAL  ANER+HEYATLEHLL+ALIDD+DAA VM +CNV+L  L+  + +Y
Sbjct: 6   FSPSLEKALHQALTFANERHHEYATLEHLLMALIDDADAAAVMGACNVNLDTLRKTVSDY 65

Query: 64  IDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHAT 123
           +DN+ +N L  G+  + KPTS FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +SHA 
Sbjct: 66  VDNELAN-LVTGYDEDSKPTSGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERESHAA 124

Query: 124 YFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNL 183
           YFLQEQEMT YDAVN+ISHGI KR   +  +    V+  S  S  +    + +       
Sbjct: 125 YFLQEQEMTRYDAVNYISHGIGKRPGTSQPRPPRGVEEESEAS--QKPPREQEEGPAKKQ 182

Query: 184 FPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAE 243
             AL AYCV+L EK K G++D L+GRH+E+NRTIQ+LCRRSKNNPLYVGDPGVGKTAIAE
Sbjct: 183 PEALKAYCVNLNEKAKTGRIDPLIGRHDEVNRTIQVLCRRSKNNPLYVGDPGVGKTAIAE 242

Query: 244 GFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYID 303
           G AK+IV+G VP+ L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E Y  A+L+ID
Sbjct: 243 GLAKRIVEGKVPEALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEDYPGAVLFID 302

Query: 304 EIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKID 363
           EIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQKID
Sbjct: 303 EIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQKID 362

Query: 364 VSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEA 423
           V+EPSI+DAIEI+KG+KPYFEE+H+LRY+ EAI+ AV+LS R+ + RKLPDKAIDVIDE 
Sbjct: 363 VNEPSIDDAIEIMKGLKPYFEEYHKLRYTNEAIKTAVELSARYISDRKLPDKAIDVIDET 422

Query: 424 GASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQE 483
           GA+Q+L P S+RRK ITEK+I+ TIA+M R I   + S+DD+ VL+NL+K L +VVYGQ+
Sbjct: 423 GAAQMLLPASRRRKLITEKEIEVTIATMAR-IPAKTVSKDDELVLANLDKELRSVVYGQD 481

Query: 484 EAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEY 543
           +AI+ LS++IK+ARAGL +PNKPIG YVFSGPTGVGKTE++KQLA +LGV++LRFDMSEY
Sbjct: 482 DAIEALSTAIKLARAGLREPNKPIGSYVFSGPTGVGKTEVAKQLAASLGVEMLRFDMSEY 541

Query: 544 MERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYG 603
           MERH VSRL+GAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ NILLQ+MD+G
Sbjct: 542 MERHTVSRLLGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDIYNILLQVMDHG 601

Query: 604 ILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRL 663
            LTD +GKKI FRNVILIMTTNAGA EM+K+ IGFGSS+    D+EA+    +PEF NRL
Sbjct: 602 SLTDHNGKKIDFRNVILIMTTNAGASEMAKSAIGFGSSKRSGEDEEAINRLFTPEFRNRL 661

Query: 664 DSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPL 723
           D+IIPF PL S++I +VV KF+M+LE QL E+GI+F  SE  + WL + GYD KMGARPL
Sbjct: 662 DAIIPFAPLPSEVIHKVVQKFVMQLEAQLSERGITFDLSEPAVAWLATRGYDEKMGARPL 721

Query: 724 ERIIKEHVKVPLADEILFGKLKKGGGVVKV 753
            R+I+EH+K PLA+EILFGKLKK GG+VKV
Sbjct: 722 GRVIQEHIKKPLANEILFGKLKK-GGIVKV 750


>gi|325292724|ref|YP_004278588.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Agrobacterium
           sp. H13-3]
 gi|325060577|gb|ADY64268.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Agrobacterium
           sp. H13-3]
          Length = 838

 Score = 1032 bits (2669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/769 (65%), Positives = 619/769 (80%), Gaps = 3/769 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNVDL  L+  +
Sbjct: 1   MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMGACNVDLDALRKTV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +Y+DN+ +N L  G+  + KPTS FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  SDYVDNELTN-LVTGYDEDSKPTSGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQEMT YDAVN+ISHGI KR   +  ++    D   A         + +  + 
Sbjct: 120 HAAYFLQEQEMTRYDAVNYISHGIGKRPGTSQTRAPRGADEPEADPKAARSNPEEEGSSA 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYCV+L EK K GK+D L+GRHEE+NRTIQILCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 KKQQDALKAYCVNLNEKAKNGKIDPLIGRHEEVNRTIQILCRRSKNNPLYVGDPGVGKTA 239

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VP+ L    IFSLDMG L+AGTRYRGDFEER+K++VKE+E Y  A+L
Sbjct: 240 IAEGLAKRIVEGKVPEALANDTIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEYPGAVL 299

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 300 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 359

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI+DAI I+KG+KPYFE++H LRYS EAI+AAV+LS R+ + RKLPDKAIDVI
Sbjct: 360 KIDVNEPSIDDAIAIMKGLKPYFEDYHHLRYSNEAIKAAVELSARYISDRKLPDKAIDVI 419

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA+Q+L P SKRRK ITE++I+ TIA+M R I   + S+DD+ VL+NLEK L +VVY
Sbjct: 420 DETGAAQMLLPASKRRKLITEREIEATIATMAR-IPPKTVSKDDEMVLANLEKELRSVVY 478

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L+++IK+ARAGL +PNKPIG YVFSGPTGVGKTE++KQLA +LGV++LRFDM
Sbjct: 479 GQDIAIEALATAIKLARAGLREPNKPIGSYVFSGPTGVGKTEVAKQLAASLGVEMLRFDM 538

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRL+GAPPGYVGF QGG+L D VDQ+P+SVVLLDEIEK+HPD+ NILLQ+M
Sbjct: 539 SEYMERHTVSRLLGAPPGYVGFDQGGLLTDGVDQHPHSVVLLDEIEKAHPDIYNILLQVM 598

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA EM+K+ IGFGSSR    D+EA+    +PEF 
Sbjct: 599 DHGSLTDHNGKKIDFRNVILIMTTNAGASEMAKSAIGFGSSRRTGEDEEAINRLFTPEFR 658

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL + +I +VV KF+M+LE QL E+ ++F   E+ I+WL   GYD KMGA
Sbjct: 659 NRLDAIIPFSPLPTAVIHKVVQKFVMQLETQLSERNVTFDLHEDAISWLAEKGYDEKMGA 718

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEI 769
           RPL R+I+EH+K PLA+EILFGKLKK GGVV V++      S  +  E+
Sbjct: 719 RPLSRVIQEHIKKPLANEILFGKLKK-GGVVSVTVGKKDDGSDGLKLEV 766


>gi|241204497|ref|YP_002975593.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858387|gb|ACS56054.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 830

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/800 (64%), Positives = 629/800 (78%), Gaps = 18/800 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNVDL  L+  L
Sbjct: 1   MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMGACNVDLDALRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y+DN+ SN L  G+  + KPTS FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYVDNELSN-LITGYDEDSKPTSGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDG-------SSAGSDGEGFVN 173
           HA YFLQEQEMT YDAVN+ISHGI KR   ++ +     +        ++ G + EG   
Sbjct: 120 HAAYFLQEQEMTRYDAVNYISHGIGKRPGASDVRPPRGAEDEAESSKPTARGGEEEGGPK 179

Query: 174 DYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGD 233
             Q         AL AYCV+L EK K GK+D L+GRH E++RTIQILCRRSKNNPLYVGD
Sbjct: 180 KQQD--------ALKAYCVNLNEKAKGGKIDPLIGRHAEVSRTIQILCRRSKNNPLYVGD 231

Query: 234 PGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIE 293
           PGVGKTAIAEG AK+IV+G VP+ L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E
Sbjct: 232 PGVGKTAIAEGLAKRIVEGKVPEALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELE 291

Query: 294 SYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDK 353
            Y  A+L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+
Sbjct: 292 EYPGAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDR 351

Query: 354 ALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLP 413
           ALVRRFQKIDVSEPSIEDAIEI+KG+KPYFEE+H LRYS +AI++AV+LS R+ + RKLP
Sbjct: 352 ALVRRFQKIDVSEPSIEDAIEIMKGLKPYFEEYHHLRYSNDAIKSAVELSARYISDRKLP 411

Query: 414 DKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEK 473
           DKAIDVIDE GA+Q+L P SKRRK ITEK+I+ T+A+M R I   + S+DD++VL+NLE+
Sbjct: 412 DKAIDVIDETGAAQMLLPPSKRRKLITEKEIEATVATMAR-IPPKTVSKDDEAVLANLEQ 470

Query: 474 NLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGV 533
            L +VVYGQ+ AI+ LS+SIK+ARAGL +PNKPIG YVFSGPTGVGKTE++KQLA +LGV
Sbjct: 471 ELRSVVYGQDIAIEALSTSIKLARAGLREPNKPIGAYVFSGPTGVGKTEVAKQLASSLGV 530

Query: 534 QLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVL 593
           +LLRFDMSEYMERH VSRL+GAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ 
Sbjct: 531 ELLRFDMSEYMERHTVSRLLGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDIY 590

Query: 594 NILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRN 653
           NILLQ+MD+G LTD +GKKI FRNVILIMTTNAGA EM+KA IGFGSS+    D+EAL  
Sbjct: 591 NILLQVMDHGTLTDHNGKKIDFRNVILIMTTNAGASEMAKAAIGFGSSKRTGEDEEALTR 650

Query: 654 FLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHG 713
             +PEF NRLD+IIPF  L + +I +VV KFIM+LE QL E+ ++F   E+ I WL   G
Sbjct: 651 LFTPEFRNRLDAIIPFAALPTAVIHKVVQKFIMQLEAQLSERNVTFDLHEDAIAWLAEKG 710

Query: 714 YDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSG 773
           YD KMGARPL R+I++ +K PLA+EILFGKLKK GGVV V++ P +     I  E  +  
Sbjct: 711 YDEKMGARPLARVIQDTIKKPLANEILFGKLKK-GGVVNVTVGPKEDGKPGIVLEAISET 769

Query: 774 SNISLETEEKEVEDIKSDTD 793
           + I  + E + V     D D
Sbjct: 770 APIKPKPEAEVVHPEGDDGD 789


>gi|222085851|ref|YP_002544382.1| ATP-dependent Clp protease [Agrobacterium radiobacter K84]
 gi|221723299|gb|ACM26455.1| ATP-dependent Clp protease [Agrobacterium radiobacter K84]
          Length = 843

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/769 (66%), Positives = 623/769 (81%), Gaps = 12/769 (1%)

Query: 4   FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNY 63
           FS +LEK LHQAL  ANER+HEYATLEHLLLAL+DD+DAA VM +CNVDL  L+  L  Y
Sbjct: 6   FSPSLEKALHQALTYANERHHEYATLEHLLLALVDDADAAAVMGACNVDLDALRKTLTEY 65

Query: 64  IDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHAT 123
           +DN+ SN L  G+  + KPTS FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +SHA 
Sbjct: 66  VDNELSN-LITGYDEDSKPTSGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERESHAA 124

Query: 124 YFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSA----GSDGEGFVNDYQAKT 179
           +FLQEQEMT YDAVN+ISHGI KR   +  ++    + S +     S GE   +  + + 
Sbjct: 125 FFLQEQEMTRYDAVNYISHGIGKRPGASQTRTPRGAEDSESESKPTSRGEQEESGNKKQQ 184

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
           D     AL AYCV+L EK K GK+D L+GRH E+NRTIQ+LCRRSKNNPLYVGDPGVGKT
Sbjct: 185 D-----ALKAYCVNLNEKAKNGKIDPLIGRHSEVNRTIQVLCRRSKNNPLYVGDPGVGKT 239

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG AK+IV+G VP+ L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E Y  A+
Sbjct: 240 AIAEGLAKRIVEGKVPEALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEYPGAV 299

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRF
Sbjct: 300 LFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRF 359

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV+EPSIEDAIEI+KG+KPYFEE+H LRY+ +AI++AV+LS R+ + RKLPDKAIDV
Sbjct: 360 QKIDVNEPSIEDAIEIMKGLKPYFEEYHHLRYTNDAIKSAVELSARYISDRKLPDKAIDV 419

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDE GA+Q+L P SKRRK ITEK+I+ TIA+M R I   + S+DD+ VL+NLE+ L +VV
Sbjct: 420 IDETGAAQMLLPPSKRRKLITEKEIEVTIATMAR-IPAKTVSKDDEMVLANLEQELRSVV 478

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           YGQ+ AI+ LS++IK+ARAGL +PNKPIGCY+FSGPTGVGKTE++KQLA +LGV+LLRFD
Sbjct: 479 YGQDTAIEALSTAIKLARAGLREPNKPIGCYIFSGPTGVGKTEVAKQLASSLGVELLRFD 538

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERH VSRL+GAPPGYVGF QGG+L D VDQ+P+SVVLLDEIEK+HPD+ NILLQ+
Sbjct: 539 MSEYMERHTVSRLLGAPPGYVGFDQGGLLTDGVDQHPHSVVLLDEIEKAHPDIFNILLQV 598

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +GKKI FRNVILIMTTNAGA EM+KA IGFGS++    D+EAL    +PEF
Sbjct: 599 MDHGSLTDHNGKKIDFRNVILIMTTNAGASEMAKAAIGFGSAKRTGEDEEALNRLFTPEF 658

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+ IPF PL + +I +VV KFIM+LE QL E+ ++F   E+ I WL   GYD KMG
Sbjct: 659 RNRLDATIPFAPLPTVVIHKVVQKFIMQLEAQLSERNVTFDLHEDAIAWLSEKGYDEKMG 718

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           ARPL R+I+E++K PLA+EILFGKLKK GGVV V++   +  ++ I  E
Sbjct: 719 ARPLARVIQENIKKPLANEILFGKLKK-GGVVTVTVGKKEDGTTGIVLE 766


>gi|116251969|ref|YP_767807.1| ATP-dependent Clp protease ATP-binding subunit [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115256617|emb|CAK07705.1| putative ATP-dependent Clp protease ATP-binding subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 830

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/800 (64%), Positives = 629/800 (78%), Gaps = 18/800 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNVDL  L+  L
Sbjct: 1   MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMGACNVDLDALRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y+DN+ SN L  G+  + KPTS FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYVDNELSN-LITGYDEDSKPTSGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDG-------SSAGSDGEGFVN 173
           HA YFLQEQEMT YDAVN+ISHGI KR   ++ +     +        ++ G + EG   
Sbjct: 120 HAAYFLQEQEMTRYDAVNYISHGIGKRPGASDVRPPRGAEDEAESSKPTARGGEEEGGPK 179

Query: 174 DYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGD 233
             Q         AL AYCV+L EK K GK+D L+GRH E++RTIQILCRRSKNNPLYVGD
Sbjct: 180 KQQD--------ALKAYCVNLNEKAKGGKIDPLIGRHAEVSRTIQILCRRSKNNPLYVGD 231

Query: 234 PGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIE 293
           PGVGKTAIAEG AK+IV+G VP+ L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E
Sbjct: 232 PGVGKTAIAEGLAKRIVEGKVPEALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELE 291

Query: 294 SYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDK 353
            Y  A+L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+
Sbjct: 292 EYPGAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDR 351

Query: 354 ALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLP 413
           ALVRRFQKIDVSEPSI+DAIEI+KG+KPYFEE+H LRYS +AI++AV+LS R+ + RKLP
Sbjct: 352 ALVRRFQKIDVSEPSIDDAIEIMKGLKPYFEEYHHLRYSNDAIKSAVELSARYISDRKLP 411

Query: 414 DKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEK 473
           DKAIDVIDE GA+Q+L P SKRRK ITEK+I+ T+A+M R I   + S+DD++VL+NLE+
Sbjct: 412 DKAIDVIDETGAAQMLLPPSKRRKLITEKEIEATVATMAR-IPPKTVSKDDEAVLANLEQ 470

Query: 474 NLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGV 533
            L +VVYGQ+ AI+ LS+SIK+ARAGL +PNKPIG YVFSGPTGVGKTE++KQLA +LGV
Sbjct: 471 ELRSVVYGQDIAIEALSTSIKLARAGLREPNKPIGAYVFSGPTGVGKTEVAKQLASSLGV 530

Query: 534 QLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVL 593
           +LLRFDMSEYMERH VSRL+GAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ 
Sbjct: 531 ELLRFDMSEYMERHTVSRLLGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDIY 590

Query: 594 NILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRN 653
           NILLQ+MD+G LTD +GKKI FRNVILIMTTNAGA EM+KA IGFGSS+    D+EAL  
Sbjct: 591 NILLQVMDHGTLTDHNGKKIDFRNVILIMTTNAGASEMAKAAIGFGSSKRTGEDEEALTR 650

Query: 654 FLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHG 713
             +PEF NRLD+IIPF  L + +I +VV KFIM+LE QL E+ ++F   E+ I WL   G
Sbjct: 651 LFTPEFRNRLDAIIPFAALPTAVIHKVVQKFIMQLEAQLSERNVTFDLHEDAIAWLAEKG 710

Query: 714 YDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSG 773
           YD KMGARPL R+I++ +K PLA+EILFGKLKK GGVV V++ P +     I  E  +  
Sbjct: 711 YDEKMGARPLARVIQDTIKKPLANEILFGKLKK-GGVVNVTVGPKEDGKPGIVLEAISET 769

Query: 774 SNISLETEEKEVEDIKSDTD 793
           + I  + E + V     D D
Sbjct: 770 APIKPKPEAEVVHPEGDDGD 789


>gi|86357528|ref|YP_469420.1| ATP-dependent Clp protease, ATP-binding subunit protein [Rhizobium
           etli CFN 42]
 gi|86281630|gb|ABC90693.1| ATP-dependent Clp protease, ATP-binding subunit protein [Rhizobium
           etli CFN 42]
          Length = 829

 Score = 1028 bits (2659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/794 (64%), Positives = 626/794 (78%), Gaps = 7/794 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNVDL  L+  L
Sbjct: 1   MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMGACNVDLDALRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y+DN+ SN L  G+  + KPTS FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYVDNELSN-LITGYDEDSKPTSGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSS-AGSDGEGFVNDYQAKT 179
           HA YFLQEQEMT YDAVN+ISHGI KR   +  ++    +  + +     G   +   K 
Sbjct: 120 HAAYFLQEQEMTRYDAVNYISHGIGKRPGASETRTPRGAEEEAESKPTARGGEEESGPKK 179

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
             +   AL AYCV+L EK K GK+D L+GRH E++RTIQILCRRSKNNPLYVGDPGVGKT
Sbjct: 180 QQD---ALKAYCVNLNEKAKGGKIDPLIGRHAEVSRTIQILCRRSKNNPLYVGDPGVGKT 236

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG AK+IV+G VP+ L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E Y  A+
Sbjct: 237 AIAEGLAKRIVEGKVPEALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEYPGAV 296

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRF
Sbjct: 297 LFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRF 356

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDVSEPSI DAIEI+KG+KPYFEE+H LRYS +AI++AV+LS R+ + RKLPDKAIDV
Sbjct: 357 QKIDVSEPSINDAIEIMKGLKPYFEEYHHLRYSNDAIKSAVELSARYISDRKLPDKAIDV 416

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDE GA+Q+L P SKRRK ITEK+I+ TIA+M R I   + S+DD++VL+NLE+ L +VV
Sbjct: 417 IDETGAAQMLLPPSKRRKLITEKEIEATIATMAR-IPPKTVSKDDEAVLANLEQELRSVV 475

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           YGQ+ AI+ LS+SIK+ARAGL +PNKPIG YVFSGPTGVGKTE++KQLA +LGV+LLRFD
Sbjct: 476 YGQDIAIEALSTSIKLARAGLREPNKPIGAYVFSGPTGVGKTEVAKQLAASLGVELLRFD 535

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERH VSRL+GAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ NILLQ+
Sbjct: 536 MSEYMERHTVSRLLGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDIYNILLQV 595

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +GKKI FRNVILIMTTNAGA EM+KA IGFGSS+    D+EAL    +PEF
Sbjct: 596 MDHGTLTDHNGKKIDFRNVILIMTTNAGASEMAKAAIGFGSSKRTGEDEEALTRLFTPEF 655

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+IIPF  L + +I +VV KFIM+LE QL E+ ++F   E+ I WL   GYD KMG
Sbjct: 656 RNRLDAIIPFAALPTAVIHKVVQKFIMQLEAQLSERNVTFDLHEDAIAWLAEKGYDEKMG 715

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLE 779
           ARPL R+I++ +K PLA+EILFGKLKK GGVV V++ P +     I  E     + I  +
Sbjct: 716 ARPLARVIQDTIKKPLANEILFGKLKK-GGVVNVTVGPKEDGKPGILLEAIPDTAPIKPK 774

Query: 780 TEEKEVEDIKSDTD 793
            E + V     D D
Sbjct: 775 PEAEAVHPEADDED 788


>gi|190891597|ref|YP_001978139.1| ATP-dependent Clp protease protein, ATP-binding subunit [Rhizobium
           etli CIAT 652]
 gi|190696876|gb|ACE90961.1| ATP-dependent Clp protease protein, ATP-binding subunit [Rhizobium
           etli CIAT 652]
          Length = 829

 Score = 1027 bits (2656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/774 (66%), Positives = 618/774 (79%), Gaps = 17/774 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNVDL  L+  L
Sbjct: 1   MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMGACNVDLDALRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y+DN+ SN L  G+  + KPTS FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYVDNELSN-LITGYDEDSKPTSGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVD------GSSAGSDGEGFVND 174
           HA YFLQEQEMT YDAVN+ISHGI KR   +  +     +       ++ G + EG    
Sbjct: 120 HAAYFLQEQEMTRYDAVNYISHGIGKRPGASEARPPRGAEEEAESKPTARGGEEEGGPKK 179

Query: 175 YQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDP 234
            Q         AL AYCV+L EK K GK+D L+GRH E++RTIQILCRRSKNNPLYVGDP
Sbjct: 180 QQD--------ALKAYCVNLNEKAKGGKIDPLIGRHAEVSRTIQILCRRSKNNPLYVGDP 231

Query: 235 GVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES 294
           GVGKTAIAEG AK+IV+G VP+ L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E 
Sbjct: 232 GVGKTAIAEGLAKRIVEGKVPEALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEE 291

Query: 295 YANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKA 354
           Y  A+L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+A
Sbjct: 292 YPGAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRA 351

Query: 355 LVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD 414
           LVRRFQKIDVSEPSI DAIEI+KG+KPYFEE+H LRYS +AI++AV+LS R+ + RKLPD
Sbjct: 352 LVRRFQKIDVSEPSINDAIEIMKGLKPYFEEYHHLRYSNDAIKSAVELSARYISDRKLPD 411

Query: 415 KAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKN 474
           KAIDVIDE GA+Q+L P SKRRK ITEK+I+ TIA+M R I   + S+DD++VL+NLE+ 
Sbjct: 412 KAIDVIDETGAAQMLLPPSKRRKLITEKEIEATIATMAR-IPPKTVSKDDEAVLANLEQE 470

Query: 475 LGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQ 534
           L +VVYGQ+ AI+ LS+SIK+ARAGL +PNKPIG YVFSGPTGVGKTE++KQLA +LGV+
Sbjct: 471 LRSVVYGQDIAIEALSTSIKLARAGLREPNKPIGAYVFSGPTGVGKTEVAKQLASSLGVE 530

Query: 535 LLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLN 594
           LLRFDMSEYMERH VSRL+GAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N
Sbjct: 531 LLRFDMSEYMERHTVSRLLGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDIYN 590

Query: 595 ILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNF 654
           ILLQ+MD+G LTD +GKKI FRNVILIMTTNAGA EM+KA IGFGSS+    D+EAL   
Sbjct: 591 ILLQVMDHGTLTDHNGKKIDFRNVILIMTTNAGASEMAKAAIGFGSSKRTGEDEEALTRL 650

Query: 655 LSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGY 714
            +PEF NRLD+IIPF  L + +I +VV KFIM+LE QL E+ ++F   E+ I WL   GY
Sbjct: 651 FTPEFRNRLDAIIPFAALPTAVIHKVVQKFIMQLEAQLSERNVTFDLHEDAIAWLSDKGY 710

Query: 715 DVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           D KMGARPL R+I++ +K PLA+EILFGKLKK GGVV V++ P +     I  E
Sbjct: 711 DEKMGARPLARVIQDTIKKPLANEILFGKLKK-GGVVNVTVGPKEDGKPGIVLE 763


>gi|209549171|ref|YP_002281088.1| ATP-dependent Clp protease ATP-binding subunit clpA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534927|gb|ACI54862.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 830

 Score = 1026 bits (2654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/775 (65%), Positives = 619/775 (79%), Gaps = 18/775 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNVDL  L+  L
Sbjct: 1   MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMGACNVDLDALRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y+DN+ SN L  G+  + KPTS FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYVDNELSN-LITGYDEDSKPTSGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVD-------GSSAGSDGEGFVN 173
           HA YFLQEQEMT YDAVN+ISHGI KR   +  +     +        ++ G + EG   
Sbjct: 120 HAAYFLQEQEMTRYDAVNYISHGIGKRPGASEARPPRGAEEEAESSKPTARGGEEEGGPK 179

Query: 174 DYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGD 233
             Q         AL AYCV+L EK K GK+D L+GRH E++RTIQILCRRSKNNPLYVGD
Sbjct: 180 KQQD--------ALKAYCVNLNEKAKGGKIDPLIGRHAEVSRTIQILCRRSKNNPLYVGD 231

Query: 234 PGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIE 293
           PGVGKTAIAEG AK+IV+G VP+ L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E
Sbjct: 232 PGVGKTAIAEGLAKRIVEGKVPEALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELE 291

Query: 294 SYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDK 353
            Y  A+L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+
Sbjct: 292 EYPGAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDR 351

Query: 354 ALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLP 413
           ALVRRFQKIDVSEPSI+DAIEI+KG+KPYFEE+H LRYS +AI++AV+LS R+ + RKLP
Sbjct: 352 ALVRRFQKIDVSEPSIDDAIEIMKGLKPYFEEYHHLRYSNDAIKSAVELSARYISDRKLP 411

Query: 414 DKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEK 473
           DKAIDVIDE GA+Q+L P SKRRK ITEK+I+ T+A+M R I   + S+DD++VL+NLE+
Sbjct: 412 DKAIDVIDETGAAQMLLPPSKRRKLITEKEIEATVATMAR-IPPKTVSKDDEAVLANLEQ 470

Query: 474 NLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGV 533
            L +VVYGQ+ AI+ LS+SIK+ARAGL +PNKPIG YVFSGPTGVGKTE++KQLA +LGV
Sbjct: 471 ELRSVVYGQDIAIEALSTSIKLARAGLREPNKPIGAYVFSGPTGVGKTEVAKQLASSLGV 530

Query: 534 QLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVL 593
           +LLRFDMSEYMERH VSRL+GAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ 
Sbjct: 531 ELLRFDMSEYMERHTVSRLLGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDIY 590

Query: 594 NILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRN 653
           NILLQ+MD+G LTD +GKKI FRNVILIMTTNAGA EM+KA IGFGSS+    D+EAL  
Sbjct: 591 NILLQVMDHGTLTDHNGKKIDFRNVILIMTTNAGASEMAKAAIGFGSSKRTGEDEEALTR 650

Query: 654 FLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHG 713
             +PEF NRLD+IIPF  L + +I +VV KFIM+LE QL E+ ++F   E+ I WL   G
Sbjct: 651 LFTPEFRNRLDAIIPFAALPTAVIHKVVQKFIMQLEAQLSERNVTFDLHEDAIAWLSEKG 710

Query: 714 YDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           YD KMGARPL R+I++ +K PLA+EILFGKLKK GGVV V++ P +     I  E
Sbjct: 711 YDEKMGARPLARVIQDTIKKPLANEILFGKLKK-GGVVNVTVGPKEDGKPGIVLE 764


>gi|114704885|ref|ZP_01437793.1| endopeptidase Clp ATP-binding chain A [Fulvimarina pelagi HTCC2506]
 gi|114539670|gb|EAU42790.1| endopeptidase Clp ATP-binding chain A [Fulvimarina pelagi HTCC2506]
          Length = 832

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/768 (64%), Positives = 616/768 (80%), Gaps = 10/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FSE+LEK LHQAL LANER+ E+ATLEHLLLAL++D+DAA VM  CNVDL  LK+NL
Sbjct: 1   MPTFSESLEKSLHQALTLANERHQEFATLEHLLLALVEDNDAAAVMRGCNVDLTALKSNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           ++YIDN+ SN L  G   E KPT+ F RV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  ISYIDNELSN-LVTGHGEESKPTAGFHRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQEMT YDAVNFISHGI+KR   +  +    V G+       G   D + K  
Sbjct: 120 HAAYFLQEQEMTRYDAVNFISHGIAKRPGGSESRP---VRGAEEDQQTVGQEEDGKRKGQ 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYC++L EK + GK+D L+GR +EINRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 177 ----DALSAYCINLNEKARGGKIDPLIGRADEINRTIQVLCRRSKNNPLYVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+I+DG VP++L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E Y  A+L
Sbjct: 233 IAEGLAKRIIDGDVPEVLQDATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEYPGAVL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDAI I+KG+KPYFE+ H+++++ +AI++AV+LS R+   RKLPDKAIDVI
Sbjct: 353 KIDVNEPSVEDAISILKGLKPYFEDFHKVKFTNDAIKSAVELSSRYINDRKLPDKAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L   +KR+K I  K+I+ T+A+M R I   S S+DD+ VL+NL+  L  VVY
Sbjct: 413 DETGASQMLLAENKRKKSIGVKEIEATVATMAR-IPPKSVSKDDEEVLANLDTQLKRVVY 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L+S+IK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA  LGV++LRFDM
Sbjct: 472 GQDQAIEALASAIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASTLGVEILRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 532 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+I FRNVILIMTTNAGA EM KA IGFGSS+   AD+EA+    +PEF 
Sbjct: 592 DHGKLTDHNGKQIDFRNVILIMTTNAGASEMQKAAIGFGSSKRTGADEEAINKMFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF  L + +I QVV KF+M+LE QL E+ + F  + E + WL   GYD +MGA
Sbjct: 652 NRLDAIIPFGSLPTPVIHQVVEKFVMQLEAQLSERNVIFELTPEAVAWLAEKGYDEQMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RPL R+I+EH+K PLADE+LFGKLK+ GG VKVS+  D++ +  I  E
Sbjct: 712 RPLGRVIQEHIKKPLADEVLFGKLKR-GGTVKVSITEDENGAKSIALE 758


>gi|256369594|ref|YP_003107104.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Brucella
           microti CCM 4915]
 gi|255999756|gb|ACU48155.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Brucella
           microti CCM 4915]
          Length = 824

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/768 (64%), Positives = 613/768 (79%), Gaps = 8/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +CNVDL  LK+ +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACNVDLDYLKHIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LITGYDEDSKPTAAFQRVIQRAVIHVQSSNRDEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGISKR + +  ++   V+ +S    G       + K D
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGISKRPQGSEPRTPRGVESASEERTGIEQEEAPKKKQD 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYC++L EK K G++D L+GR  EINRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 -----ALSAYCINLNEKAKAGRIDPLIGRDSEINRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VPD L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E +  A+L
Sbjct: 235 IAEGLAKRIVEGQVPDALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEFPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKDKALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDKALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFE+ H+++Y+ +AI++AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDTIEIMKGLKPYFEDFHKVKYTVDAIKSAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+LE  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEEVLSHLEAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIDALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PEF 
Sbjct: 594 DHGALTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL   +I QVV KF+++LE QL E+G++F  ++  I WL   GYD +MGA
Sbjct: 654 NRLDAIIPFGPLPVPVIHQVVQKFVLQLEAQLAERGVTFELTDAAIAWLADKGYDERMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RPL R+I+EH+K PLADE+LFGKLK  GG V+V +   +  ++ +  E
Sbjct: 714 RPLARVIQEHIKKPLADEVLFGKLKH-GGTVRVDVTTKEDGNTDLMLE 760


>gi|256061250|ref|ZP_05451401.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           neotomae 5K33]
 gi|261325258|ref|ZP_05964455.1| ATP-dependent Clp protease [Brucella neotomae 5K33]
 gi|261301238|gb|EEY04735.1| ATP-dependent Clp protease [Brucella neotomae 5K33]
          Length = 824

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/768 (64%), Positives = 613/768 (79%), Gaps = 8/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +CNVDL  LK+ +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACNVDLDYLKHIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LITGYDEDSKPTAAFQRVIQRAVIHVQSSNRDEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGISKR + +  ++   V+ +S    G       + K D
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGISKRPQGSEPRTPRGVESASEERTGIEQEEAPKKKQD 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYC++L EK K G++D L+GR  EINRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 -----ALSAYCINLNEKAKAGRIDPLIGRDSEINRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VPD L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E +  A+L
Sbjct: 235 IAEGLAKRIVEGQVPDALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEFPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFE+ H+++Y+ +AI++AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDTIEIMKGLKPYFEDFHKVKYTVDAIKSAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+LE  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEEVLSHLEAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIDALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PEF 
Sbjct: 594 DHGALTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL   +I QVV KF+++LE QL E+G++F  ++  I WL   GYD +MGA
Sbjct: 654 NRLDAIIPFGPLPVPVIHQVVQKFVLQLEAQLAERGVTFELTDAAIAWLADKGYDERMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RPL R+I+EH+K PLADE+LFGKLK  GG V+V +   +  ++ +  E
Sbjct: 714 RPLARVIQEHIKKPLADEVLFGKLKH-GGTVRVDVTTKEDGNTDLMLE 760


>gi|17987099|ref|NP_539733.1| ATP-dependent Clp protease ATP-binding subunit CLPA [Brucella
           melitensis bv. 1 str. 16M]
 gi|23502047|ref|NP_698174.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Brucella suis
           1330]
 gi|62290082|ref|YP_221875.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Brucella
           abortus bv. 1 str. 9-941]
 gi|82700007|ref|YP_414581.1| chaperonin ClpA/B [Brucella melitensis biovar Abortus 2308]
 gi|161619120|ref|YP_001593007.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella canis
           ATCC 23365]
 gi|189024320|ref|YP_001935088.1| ATP-dependent CLP protease ATP-binding subunit CLPA [Brucella
           abortus S19]
 gi|225627637|ref|ZP_03785674.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella ceti
           str. Cudo]
 gi|225852666|ref|YP_002732899.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brucella
           melitensis ATCC 23457]
 gi|237815588|ref|ZP_04594585.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           abortus str. 2308 A]
 gi|254689392|ref|ZP_05152646.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           abortus bv. 6 str. 870]
 gi|254693876|ref|ZP_05155704.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           abortus bv. 3 str. Tulya]
 gi|254697527|ref|ZP_05159355.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|254706650|ref|ZP_05168478.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           pinnipedialis M163/99/10]
 gi|254710243|ref|ZP_05172054.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           pinnipedialis B2/94]
 gi|254730422|ref|ZP_05189000.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           abortus bv. 4 str. 292]
 gi|256031737|ref|ZP_05445351.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           pinnipedialis M292/94/1]
 gi|256044824|ref|ZP_05447728.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256113729|ref|ZP_05454533.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           melitensis bv. 3 str. Ether]
 gi|256159903|ref|ZP_05457625.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella ceti
           M490/95/1]
 gi|256255137|ref|ZP_05460673.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella ceti
           B1/94]
 gi|256257638|ref|ZP_05463174.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           abortus bv. 9 str. C68]
 gi|256263840|ref|ZP_05466372.1| ATP-dependent CLP protease ATP-binding subunit CLPA [Brucella
           melitensis bv. 2 str. 63/9]
 gi|260168870|ref|ZP_05755681.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella sp.
           F5/99]
 gi|260546632|ref|ZP_05822371.1| ATP-dependent CLP protease ATP-binding subunit CLPA [Brucella
           abortus NCTC 8038]
 gi|260565576|ref|ZP_05836060.1| ATP-dependent CLP protease ATP-binding subunit CLPA [Brucella
           melitensis bv. 1 str. 16M]
 gi|260566298|ref|ZP_05836768.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brucella suis
           bv. 4 str. 40]
 gi|260754910|ref|ZP_05867258.1| ATP-dependent Clp protease [Brucella abortus bv. 6 str. 870]
 gi|260758127|ref|ZP_05870475.1| ATP-dependent Clp protease [Brucella abortus bv. 4 str. 292]
 gi|260761953|ref|ZP_05874296.1| ATP-dependent Clp protease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883922|ref|ZP_05895536.1| ATP-dependent Clp protease [Brucella abortus bv. 9 str. C68]
 gi|261214162|ref|ZP_05928443.1| ATP-dependent Clp protease [Brucella abortus bv. 3 str. Tulya]
 gi|261222335|ref|ZP_05936616.1| ATP-dependent Clp protease [Brucella ceti B1/94]
 gi|261314111|ref|ZP_05953308.1| ATP-dependent Clp protease [Brucella pinnipedialis M163/99/10]
 gi|261317802|ref|ZP_05956999.1| ATP-dependent Clp protease [Brucella pinnipedialis B2/94]
 gi|261758358|ref|ZP_06002067.1| ATP-dependent CLP protease ATP-binding subunit CLPA [Brucella sp.
           F5/99]
 gi|265988833|ref|ZP_06101390.1| ATP-dependent Clp protease [Brucella pinnipedialis M292/94/1]
 gi|265991248|ref|ZP_06103805.1| ATP-dependent Clp protease [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995084|ref|ZP_06107641.1| ATP-dependent Clp protease [Brucella melitensis bv. 3 str. Ether]
 gi|265998299|ref|ZP_06110856.1| ATP-dependent Clp protease [Brucella ceti M490/95/1]
 gi|297248479|ref|ZP_06932197.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brucella
           abortus bv. 5 str. B3196]
 gi|9542862|emb|CAC00480.1| ClpA protein [Brucella suis]
 gi|17982760|gb|AAL51997.1| ATP-dependent clp protease ATP-binding subunit clpa [Brucella
           melitensis bv. 1 str. 16M]
 gi|23348002|gb|AAN30089.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Brucella suis
           1330]
 gi|62196214|gb|AAX74514.1| ClpA, ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Brucella abortus bv. 1 str. 9-941]
 gi|82616108|emb|CAJ11147.1| Chaperonin clpA/B:ATP/GTP-binding site motif A (P-loop):AAA
           ATPase:AAA ATPase, central region:Clp, N terminal
           [Brucella melitensis biovar Abortus 2308]
 gi|161335931|gb|ABX62236.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella canis
           ATCC 23365]
 gi|189019892|gb|ACD72614.1| ATP-dependent CLP protease ATP-binding subunit CLPA [Brucella
           abortus S19]
 gi|225617642|gb|EEH14687.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella ceti
           str. Cudo]
 gi|225641031|gb|ACO00945.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           melitensis ATCC 23457]
 gi|237788886|gb|EEP63097.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           abortus str. 2308 A]
 gi|260095682|gb|EEW79559.1| ATP-dependent CLP protease ATP-binding subunit CLPA [Brucella
           abortus NCTC 8038]
 gi|260151644|gb|EEW86738.1| ATP-dependent CLP protease ATP-binding subunit CLPA [Brucella
           melitensis bv. 1 str. 16M]
 gi|260155816|gb|EEW90896.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brucella suis
           bv. 4 str. 40]
 gi|260668445|gb|EEX55385.1| ATP-dependent Clp protease [Brucella abortus bv. 4 str. 292]
 gi|260672385|gb|EEX59206.1| ATP-dependent Clp protease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675018|gb|EEX61839.1| ATP-dependent Clp protease [Brucella abortus bv. 6 str. 870]
 gi|260873450|gb|EEX80519.1| ATP-dependent Clp protease [Brucella abortus bv. 9 str. C68]
 gi|260915769|gb|EEX82630.1| ATP-dependent Clp protease [Brucella abortus bv. 3 str. Tulya]
 gi|260920919|gb|EEX87572.1| ATP-dependent Clp protease [Brucella ceti B1/94]
 gi|261297025|gb|EEY00522.1| ATP-dependent Clp protease [Brucella pinnipedialis B2/94]
 gi|261303137|gb|EEY06634.1| ATP-dependent Clp protease [Brucella pinnipedialis M163/99/10]
 gi|261738342|gb|EEY26338.1| ATP-dependent CLP protease ATP-binding subunit CLPA [Brucella sp.
           F5/99]
 gi|262552767|gb|EEZ08757.1| ATP-dependent Clp protease [Brucella ceti M490/95/1]
 gi|262766197|gb|EEZ11986.1| ATP-dependent Clp protease [Brucella melitensis bv. 3 str. Ether]
 gi|263002032|gb|EEZ14607.1| ATP-dependent Clp protease [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093971|gb|EEZ17905.1| ATP-dependent CLP protease ATP-binding subunit CLPA [Brucella
           melitensis bv. 2 str. 63/9]
 gi|264661030|gb|EEZ31291.1| ATP-dependent Clp protease [Brucella pinnipedialis M292/94/1]
 gi|297175648|gb|EFH34995.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brucella
           abortus bv. 5 str. B3196]
 gi|326409187|gb|ADZ66252.1| ATP-dependent CLP protease ATP-binding subunit CLPA [Brucella
           melitensis M28]
 gi|326538897|gb|ADZ87112.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella
           melitensis M5-90]
          Length = 824

 Score = 1022 bits (2642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/768 (64%), Positives = 613/768 (79%), Gaps = 8/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +CNVDL  LK+ +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACNVDLDYLKHIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LITGYDEDSKPTAAFQRVIQRAVIHVQSSNRDEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGISKR + +  ++   V+ +S    G       + K D
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGISKRPQGSEPRTPRGVESASEERTGIEQEEAPKKKQD 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYC++L EK K G++D L+GR  EINRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 -----ALSAYCINLNEKAKAGRIDPLIGRDSEINRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VPD L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E +  A+L
Sbjct: 235 IAEGLAKRIVEGQVPDALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEFPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFE+ H+++Y+ +AI++AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDTIEIMKGLKPYFEDFHKVKYTVDAIKSAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+LE  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEEVLSHLEAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIDALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PEF 
Sbjct: 594 DHGALTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL   +I QVV KF+++LE QL E+G++F  ++  I WL   GYD +MGA
Sbjct: 654 NRLDAIIPFGPLPVPVIHQVVQKFVLQLEAQLAERGVTFELTDAAIAWLADKGYDERMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RPL R+I+EH+K PLADE+LFGKLK  GG V+V +   +  ++ +  E
Sbjct: 714 RPLARVIQEHIKKPLADEVLFGKLKH-GGTVRVDVTTKEDGNTDLMLE 760


>gi|15888690|ref|NP_354371.1| ATP-dependent Clp protease, ATP-binding subunit [Agrobacterium
           tumefaciens str. C58]
 gi|15156428|gb|AAK87156.1| ATP-dependent Clp protease, ATP-binding subunit [Agrobacterium
           tumefaciens str. C58]
          Length = 836

 Score = 1021 bits (2639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/772 (65%), Positives = 622/772 (80%), Gaps = 9/772 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNVDL  L+  +
Sbjct: 1   MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMAACNVDLDALRKTV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +Y+DN+ +N L  G+  + KPTS FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  SDYVDNELTN-LVTGYDEDSKPTSGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVD---GSSAGSDGEGFVNDYQA 177
           HA YFLQEQEMT YDAVN+ISHGI KR   +  ++    D     S  S G    +   A
Sbjct: 120 HAAYFLQEQEMTRYDAVNYISHGIGKRPGTSQTRAPRGADEPESESKPSRGNPEEDGSSA 179

Query: 178 KTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG 237
           K   +   AL AYCV+L +K + GK+D L+GRH+E+NRTIQILCRRSKNNPLYVGDPGVG
Sbjct: 180 KKQQD---ALKAYCVNLNDKARNGKIDPLIGRHDEVNRTIQILCRRSKNNPLYVGDPGVG 236

Query: 238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN 297
           KTAIAEG AK+IV+G VP+ L    IFSLDMG L+AGTRYRGDFEER+K++VKE+E +  
Sbjct: 237 KTAIAEGLAKRIVEGKVPEALANDTIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEFPG 296

Query: 298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR 357
           A+L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVR
Sbjct: 297 AVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVR 356

Query: 358 RFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI 417
           RFQKIDV+EPSI+DAI I+KG+KPYFE++H LRYS EAI+AAV+LS R+ + RKLPDKAI
Sbjct: 357 RFQKIDVNEPSIDDAIAIMKGLKPYFEDYHHLRYSNEAIKAAVELSARYISDRKLPDKAI 416

Query: 418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGT 477
           DVIDE GA+Q+L P SKRRK ITE++I+ TIA+M R I   + S+DD+ VL+NLEK L +
Sbjct: 417 DVIDETGAAQMLLPASKRRKLITEREIEATIATMAR-IPPKTVSKDDEMVLANLEKELRS 475

Query: 478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLR 537
           VVYGQ+ AI+ L+++IK+ARAGL +PNKPIG YVFSGPTGVGKTE++KQLA +LGV++LR
Sbjct: 476 VVYGQDIAIEALATAIKLARAGLREPNKPIGSYVFSGPTGVGKTEVAKQLAASLGVEMLR 535

Query: 538 FDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL 597
           FDMSEYMERH VSRL+GAPPGYVGF QGG+L D VDQ+P+SVVLLDEIEK+HPD+ NILL
Sbjct: 536 FDMSEYMERHTVSRLLGAPPGYVGFDQGGLLTDGVDQHPHSVVLLDEIEKAHPDIYNILL 595

Query: 598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP 657
           Q+MD+G LTD +GKKI FRNVILIMTTNAGA EM+K+ IGFGSSR    D+EA+    +P
Sbjct: 596 QVMDHGSLTDHNGKKIDFRNVILIMTTNAGASEMAKSAIGFGSSRRTGEDEEAINRLFTP 655

Query: 658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVK 717
           EF NRLD+IIPF PL + +I +VV KF+M+LE QL E+ ++F   E+ I+WL   GYD K
Sbjct: 656 EFRNRLDAIIPFSPLPTAVIHKVVQKFVMQLETQLSERNVTFDLHEDAISWLAEKGYDEK 715

Query: 718 MGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEI 769
           MGARPL R+I+EH+K PLA+EILFGKLKK GGVV V++      +  +  E+
Sbjct: 716 MGARPLSRVIQEHIKKPLANEILFGKLKK-GGVVSVTVGKKDDGADGLILEV 766


>gi|254714239|ref|ZP_05176050.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella ceti
           M644/93/1]
 gi|254717675|ref|ZP_05179486.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella ceti
           M13/05/1]
 gi|261219516|ref|ZP_05933797.1| ATP-dependent Clp protease [Brucella ceti M13/05/1]
 gi|261322011|ref|ZP_05961208.1| ATP-dependent Clp protease [Brucella ceti M644/93/1]
 gi|260924605|gb|EEX91173.1| ATP-dependent Clp protease [Brucella ceti M13/05/1]
 gi|261294701|gb|EEX98197.1| ATP-dependent Clp protease [Brucella ceti M644/93/1]
          Length = 824

 Score = 1020 bits (2637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/768 (63%), Positives = 613/768 (79%), Gaps = 8/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +CNVDL  LK+ +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACNVDLDYLKHIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LITGYDEDSKPTAAFQRVIQRAVIHVQSSNRDEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGISKR + +  ++   V+ +S    G       + K D
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGISKRPQGSEPRTPRGVESASEERTGIEQEEAPKKKQD 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYC++L +K K G++D L+GR  EINRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 -----ALSAYCINLNKKAKAGRIDPLIGRDSEINRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VPD L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E +  A+L
Sbjct: 235 IAEGLAKRIVEGQVPDALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEFPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFE+ H+++Y+ +AI++AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDTIEIMKGLKPYFEDFHKVKYTVDAIKSAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+LE  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEEVLSHLEAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIDALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PEF 
Sbjct: 594 DHGALTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL   +I QVV KF+++LE QL E+G++F  ++  I WL   GYD +MGA
Sbjct: 654 NRLDAIIPFGPLPVPVIHQVVQKFVLQLEAQLAERGVTFELTDAAIAWLADKGYDERMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RPL R+I+EH+K PLADE+LFGKLK  GG V+V +   +  ++ +  E
Sbjct: 714 RPLARVIQEHIKKPLADEVLFGKLKH-GGTVRVDVTTKEDGNTDLMLE 760


>gi|163843433|ref|YP_001627837.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella suis
           ATCC 23445]
 gi|163674156|gb|ABY38267.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella suis
           ATCC 23445]
          Length = 824

 Score = 1019 bits (2636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/768 (63%), Positives = 612/768 (79%), Gaps = 8/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +CNVDL  LK+ +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACNVDLDYLKHIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LITGYDEDSKPTAAFQRVIQRAVIHVQSSNRDEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGISKR + +  ++   V+ +S    G       + K D
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGISKRPQGSEPRTPRGVESASEERTGIEQEEAPKKKQD 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYC++L EK K G++D L+GR  EINRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 -----ALSAYCINLNEKAKAGRIDPLIGRDSEINRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VPD L  A IFSLDMG L+AG RYRGDFEER+K++VKE+E +  A+L
Sbjct: 235 IAEGLAKRIVEGQVPDALADATIFSLDMGTLLAGARYRGDFEERLKQVVKELEEFPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFE+ H+++Y+ +AI++AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDTIEIMKGLKPYFEDFHKVKYTVDAIKSAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+LE  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEEVLSHLEAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIDALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PEF 
Sbjct: 594 DHGALTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL   +I QV+ KF+++LE QL E+G++F  ++  I WL   GYD +MGA
Sbjct: 654 NRLDAIIPFGPLPVPVIHQVMQKFVLQLEAQLAERGVTFELTDAAIAWLADKGYDERMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RPL R+I+EH+K PLADE+LFGKLK  GG V+V +   +  ++ +  E
Sbjct: 714 RPLARVIQEHIKKPLADEVLFGKLKH-GGTVRVDVTTKEDGNTDLMLE 760


>gi|153009351|ref|YP_001370566.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561239|gb|ABS14737.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Ochrobactrum
           anthropi ATCC 49188]
          Length = 824

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/759 (65%), Positives = 610/759 (80%), Gaps = 8/759 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +C+VDL+ LK  +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACSVDLEHLKRIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LVTGYDEDSKPTAAFQRVIQRAVIHVQSSNREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGISKR +  N +++      SA  +      +  AK  
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGISKRPQ--NSETRPPRGAESANEERTSTEQEESAKKK 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            +   ALSAYCV+L EK K G++D L+GR  EI+RTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 178 QD---ALSAYCVNLNEKAKAGRIDPLIGRDSEISRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VP+ L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E Y  A+L
Sbjct: 235 IAEGLAKRIVEGQVPEALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEYPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI DAIEI+KG+KPYFE+ H+++Y+ +AI+ AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDAIEIMKGLKPYFEDFHKVKYTVDAIKTAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+L+  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEQVLSHLDAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIEALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PEF 
Sbjct: 594 DHGSLTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL   +I QVV KF+++LE QL E+G++F  +E  I WL   GYD +MGA
Sbjct: 654 NRLDAIIPFGPLPVPVIHQVVQKFVLQLEAQLAERGVTFELTEGAIAWLADKGYDERMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV-VKVSLNPD 758
           RPL R+I+EH+K PLADE+LFGKLK GG V V V   PD
Sbjct: 714 RPLARVIQEHIKKPLADEVLFGKLKHGGTVRVDVVTKPD 752


>gi|294852508|ref|ZP_06793181.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brucella sp.
           NVSL 07-0026]
 gi|294821097|gb|EFG38096.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brucella sp.
           NVSL 07-0026]
          Length = 824

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/768 (63%), Positives = 612/768 (79%), Gaps = 8/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +CNVDL  LK+ +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACNVDLDYLKHIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LITGYDEDSKPTAAFQRVIQRAVIHVQSSNRDEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGISKR + +  ++   V+ +S    G       + K D
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGISKRPQGSEPRTPRGVESASEERTGIEQEEAPKKKRD 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYC++L EK K G++D L+GR  EINRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 -----ALSAYCINLNEKAKAGRIDPLIGRDSEINRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VPD L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E +  A+L
Sbjct: 235 IAEGLAKRIVEGQVPDALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEFPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFE+ H+++Y+ +AI++AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDTIEIMKGLKPYFEDFHKVKYTVDAIKSAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+LE  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEEVLSHLEAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIDALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME H VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMESHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PEF 
Sbjct: 594 DHGALTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL   +I QVV KF+++LE QL E+G++F  ++  I WL   GYD +MGA
Sbjct: 654 NRLDAIIPFGPLPVPVIHQVVQKFVLQLEAQLAERGVTFELTDAAIAWLADKGYDERMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RPL R+I+EH+K PLADE+LFGKLK  GG V+V +   +  ++ +  E
Sbjct: 714 RPLARVIQEHIKKPLADEVLFGKLKH-GGTVRVDVTTKEDGNTDLMLE 760


>gi|227821889|ref|YP_002825859.1| ATP-dependent specificity subunit of ClpA-ClpP serine protease
           [Sinorhizobium fredii NGR234]
 gi|227340888|gb|ACP25106.1| ATP-dependent specificity subunit of ClpA-ClpP serine protease
           [Sinorhizobium fredii NGR234]
          Length = 830

 Score = 1018 bits (2633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/755 (66%), Positives = 617/755 (81%), Gaps = 6/755 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNV+L+ L+  +
Sbjct: 1   MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMGACNVNLETLRKTV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +Y+DN+ SN L  G+  + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  TDYVDNELSN-LITGYDEDSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQEMT YDAVNFISHGI KR    + +S+  V G+      +    + +    
Sbjct: 120 HAAYFLQEQEMTRYDAVNFISHGIGKRP--GSSESR-QVRGAEDQESEQKAPRESEETGP 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+AYCV+L EK K GK+D L+GRH E+NRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 177 KKQQDALTAYCVNLNEKAKSGKIDPLIGRHAEVNRTIQVLCRRSKNNPLYVGDPGVGKTA 236

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+  VP+ L  A IF+LDMG L+AGTRYRGDFEER+K++VKE+E Y  A+L
Sbjct: 237 IAEGLAKRIVEKQVPEALQDATIFALDMGTLLAGTRYRGDFEERLKQVVKELEEYHGAVL 296

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSG++RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 297 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGSIRCIGSTTYKEYRQFFEKDRALVRRFQ 356

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ DAIEI++G+KPYFEE+H L+YS EAIRAAV+LS R+   RKLPDKAIDVI
Sbjct: 357 KIDVNEPTVADAIEIMRGLKPYFEEYHHLKYSNEAIRAAVELSARYINDRKLPDKAIDVI 416

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L P+ KRRK ITE++I+ T+A+M R I   S S+DD++VL+NLEK L +VVY
Sbjct: 417 DESGAAQMLLPVHKRRKLITEREIEATVATMAR-IPPKSVSKDDEAVLANLEKELRSVVY 475

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L+SSIK+ARAGL +PNKPIGCYVFSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 476 GQDLAIEALASSIKLARAGLREPNKPIGCYVFSGPTGVGKTEVAKQLATSLGVELLRFDM 535

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRL+GAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 536 SEYMERHTVSRLLGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 595

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M++  IGFGSS+ +  D EAL    +PEF 
Sbjct: 596 DHGSLTDHNGKKIDFRNVILIMTTNAGASDMARPAIGFGSSKREGEDIEALNKLFTPEFR 655

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++IPF  L + +I QVV KF+M+LE QL E+ ++F  + E I WL   GYD KMGA
Sbjct: 656 NRLDAVIPFNSLPTPVIHQVVQKFVMQLETQLAERNVTFDLAPEAIAWLADKGYDEKMGA 715

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           RPL R+I+E++K PLADEILFGKLKK GGVVKV++
Sbjct: 716 RPLARVIQENIKKPLADEILFGKLKK-GGVVKVTI 749


>gi|306844033|ref|ZP_07476628.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella sp.
           BO1]
 gi|306275788|gb|EFM57512.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella sp.
           BO1]
          Length = 824

 Score = 1018 bits (2633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/750 (65%), Positives = 604/750 (80%), Gaps = 7/750 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +CNVDL  LK+ +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACNVDLDYLKHIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LITGYDEDSKPTAAFQRVIQRAVIHVQSSNRDEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGISKR + +  ++   V+ +S    G       + K D
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGISKRPQGSEPRTPRGVESASEERTGIEQEEAPKKKQD 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYC++L EK K G++D L+GR  EINRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 -----ALSAYCINLNEKAKAGRIDPLIGRDSEINRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VP  L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E +  A+L
Sbjct: 235 IAEGLAKRIVEGQVPAALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEFPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFE+ H+++Y+ +AI++AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDTIEIMKGLKPYFEDFHKVKYTVDAIKSAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+LE  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEEVLSHLEAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIDALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PEF 
Sbjct: 594 DHGALTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL   +I QVV KF+++LE QL E+G++F  ++  I WL   GYD +MGA
Sbjct: 654 NRLDAIIPFGPLPVPVIHQVVQKFVLQLEAQLAERGVTFELTDAAIAWLADKGYDERMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RPL R+I+EH+K PLADE+LFGKLK GG V
Sbjct: 714 RPLARVIQEHIKKPLADEVLFGKLKHGGTV 743


>gi|239832058|ref|ZP_04680387.1| ATP-dependent Clp protease ATP-binding subunit clpA [Ochrobactrum
           intermedium LMG 3301]
 gi|239824325|gb|EEQ95893.1| ATP-dependent Clp protease ATP-binding subunit clpA [Ochrobactrum
           intermedium LMG 3301]
          Length = 824

 Score = 1018 bits (2631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/759 (65%), Positives = 607/759 (79%), Gaps = 8/759 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +C+VDL+ LK  +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACSVDLEHLKRIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LVTGYDEDSKPTAAFQRVIQRAVIHVQSSNREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGISKR      QS        A S  E   +  Q ++ 
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGISKRP-----QSSETRPPRGAESPSEERTSTEQEESA 174

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYCV+L EK K G++D L+GR  EI+RTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 175 KKKQDALSAYCVNLNEKAKAGRIDPLIGRDSEISRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VP+ L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E Y  A+L
Sbjct: 235 IAEGLAKRIVEGQVPEALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEYPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI DAIEI+KG+KPYFE+ H+++Y+ +AI+ AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDAIEIMKGLKPYFEDFHKVKYTVDAIKTAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+L+  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEQVLSHLDAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIEALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PEF 
Sbjct: 594 DHGSLTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL   +I QVV KF+++LE QL E+G++F  +E  I WL   GYD +MGA
Sbjct: 654 NRLDAIIPFGPLPVPVIHQVVQKFVLQLEAQLAERGVTFELTEGAIAWLADKGYDERMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV-VKVSLNPD 758
           RPL R+I+EH+K PLADE+LFGKLK GG V V V   PD
Sbjct: 714 RPLGRVIQEHIKKPLADEVLFGKLKHGGTVRVDVVTKPD 752


>gi|148559573|ref|YP_001259087.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brucella ovis
           ATCC 25840]
 gi|148370830|gb|ABQ60809.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brucella ovis
           ATCC 25840]
          Length = 824

 Score = 1017 bits (2630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/750 (65%), Positives = 604/750 (80%), Gaps = 7/750 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +CNVDL  LK+ +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACNVDLDYLKHIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LITGYDEDSKPTAAFQRVIQRAVIHVQSSNRDEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGISKR + +  ++   V+ +S    G       + K D
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGISKRPQGSEPRTPRGVESASEERTGIEQEEAPKKKQD 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYC++L EK K G++D L+GR  EINRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 -----ALSAYCINLNEKAKAGRIDPLIGRDSEINRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G V D L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E +  A+L
Sbjct: 235 IAEGLAKRIVEGQVLDALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEFPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFE+ H+++Y+ +AI++AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDTIEIMKGLKPYFEDFHKVKYTVDAIKSAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+LE  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEEVLSHLEAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIDALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PEF 
Sbjct: 594 DHGALTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL   +I QVV KF+++LE QL E+G++F  ++  I WL   GYD +MGA
Sbjct: 654 NRLDAIIPFGPLPVPVIHQVVQKFVLQLEAQLAERGVTFELTDAAIAWLADKGYDERMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RPL R+I+EH+K PLADE+LFGKLK GG V
Sbjct: 714 RPLARVIQEHIKKPLADEVLFGKLKHGGAV 743


>gi|260459201|ref|ZP_05807456.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Mesorhizobium
           opportunistum WSM2075]
 gi|259034755|gb|EEW36011.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Mesorhizobium
           opportunistum WSM2075]
          Length = 822

 Score = 1017 bits (2629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/792 (62%), Positives = 619/792 (78%), Gaps = 17/792 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS+ LEK LHQAL LANER+HEYATLEHLLLALIDD++AA VM +CNVDL  LK+ +
Sbjct: 1   MPAFSQGLEKALHQALTLANERHHEYATLEHLLLALIDDTEAAAVMRACNVDLDELKHTV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           L YID +  N L  G+  + KPT+ FQRV+QRAV+HVQS+GR  V+GAN+LVA+F+E +S
Sbjct: 61  LTYIDTELDN-LVTGYDEDSKPTAGFQRVIQRAVIHVQSSGREEVSGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDG-----EGFVNDY 175
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +S    D    G +G     EG     
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGIAKRPGASETRSPRGADDEQGGQNGAEPQEEGGKKKQ 179

Query: 176 QAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPG 235
           Q         AL+AYCV+L  K K GK+D L+GR  EINRTIQ+LCRRSKNNPLYVGDPG
Sbjct: 180 QQD-------ALTAYCVNLNNKAKAGKIDPLIGRESEINRTIQVLCRRSKNNPLYVGDPG 232

Query: 236 VGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY 295
           VGKTAIAEG AK+IV+G VP++L  A IF+LDMG L+AGTRYRGDFEER+K++VKE+E Y
Sbjct: 233 VGKTAIAEGLAKRIVEGDVPEVLHNATIFALDMGTLLAGTRYRGDFEERLKQVVKELEDY 292

Query: 296 ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKAL 355
             A+L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY E+RQFFEKD+AL
Sbjct: 293 PGAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEFRQFFEKDRAL 352

Query: 356 VRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK 415
           VRRFQKIDV+EP+IEDAIEI+KG+KPYFEE H++RY+ EAI+A+V+LS R+   RKLPDK
Sbjct: 353 VRRFQKIDVNEPTIEDAIEIMKGLKPYFEEFHKVRYTSEAIKASVELSARYINDRKLPDK 412

Query: 416 AIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNL 475
           AIDVIDE GASQ+L P +KR+K I  K+I+ TIA+M R I   + S DD+ VL  L+  L
Sbjct: 413 AIDVIDETGASQMLVPEAKRKKTIGIKEIEATIATMAR-IPPKTVSADDEKVLQGLDIEL 471

Query: 476 GTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQL 535
             VVYGQ+ AI  L+S+IK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA +LGV+L
Sbjct: 472 KRVVYGQDTAITALTSAIKLARAGLREPEKPIGSYLFSGPTGVGKTEVAKQLAASLGVEL 531

Query: 536 LRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNI 595
           +RFDMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPD+ NI
Sbjct: 532 IRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEVEKAHPDLFNI 591

Query: 596 LLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFL 655
           LLQ+MD+G LTD +GK+I FRNVILIMTTNAGA +  +A IGFGS++ +  D EA+    
Sbjct: 592 LLQVMDHGKLTDHNGKQIDFRNVILIMTTNAGASDAQRAAIGFGSTKREGDDVEAINRLF 651

Query: 656 SPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYD 715
           +PEF NRLD+IIPF  L   +I QVV KF+M+LE QL E+G++F  S + I WL   GYD
Sbjct: 652 TPEFRNRLDAIIPFGSLPVPVIHQVVQKFVMQLEAQLSERGVTFDLSSDAIAWLADKGYD 711

Query: 716 VKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSN 775
            +MGARPL R+I+EH+K PLADE+LFGKLKK GG V+V++  +K  +     ++E+    
Sbjct: 712 ERMGARPLGRVIQEHIKKPLADEVLFGKLKK-GGTVRVTV--EKKETGETGLKLESLADE 768

Query: 776 ISLETEEKEVED 787
             ++ +++E ED
Sbjct: 769 APVKPKKEEPED 780


>gi|307317005|ref|ZP_07596446.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Sinorhizobium
           meliloti AK83]
 gi|306897093|gb|EFN27838.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Sinorhizobium
           meliloti AK83]
          Length = 838

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/768 (64%), Positives = 619/768 (80%), Gaps = 6/768 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNV+L  L+  +
Sbjct: 1   MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMGACNVNLDTLRKTV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +Y+DN+ SN L  G+  + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  TDYVDNELSN-LVTGYDEDSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQEMT YDAVNFISHGI KR   +  +    V G+      +    + +    
Sbjct: 120 HAAYFLQEQEMTRYDAVNFISHGIGKRPGSSEARP---VRGAEDQDSEQKASRESEEAGP 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+AYCV+L EK K GK+D L+GRH E+NRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 177 KKQQDALTAYCVNLNEKAKSGKIDPLIGRHAEVNRTIQVLCRRSKNNPLYVGDPGVGKTA 236

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+I++  VP+ L  A IF+LDMG L+AGTRYRGDFEER+K++VKE+E Y  A+L
Sbjct: 237 IAEGLAKRIIEKKVPEALQDATIFALDMGTLLAGTRYRGDFEERLKQVVKELEDYPGAVL 296

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 297 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 356

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+I D IEI+KG+KPYFE++HQL+Y+ +AI+AAV+LS R+   RKLPDKAIDVI
Sbjct: 357 KIDVNEPTIADTIEIMKGLKPYFEDYHQLKYTNDAIKAAVELSARYINDRKLPDKAIDVI 416

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L P+SKRRK ITE++I+ T+A+M R I   + S+DD++VL+NLE+ L +VVY
Sbjct: 417 DESGAAQMLLPVSKRRKLITEREIEATVATMAR-IPPKTVSKDDEAVLANLEQELRSVVY 475

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L+SSIK+ARAGL +PNKPIGCYVFSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 476 GQDLAIEALASSIKLARAGLREPNKPIGCYVFSGPTGVGKTEVAKQLATSLGVELLRFDM 535

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 536 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 595

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M++A IGFGSS+    D EAL    +PEF 
Sbjct: 596 DHGSLTDHNGKKIDFRNVILIMTTNAGASDMARAAIGFGSSKRTGEDVEALNRLFTPEFR 655

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDS+IPF  L + +I +VV KF+M+LE QL E+ ++F  + + I WL   GYD KMGA
Sbjct: 656 NRLDSVIPFNSLPTPVIHKVVQKFVMQLETQLAERNVTFDLAPDAIAWLAERGYDEKMGA 715

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RPL R+I+E++K PLADEILFGKLKK GGVVKV++   +  +  +  E
Sbjct: 716 RPLARVIQENIKKPLADEILFGKLKK-GGVVKVTIGNKEDGTKGLMLE 762


>gi|15965240|ref|NP_385593.1| ATP-dependent Clp protease ATP-binding subunit protein
           [Sinorhizobium meliloti 1021]
 gi|307309263|ref|ZP_07588931.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Sinorhizobium
           meliloti BL225C]
 gi|15074420|emb|CAC46066.1| Probable ATP-dependent CLP protease ATP-binding subunit
           [Sinorhizobium meliloti 1021]
 gi|306900264|gb|EFN30881.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Sinorhizobium
           meliloti BL225C]
          Length = 838

 Score = 1016 bits (2626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/768 (64%), Positives = 619/768 (80%), Gaps = 6/768 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNV+L  L+  +
Sbjct: 1   MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMGACNVNLDTLRKTV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +Y+DN+ SN L  G+  + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  TDYVDNELSN-LVTGYDEDSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQEMT YDAVNFISHGI KR   +  +    V G+      +    + +    
Sbjct: 120 HAAYFLQEQEMTRYDAVNFISHGIGKRPGSSEARP---VRGAEDQDSEQKASRESEEAGP 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+AYCV+L EK K GK+D L+GRH E+NRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 177 KKQQDALTAYCVNLNEKAKSGKIDPLIGRHAEVNRTIQVLCRRSKNNPLYVGDPGVGKTA 236

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+I++  VP+ L  A IF+LDMG L+AGTRYRGDFEER+K++VKE+E Y  A+L
Sbjct: 237 IAEGLAKRIIEKKVPEALQDATIFALDMGTLLAGTRYRGDFEERLKQVVKELEDYPGAVL 296

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 297 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 356

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+I D IEI+KG+KPYFE++HQL+Y+ +AI+AAV+LS R+   RKLPDKAIDVI
Sbjct: 357 KIDVNEPTIADTIEIMKGLKPYFEDYHQLKYTNDAIKAAVELSARYINDRKLPDKAIDVI 416

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L P+SKRRK ITE++I+ T+A+M R I   + S+DD++VL+NLE+ L +VVY
Sbjct: 417 DESGAAQMLLPVSKRRKLITEREIEATVATMAR-IPPKTVSKDDEAVLANLEQELRSVVY 475

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L+SSIK+ARAGL +PNKPIGCYVFSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 476 GQDLAIEALASSIKLARAGLREPNKPIGCYVFSGPTGVGKTEVAKQLATSLGVELLRFDM 535

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 536 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 595

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M++A IGFGSS+    D EAL    +PEF 
Sbjct: 596 DHGSLTDHNGKKIDFRNVILIMTTNAGASDMARAAIGFGSSKRTGEDVEALNRLFTPEFR 655

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDS+IPF  L + +I +VV KF+M+LE QL E+ ++F  + + I WL   GYD KMGA
Sbjct: 656 NRLDSVIPFNSLPTPVIHKVVQKFVMQLETQLAERNVTFDLAPDAIAWLAERGYDEKMGA 715

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RPL R+I+E++K PLADEILFGKLKK GGVVKV++   +  +  +  E
Sbjct: 716 RPLARVIQENIKKPLADEILFGKLKK-GGVVKVTIGNKEDGTKGLMLE 762


>gi|13470854|ref|NP_102423.1| endopeptidase Clp ATP-binding chain A [Mesorhizobium loti
           MAFF303099]
 gi|14021597|dbj|BAB48209.1| endopeptidase Clp ATP-binding chain A [Mesorhizobium loti
           MAFF303099]
          Length = 822

 Score = 1016 bits (2626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/792 (62%), Positives = 619/792 (78%), Gaps = 17/792 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS+ LEK LHQAL LANER+HEYATLEHLLLALIDD++AA VM +CNVDL  LK+ +
Sbjct: 1   MPAFSQGLEKALHQALTLANERHHEYATLEHLLLALIDDTEAAAVMRACNVDLDELKHTV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           L YID +  N L  G+  + KPT+ FQRV+QRAV+HVQS+GR  V+GAN+LVA+F+E +S
Sbjct: 61  LTYIDTELDN-LVTGYDEDSKPTAGFQRVIQRAVIHVQSSGREEVSGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDG-----EGFVNDY 175
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +S    D    G +G     EG     
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGIAKRPGASETRSPRGADDEQGGQNGAEPQEEGGKKKQ 179

Query: 176 QAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPG 235
           Q         AL+AYCV+L  K K GK+D L+GR  EINRTIQ+LCRRSKNNPLYVGDPG
Sbjct: 180 QQD-------ALTAYCVNLNNKAKAGKIDPLIGRESEINRTIQVLCRRSKNNPLYVGDPG 232

Query: 236 VGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY 295
           VGKTAIAEG AK+IV+G VP++L  A IF+LDMG L+AGTRYRGDFEER+K++VKE+E Y
Sbjct: 233 VGKTAIAEGLAKRIVEGDVPEVLHNATIFALDMGTLLAGTRYRGDFEERLKQVVKELEDY 292

Query: 296 ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKAL 355
             A+L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY E+RQFFEKD+AL
Sbjct: 293 PGAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEFRQFFEKDRAL 352

Query: 356 VRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK 415
           VRRFQKIDV+EP+IEDAIEI+KG+KPYFEE H++RY+ EAI+A+V+LS R+   RKLPDK
Sbjct: 353 VRRFQKIDVNEPTIEDAIEIMKGLKPYFEEFHKVRYTSEAIKASVELSARYINDRKLPDK 412

Query: 416 AIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNL 475
           AIDVIDE GASQ+L P +KR+K I  K+I+ TIA+M R I   + S DD+ VL  L+  L
Sbjct: 413 AIDVIDETGASQMLVPEAKRKKTIGIKEIEATIATMAR-IPPKTVSADDEKVLQGLDIEL 471

Query: 476 GTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQL 535
             VVYGQ+ AI  L+S+IK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA +LGV+L
Sbjct: 472 KRVVYGQDTAITALTSAIKLARAGLREPEKPIGSYLFSGPTGVGKTEVAKQLAASLGVEL 531

Query: 536 LRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNI 595
           +RFDMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPD+ NI
Sbjct: 532 IRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEVEKAHPDLFNI 591

Query: 596 LLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFL 655
           LLQ+MD+G LTD +GK+I FRNVILIMTTNAGA +  +A IGFGS++ +  D EA+    
Sbjct: 592 LLQVMDHGKLTDHNGKQIDFRNVILIMTTNAGASDAQRAAIGFGSTKREGDDVEAINRLF 651

Query: 656 SPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYD 715
           +PEF NRLD+IIPF  L   +I QVV KF+M+LE QL E+G++F  S + I WL   GYD
Sbjct: 652 TPEFRNRLDAIIPFGSLPVPVIHQVVQKFVMQLEAQLSERGVTFDLSPDAIAWLADKGYD 711

Query: 716 VKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSN 775
            +MGARPL R+I+EH+K PLADE+LFGKLKK GG V+V++  +K  +     ++E+    
Sbjct: 712 ERMGARPLGRVIQEHIKKPLADEVLFGKLKK-GGTVRVTV--EKKETGETGLKLESLADE 768

Query: 776 ISLETEEKEVED 787
             ++ +++E ED
Sbjct: 769 APVKPKKEEPED 780


>gi|150396336|ref|YP_001326803.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Sinorhizobium
           medicae WSM419]
 gi|150027851|gb|ABR59968.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Sinorhizobium
           medicae WSM419]
          Length = 838

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/768 (64%), Positives = 620/768 (80%), Gaps = 6/768 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNV+L  L+  +
Sbjct: 1   MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMGACNVNLDTLRKTV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +Y+DN+ SN L  G+  + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  TDYVDNELSN-LVTGYDEDSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQEMT YDAVNFISHGI KR   +  +    V G+      +    + +    
Sbjct: 120 HAAYFLQEQEMTRYDAVNFISHGIGKRPGSSEARP---VRGAEDQDSEQKASRESEETGP 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+AYCV+L EK K GK+D L+GRH E+NRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 177 KKQQDALTAYCVNLNEKAKSGKIDPLIGRHAEVNRTIQVLCRRSKNNPLYVGDPGVGKTA 236

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+I++  VP+ L  A IF+LDMG L+AGTRYRGDFEER+K++VKE+E Y  A+L
Sbjct: 237 IAEGLAKRIIEKKVPEALQDATIFALDMGTLLAGTRYRGDFEERLKQVVKELEDYPGAVL 296

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 297 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 356

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+I DAIEI+KG+KPYFE++H+L+Y+ +AI+AAV+LS R+   RKLPDKAIDVI
Sbjct: 357 KIDVNEPTIADAIEIMKGLKPYFEDYHRLKYTNDAIKAAVELSARYINDRKLPDKAIDVI 416

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L P+SKRRK ITE++I+ TIA+M R I   + S+DD++VL+NLE+ L +VVY
Sbjct: 417 DESGAAQMLLPVSKRRKLITEREIEATIATMAR-IPPKTVSKDDEAVLANLEQELRSVVY 475

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L+SSIK+ARAGL +PNKPIGCYVFSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 476 GQDLAIEALASSIKLARAGLREPNKPIGCYVFSGPTGVGKTEVAKQLATSLGVELLRFDM 535

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 536 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 595

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M++A IGFGSS+    D EAL    +PEF 
Sbjct: 596 DHGSLTDHNGKKIDFRNVILIMTTNAGASDMARAAIGFGSSKRTGEDVEALNRLFTPEFR 655

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++IPF  L + +I +VV KF+M+LE QL E+ ++F  + + I WL   GYD KMGA
Sbjct: 656 NRLDAVIPFNSLPTPVIHKVVQKFVMQLETQLAERNVTFDLAPDAIAWLAERGYDEKMGA 715

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RPL R+I+E++K PLADEILFGKLKK GGVVKV++   +  +  +  E
Sbjct: 716 RPLSRVIQENIKKPLADEILFGKLKK-GGVVKVTIGTKEDGAKGLMLE 762


>gi|254719231|ref|ZP_05181042.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella sp.
           83/13]
 gi|265984226|ref|ZP_06096961.1| ATP-dependent Clp protease [Brucella sp. 83/13]
 gi|306837980|ref|ZP_07470838.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella sp.
           NF 2653]
 gi|264662818|gb|EEZ33079.1| ATP-dependent Clp protease [Brucella sp. 83/13]
 gi|306406904|gb|EFM63125.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella sp.
           NF 2653]
          Length = 824

 Score = 1014 bits (2621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/768 (63%), Positives = 610/768 (79%), Gaps = 8/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +CNVDL  LK+ +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACNVDLDYLKHIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LITGYDEDSKPTAAFQRVIQRAVIHVQSSNRDEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISH ISKR + +  ++   V+ +S    G       + K D
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHDISKRPQGSEPRTPRGVESASEERTGIEQEEAPKKKQD 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYC++L EK K G++D L+GR  EINRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 -----ALSAYCINLNEKAKAGRIDPLIGRDSEINRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VP  L    IFSLDMG L+AGTRYRGDFEER+K++VKE+E +  A+L
Sbjct: 235 IAEGLAKRIVEGQVPAALADTTIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEFPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFE+ H+++Y+ +AI++AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDTIEIMKGLKPYFEDFHKVKYTVDAIKSAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+LE  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEEVLSHLEAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIDALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PEF 
Sbjct: 594 DHGALTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF PL   +I QVV KF+++LE QL E+G++F  ++  I WL   GYD +MGA
Sbjct: 654 NRLDAIIPFGPLPVPVIHQVVQKFVLQLEAQLAERGVTFELTDAAIAWLADKGYDERMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RPL R+I+EH+K PLADE+LFGKLK  GG V+V +   +  ++ +  E
Sbjct: 714 RPLARVIQEHIKKPLADEVLFGKLKH-GGTVRVDVTTREDGNTDLMLE 760


>gi|319783683|ref|YP_004143159.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317169571|gb|ADV13109.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 822

 Score = 1013 bits (2620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/789 (62%), Positives = 615/789 (77%), Gaps = 15/789 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS+ LEK LHQAL LANER+HEYATLEHLLLALIDD++AA VM +CNVDL  LK+ +
Sbjct: 1   MPAFSQGLEKALHQALTLANERHHEYATLEHLLLALIDDTEAAAVMRACNVDLDELKHTV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           L YID +  N L  G+  + KPT+ FQRV+QRAV+HVQS+GR  V+GAN+LVA+F+E +S
Sbjct: 61  LTYIDTELDN-LVTGYDEDSKPTAGFQRVIQRAVIHVQSSGREEVSGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDG-----EGFVNDY 175
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +S    D    G +G     EG     
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGIAKRPGASETRSPRGADDEQGGQNGAEPQEEGGKKKQ 179

Query: 176 QAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPG 235
           Q         AL+AYCV+L  K K GK+D L+GR  EINRTIQ+LCRRSKNNPLYVGDPG
Sbjct: 180 QQD-------ALTAYCVNLNNKAKAGKIDPLIGRESEINRTIQVLCRRSKNNPLYVGDPG 232

Query: 236 VGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY 295
           VGKTAIAEG AK+IV+G VP++L  A IF+LDMG L+AGTRYRGDFEER+K++VKE+E Y
Sbjct: 233 VGKTAIAEGLAKRIVEGDVPEVLHNATIFALDMGTLLAGTRYRGDFEERLKQVVKELEDY 292

Query: 296 ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKAL 355
             A+L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY E+RQFFEKD+AL
Sbjct: 293 PGAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEFRQFFEKDRAL 352

Query: 356 VRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK 415
           VRRFQKIDV+EP+IEDAIEI+KG+KPY+EE H+++++ EAI+A+V+LS R+   RKLPDK
Sbjct: 353 VRRFQKIDVNEPTIEDAIEIMKGLKPYYEEFHKVKFTNEAIKASVELSARYINDRKLPDK 412

Query: 416 AIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNL 475
           AIDVIDE GASQ+L P +KR+K I  K+I+ TIA+M R I   + S DD+ VL  L+  L
Sbjct: 413 AIDVIDETGASQMLVPEAKRKKTIGIKEIEATIATMAR-IPPKTVSADDEKVLQGLDIEL 471

Query: 476 GTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQL 535
             VVYGQ+ AI  L+S+IK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA +LGV+L
Sbjct: 472 KRVVYGQDTAITALTSAIKLARAGLREPEKPIGSYLFSGPTGVGKTEVAKQLAASLGVEL 531

Query: 536 LRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNI 595
           +RFDMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPD+ NI
Sbjct: 532 IRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEVEKAHPDLFNI 591

Query: 596 LLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFL 655
           LLQ+MD+G LTD +GK+I FRNVILIMTTNAGA +  +A IGFGS++ +  D EA+    
Sbjct: 592 LLQVMDHGKLTDHNGKQIDFRNVILIMTTNAGASDAQRAAIGFGSTKREGDDVEAINRLF 651

Query: 656 SPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYD 715
           +PEF NRLD+IIPF  L   +I QVV KF+M+LE QL E+G++F  S + I WL   GYD
Sbjct: 652 TPEFRNRLDAIIPFGSLPVPVIHQVVQKFVMQLEAQLSERGVTFDLSADAIAWLADKGYD 711

Query: 716 VKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSN 775
            +MGARPL R+I+EH+K PLADE+LFGKLKK GG V+V++   ++  + +  E     + 
Sbjct: 712 ERMGARPLGRVIQEHIKKPLADEVLFGKLKK-GGTVRVTVEKKETGETGLKLESLADEAP 770

Query: 776 ISLETEEKE 784
           +  + EE E
Sbjct: 771 VKPKKEEPE 779


>gi|110633726|ref|YP_673934.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Mesorhizobium
           sp. BNC1]
 gi|110284710|gb|ABG62769.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Chelativorans
           sp. BNC1]
          Length = 819

 Score = 1012 bits (2617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/755 (64%), Positives = 605/755 (80%), Gaps = 6/755 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS+ LE+ LHQAL  ANER+HEYATLEHLLLALIDD+DAA VM +CNVDL  L+  +
Sbjct: 1   MPAFSQGLERALHQALTYANERHHEYATLEHLLLALIDDNDAAAVMRACNVDLDELRRTV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT+ FQRV+QRAV+HVQS+GR  V+GAN+LVA+F+E +S
Sbjct: 61  TDYIDTELDN-LVTGYDEDSKPTAGFQRVIQRAVIHVQSSGREEVSGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  ++    D   AGS G       + K  
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGIAKRPGASEARTPRGADEDQAGSTGAETEEGAKKKQQ 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            +   ALSAYCV+L  K + G++D L+GR  EI+RTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 QD---ALSAYCVNLNAKARAGRIDPLIGRESEISRTIQVLCRRSKNNPLYVGDPGVGKTA 236

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VPD+L  A IF+LDMG L+AGTRYRGDFEER+K++VKE+E +  AIL
Sbjct: 237 IAEGLAKRIVEGDVPDVLADATIFALDMGTLLAGTRYRGDFEERLKQVVKELEDFPGAIL 296

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY E+RQFFEKD+ALVRRFQ
Sbjct: 297 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEFRQFFEKDRALVRRFQ 356

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ DAIEI+KG+KPYFE+ H+++Y+ EA++AAV+LS R+   RKLPDKAIDVI
Sbjct: 357 KIDVNEPTVLDAIEIMKGLKPYFEDFHRVKYTNEAVKAAVELSARYINDRKLPDKAIDVI 416

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ L P SKRRK IT K+I+ TIA+M R I   + S DD+ VL+ LE  L  VVY
Sbjct: 417 DETGASQKLLPESKRRKTITVKEIETTIATMAR-IPPKTVSADDEKVLAGLETELKRVVY 475

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L+S+IK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 476 GQDKAIEALASAIKLARAGLREPEKPIGSYLFSGPTGVGKTEVAKQLAASLGVELLRFDM 535

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 536 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 595

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+I FRNVILIMTTNAGA +M+K  IGFGSS+ +  D EA+    +PEF 
Sbjct: 596 DHGKLTDHNGKRIDFRNVILIMTTNAGAADMAKPAIGFGSSKREGDDMEAINRLFTPEFR 655

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F  L   ++ QVV KF+M+LE QL E+ ++F  SEE I WL   GYD +MGA
Sbjct: 656 NRLDAVIAFGSLPMPVVHQVVQKFVMQLEAQLAERKVTFDLSEEAIAWLADRGYDERMGA 715

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           RPL R+I+EH+K PLA+E+LFGKL++ GG VKV++
Sbjct: 716 RPLGRVIQEHIKKPLAEEVLFGKLRR-GGTVKVTV 749


>gi|328543446|ref|YP_004303555.1| Endopeptidase Clp ATP-binding chain A [Polymorphum gilvum
           SL003B-26A1]
 gi|326413190|gb|ADZ70253.1| Endopeptidase Clp ATP-binding chain A [Polymorphum gilvum
           SL003B-26A1]
          Length = 813

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/761 (63%), Positives = 606/761 (79%), Gaps = 10/761 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER  EYATLEHLLLALIDD DAA VM +CNVDL VLK NL
Sbjct: 1   MPSFSRSLEKALHQALAFANERQQEYATLEHLLLALIDDQDAAAVMRACNVDLDVLKRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           ++YID +  N + NG   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VDYIDTELENLVTNG-EEDSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    V+  +A    E      + KTD
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGLSEARPVQGVEDDTAMP--EDVEAKPKKKTD 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYCV+L EK  KGK+D L+GR  EI RTIQILCRRSKNNPL+VGDPGVGKTA
Sbjct: 178 -----ALEAYCVNLNEKATKGKIDPLIGRDSEIARTIQILCRRSKNNPLFVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G VP++L  A IF+LDMG L+AGTRYRGDFEER+K++VKEIE Y  A++
Sbjct: 233 IAEGLARRIVKGDVPEVLKDATIFALDMGALLAGTRYRGDFEERLKQVVKEIEEYPGAVM 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALASGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ DAIEI+KG+KPYFE+ H++RY+ +AI+ AV+LS ++   RKLPDKAIDV+
Sbjct: 353 KIDVNEPSVPDAIEILKGLKPYFEDFHKVRYTNDAIKTAVELSAKYINDRKLPDKAIDVL 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P  +RRK I  K+I+ TIA+M R I   + S+DD  VLS+L   L  VVY
Sbjct: 413 DETGASQMLLPEGRRRKTIGVKEIETTIATMAR-IPPKTVSKDDAQVLSHLGDELKRVVY 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  L+S+IK+ARAGL +P+KPIG Y+FSGPTGVGKTE+++QLA +LGV+L+RFDM
Sbjct: 472 GQDKAIDTLASAIKLARAGLREPDKPIGSYLFSGPTGVGKTEVARQLASSLGVELIRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 532 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK++ FRNVILIMTTNAGA +M++A IGF   R +  D EA+    +PEF 
Sbjct: 592 DHGKLTDHNGKQVDFRNVILIMTTNAGAADMARAPIGFSQVRREGDDAEAINKLFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF  L  +++ QVV KF+M+LE QL ++G++F  +E+ + WL   GYD +MGA
Sbjct: 652 NRLDAIIPFGNLPMEVVYQVVEKFVMQLEAQLADRGVTFELTEDAVKWLADKGYDAQMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSA 761
           RPL R+I+EH+K PLADE+LFGKLKK GG VKVS++ DK+ 
Sbjct: 712 RPLGRVIQEHIKRPLADEVLFGKLKK-GGTVKVSVSEDKAG 751


>gi|327189212|gb|EGE56391.1| ATP-dependent Clp protease protein, ATP-binding subunit [Rhizobium
           etli CNPAF512]
          Length = 814

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/784 (64%), Positives = 615/784 (78%), Gaps = 17/784 (2%)

Query: 16  LVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNG 75
           +  ANER+HEYATLEHLLLALIDD+DAA VM +CNVDL  L+  L+ Y+DN+ SN L  G
Sbjct: 1   MTFANERHHEYATLEHLLLALIDDADAAAVMGACNVDLDALRKTLVEYVDNELSN-LITG 59

Query: 76  FRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYD 135
           +  + KPTS FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +SHA YFLQEQEMT YD
Sbjct: 60  YDEDSKPTSGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERESHAAYFLQEQEMTRYD 119

Query: 136 AVNFISHGISKRKEFANFQSKLNVD------GSSAGSDGEGFVNDYQAKTDLNLFPALSA 189
           AVN+ISHGI KR   +  +     +       ++ G + EG     Q         AL A
Sbjct: 120 AVNYISHGIGKRPGASEARPPRGAEEEAESKPTARGGEEEGGPKKQQD--------ALKA 171

Query: 190 YCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQI 249
           YCV+L EK K GK+D L+GRH E++RTIQILCRRSKNNPLYVGDPGVGKTAIAEG AK+I
Sbjct: 172 YCVNLNEKAKGGKIDPLIGRHAEVSRTIQILCRRSKNNPLYVGDPGVGKTAIAEGLAKRI 231

Query: 250 VDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLV 309
           V+G VP+ L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E Y  A+L+IDEIHT++
Sbjct: 232 VEGKVPEALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEYPGAVLFIDEIHTVI 291

Query: 310 GAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSI 369
           GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQKIDVSEPSI
Sbjct: 292 GAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQKIDVSEPSI 351

Query: 370 EDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQIL 429
            DAIEI+KG+KPYFEE+H LRYS +AI++AV+LS R+ + RKLPDKAIDVIDE GA+Q+L
Sbjct: 352 NDAIEIMKGLKPYFEEYHHLRYSNDAIKSAVELSARYISDRKLPDKAIDVIDETGAAQML 411

Query: 430 QPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKL 489
            P SKRRK ITEK+I+ TIA+M R I   + S+DD++VL+NLE+ L +VVYGQ+ AI+ L
Sbjct: 412 LPPSKRRKLITEKEIEATIATMAR-IPPKTVSKDDEAVLANLEQELRSVVYGQDIAIEAL 470

Query: 490 SSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAV 549
           S+SIK+ARAGL +PNKPIG YVFSGPTGVGKTE++KQLA +LGV+LLRFDMSEYMERH V
Sbjct: 471 STSIKLARAGLREPNKPIGAYVFSGPTGVGKTEVAKQLASSLGVELLRFDMSEYMERHTV 530

Query: 550 SRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQS 609
           SRL+GAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ NILLQ+MD+G LTD +
Sbjct: 531 SRLLGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDIYNILLQVMDHGTLTDHN 590

Query: 610 GKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPF 669
           GKKI FRNVILIMTTNAGA EM+KA IGFGSS+    D+EAL    +PEF NRLD+IIPF
Sbjct: 591 GKKIDFRNVILIMTTNAGASEMAKAAIGFGSSKRTGEDEEALTRLFTPEFRNRLDAIIPF 650

Query: 670 FPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKE 729
             L + +I +VV KFIM+LE QL E+ ++F   E+ I WL   GYD KMGARPL R+I++
Sbjct: 651 AALPTAVIHKVVQKFIMQLEAQLSERNVTFDLHEDAIAWLSEKGYDEKMGARPLARVIQD 710

Query: 730 HVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLETEEKEVEDIK 789
            +K PLA+EILFGKLKK GGVV V++ P +     I  E     + I  + E + V    
Sbjct: 711 TIKKPLANEILFGKLKK-GGVVNVTVGPKEDGKPGIVLEAIPDTAPIKPKPEAEVVHPEA 769

Query: 790 SDTD 793
            D D
Sbjct: 770 DDED 773


>gi|90419586|ref|ZP_01227496.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336523|gb|EAS50264.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 820

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/757 (64%), Positives = 600/757 (79%), Gaps = 13/757 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LEK LH AL LAN+R  E+ATLEHLLLAL+DD DAA VM  C+VDL +L+ NL
Sbjct: 1   MPTFSQSLEKSLHSALTLANDRQQEFATLEHLLLALLDDKDAAAVMQGCSVDLDILRRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             YID++ SN L  G   + KPT+ F RV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  TTYIDSELSN-LVTGHDEDSKPTAGFHRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDG--SSAGSDGEGFVNDYQAK 178
           HA YFLQEQEMT YDAVNFISHGISKR   +  +     +   S+ G D EG        
Sbjct: 120 HAAYFLQEQEMTRYDAVNFISHGISKRPGASETRPLRGAEDEQSTVGQDDEGKRK----- 174

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
              N   AL+AYC +L EK + GK+D L+GR EEINRTIQ+LCRRSKNNPLYVGDPGVGK
Sbjct: 175 ---NAPDALTAYCSNLNEKARNGKIDPLIGRAEEINRTIQVLCRRSKNNPLYVGDPGVGK 231

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG AK++V+G VPD+L  A IF+LDMG L+AGTRYRGDFEER+K+++KE+E Y  A
Sbjct: 232 TAIAEGLAKRVVEGDVPDVLADATIFALDMGTLLAGTRYRGDFEERLKQVMKELEEYPGA 291

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           +L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRR
Sbjct: 292 VLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRR 351

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV EPSI+DA+ I+KG+KPYFE+ H+++Y+ EAI++AV+LS R    RKLPDKAID
Sbjct: 352 FQKIDVKEPSIDDAVSILKGLKPYFEDFHRVKYTNEAIKSAVELSARFINDRKLPDKAID 411

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDE GASQ+L    KR+K I  K+I+ TIA+M R I   + S+DD  VL +L+  L  V
Sbjct: 412 VIDETGASQMLLAAGKRKKQIGVKEIEATIATMAR-IPPKAVSKDDAEVLEHLDAQLKRV 470

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           VYGQ+ AI  L+S+IK+ARAGL +P+KPIG Y+FSGPTGVGKTE+++QLA ALGV+LLRF
Sbjct: 471 VYGQDAAIGSLASAIKLARAGLREPDKPIGSYLFSGPTGVGKTEVARQLAAALGVELLRF 530

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPD+ NILLQ
Sbjct: 531 DMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEVEKAHPDLFNILLQ 590

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +GK+I FRNVILIMTTNAGA EM+KA IGFG S+   AD+EA+    +PE
Sbjct: 591 VMDHGKLTDHNGKQIDFRNVILIMTTNAGASEMAKATIGFGHSKRTGADEEAINRLFTPE 650

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+ IPF PL + +I QVV KF+M+LE QL E+G++F  SE+ I WL   GYD  M
Sbjct: 651 FRNRLDATIPFGPLPTPVIHQVVQKFVMQLEAQLSERGVTFELSEDAITWLADKGYDEAM 710

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           GARPL R+I+EH+K PLADE+LFGKLK  GG VKVS+
Sbjct: 711 GARPLGRVIQEHIKKPLADEVLFGKLKH-GGTVKVSV 746


>gi|163760871|ref|ZP_02167950.1| probable atp-dependent clp protease atp-binding subunit protein
           [Hoeflea phototrophica DFL-43]
 gi|162281915|gb|EDQ32207.1| probable atp-dependent clp protease atp-binding subunit protein
           [Hoeflea phototrophica DFL-43]
          Length = 842

 Score =  984 bits (2544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/758 (63%), Positives = 606/758 (79%), Gaps = 11/758 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK +HQAL  ANER+HEYATLEHLLLALI+D DAA VM +CNVDL+ L+  +
Sbjct: 1   MPSFSNSLEKAIHQALTYANERHHEYATLEHLLLALIEDPDAAAVMGACNVDLEQLRRAV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +Y+D +  N L  G+  + KPTS FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  GDYVDKELGN-LITGYDEDSKPTSGFQRVIQRAVIHVQSSGRDEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGS---SAGSDGEGFVNDYQA 177
           HA YFLQEQEMT YDAVNFISHGI+KR      +    ++ S   +  +D  G     + 
Sbjct: 120 HAAYFLQEQEMTRYDAVNFISHGIAKRPGSGESRPVRGIEESEPETGKADPSGEEGGKKK 179

Query: 178 KTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG 237
             D     AL+AYCV+L EK   G++D L+GR EE+NRTIQILCRRSKNNPLYVGDPGVG
Sbjct: 180 AQD-----ALTAYCVNLNEKAGTGRIDPLIGRMEEVNRTIQILCRRSKNNPLYVGDPGVG 234

Query: 238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN 297
           KTAIAEG AK+IV+G VPD+L  A I+SLDMG L+AGTRYRGDFEER+K++VKE+E   +
Sbjct: 235 KTAIAEGLAKRIVEGDVPDVLSEAVIYSLDMGALLAGTRYRGDFEERLKQVVKELEDLPH 294

Query: 298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR 357
           A+L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVR
Sbjct: 295 AVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVR 354

Query: 358 RFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI 417
           RFQKIDV EP+I DAIEI+KG+KPYFEE+H++ Y+ EAI+AAV+LS R+ T RKLPDKAI
Sbjct: 355 RFQKIDVVEPTIPDAIEILKGLKPYFEEYHKVGYTDEAIKAAVELSARYITDRKLPDKAI 414

Query: 418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGT 477
           DVIDE+GA Q+L P  +R+K +T+ +I+ TIA+M R I   + S+DD++VL+NL+K L +
Sbjct: 415 DVIDESGAGQMLLPEKQRKKILTDIEIENTIATMAR-IPAKTVSKDDETVLANLDKELRS 473

Query: 478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLR 537
           VVYGQ+ AI  L+++I++ARAGL +P+KPIG Y+FSGPTGVGKTE+++QLA +LGV+LLR
Sbjct: 474 VVYGQDLAIDSLTAAIRLARAGLREPDKPIGSYLFSGPTGVGKTEVARQLADSLGVELLR 533

Query: 538 FDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL 597
           FDMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+PY V+LLDEIEK+HPD+ NILL
Sbjct: 534 FDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPYCVLLLDEIEKAHPDLFNILL 593

Query: 598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP 657
           Q+MD+G LTD +GKKI FRNVILIMTTNAGA + +KA IGFGSS+ +  D EA+    +P
Sbjct: 594 QVMDHGSLTDHNGKKIDFRNVILIMTTNAGAADAAKAAIGFGSSKREGDDMEAINRLFTP 653

Query: 658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVK 717
           EF NRLDSIIPF  L   +I  VV KF+M+LE QL E+ ++F   ++ I WL   GYD +
Sbjct: 654 EFRNRLDSIIPFGSLPVKVIHMVVQKFVMQLEAQLAERNVTFDLGDDAIAWLADKGYDER 713

Query: 718 MGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           MGARPL R+I+E++K  LA+E+LFGKLK  GG VKVS+
Sbjct: 714 MGARPLGRVIQENIKKELANELLFGKLKH-GGTVKVSV 750


>gi|254474219|ref|ZP_05087610.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Pseudovibrio
           sp. JE062]
 gi|211956749|gb|EEA91958.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Pseudovibrio
           sp. JE062]
          Length = 816

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/768 (62%), Positives = 605/768 (78%), Gaps = 18/768 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER+ EYATLEHLLL+LIDD DAA VM +CNVDL  L+ ++
Sbjct: 1   MPSFSRSLEKALHQALAFANERHQEYATLEHLLLSLIDDQDAAAVMRACNVDLDQLRKSI 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + YID +  N + +G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYIDTELENLVVDGDD-DSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSS-AGSDGE---------G 170
           HA YFLQEQEMT YDAVN+ISHGI+KR   +  +    V+  S +G+D           G
Sbjct: 120 HAAYFLQEQEMTRYDAVNYISHGIAKRAGLSEPRRVRGVEEESDSGADPNVSMPQPPSGG 179

Query: 171 FVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLY 230
                + KT+     AL AYC +L +K   GK+D L+GR +EI+RTIQILCRR+KNNPLY
Sbjct: 180 SSEQTKRKTE-----ALEAYCQNLNDKAFSGKIDPLIGREKEISRTIQILCRRAKNNPLY 234

Query: 231 VGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVK 290
           VGDPGVGKTAIAEG A++IV G VP++L  A IF+LDMG+L+AGTRYRGDFEER+K++VK
Sbjct: 235 VGDPGVGKTAIAEGLARRIVVGDVPEVLKSATIFALDMGSLLAGTRYRGDFEERLKQVVK 294

Query: 291 EIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFE 350
           EIE Y  AI++IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RCIGSTTY EYRQFFE
Sbjct: 295 EIEDYPGAIMFIDEIHTVIGAGATSGGAMDASNLLKPALASGTIRCIGSTTYKEYRQFFE 354

Query: 351 KDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSR 410
           KD+ALVRRFQK+DV+EP+I DAIEI+KG+KPYFE+ H ++Y+ +AI+AAV+LS R+   R
Sbjct: 355 KDRALVRRFQKVDVNEPTIPDAIEILKGLKPYFEDFHNIKYTNDAIKAAVELSSRYLADR 414

Query: 411 KLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSN 470
           KLPDKAIDVIDE+GASQ+L P  KRRK I  K+I+ TIA+M R I   S S+DD  VLSN
Sbjct: 415 KLPDKAIDVIDESGASQMLLPEGKRRKTIGLKEIEATIATMAR-IPPKSVSKDDAEVLSN 473

Query: 471 LEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFA 530
           L+ +L  VVYGQ+ AI+ LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE+++QLA  
Sbjct: 474 LKDSLKRVVYGQDPAIEALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVARQLAST 533

Query: 531 LGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHP 590
           LGV+L+RFDMSEYMERH VSRLIGAPPGYVGF QGG+L D+VDQ+P+ V+LLDEIEK+HP
Sbjct: 534 LGVELVRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVDQHPHCVLLLDEIEKAHP 593

Query: 591 DVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEA 650
           D+ NILLQ+MD+G LTD +GK + FRNVILIMTTNAGA +++KA +GF     D  D EA
Sbjct: 594 DLFNILLQVMDHGKLTDHNGKSVDFRNVILIMTTNAGAADLAKAPMGFNRIDRDGDDMEA 653

Query: 651 LRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLV 710
           +    +PEF NRLD+IIPF  L +D+I +VV KF+M+LE QL E+ ++F  + E + WL 
Sbjct: 654 INKMFTPEFRNRLDAIIPFANLDNDVIHRVVEKFVMQLEAQLAERNVTFELTPEAVAWLS 713

Query: 711 SHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
             GYD  MGARPL R+I+EH+K PLADE+LFGKL+K GG VKVS++ D
Sbjct: 714 EKGYDRLMGARPLGRVIQEHIKKPLADEVLFGKLQK-GGTVKVSVSED 760


>gi|298291486|ref|YP_003693425.1| ATP-dependent Clp protease ATP-binding subunit clpA [Starkeya
           novella DSM 506]
 gi|296927997|gb|ADH88806.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Starkeya
           novella DSM 506]
          Length = 812

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/768 (60%), Positives = 613/768 (79%), Gaps = 12/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LH+AL LANER+HEYATLEHLLL+L+DD D+A VM +CNVDL+ L+ NL
Sbjct: 1   MPTFSRSLEQSLHRALALANERHHEYATLEHLLLSLVDDQDSAAVMRACNVDLEKLRRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + YID +  N +++G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYIDTELDNLVQDGGE-DSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   A       V G+   ++ +    D + K D
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKR---AGMSESRPVRGAEEETETK-TGEDSKKKAD 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYCV+L +K ++GK+D L+GR  EI RTIQ+LCRRSKNNPL+VGDPGVGKTA
Sbjct: 176 -----ALDAYCVNLNKKAREGKIDPLIGRDGEIQRTIQVLCRRSKNNPLFVGDPGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G VPD+L  A +FSLDMG L+AGTRYRGDFEER+K++VKEIE+Y +AI+
Sbjct: 231 IAEGLARRIVNGEVPDVLRKATVFSLDMGALLAGTRYRGDFEERLKQVVKEIEAYPDAIM 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RCIGSTTY EYRQ+FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTLRCIGSTTYKEYRQYFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP++ DAIEI+KG+KPYFE++H+LRY+ +AI+AAV+LS R+   RKLPDKAID+I
Sbjct: 351 KIDVPEPTVPDAIEILKGLKPYFEDYHRLRYTNDAIKAAVELSARYIHDRKLPDKAIDII 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L P  +R+K I  K+I+ T+A++ R I   + S+DD  +L+ LE  L  VVY
Sbjct: 411 DESGAAQMLLPEGRRKKTIGVKEIEATVATIAR-IPPKTVSKDDTEILAGLETTLKRVVY 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L+S+IK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 470 GQDKAIEALASAIKLARAGLREPEKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH +SRLIGAPPGYVGF QGG+L D +DQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 530 SEYMERHTISRLIGAPPGYVGFDQGGLLTDGIDQHPHCVLLLDEIEKAHPDLFNILLQVM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK++ FRNVILIMTTNAGA +++K+  GF  S+ +  D EA+    +PEF 
Sbjct: 590 DHGKLTDHNGKQVDFRNVILIMTTNAGAADLTKSAFGFTRSKREGDDVEAINRLFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF  L+++II  VV KF+++LE QL ++ ++   ++E   WLV  GYD +MGA
Sbjct: 650 NRLDAIIPFAHLTNEIIALVVEKFVLQLEAQLADRNVTIELTDEASAWLVERGYDQQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RP+ R+I+EH+K PLADE+LFGKL+ GG  V+V +  D+   + + FE
Sbjct: 710 RPMGRVIQEHIKKPLADEVLFGKLRSGGH-VRVIVKTDEDGETTLGFE 756


>gi|154248456|ref|YP_001419414.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Xanthobacter
           autotrophicus Py2]
 gi|154162541|gb|ABS69757.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Xanthobacter
           autotrophicus Py2]
          Length = 823

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/750 (61%), Positives = 595/750 (79%), Gaps = 11/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LH+AL LANER+HEYATLEHLLL+L+DD DAA VM +CNVD++ L+ NL
Sbjct: 1   MPTFSRSLEQSLHRALALANERHHEYATLEHLLLSLVDDQDAAAVMRACNVDMEKLRRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y+D +  N +++G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  IEYVDTELENLVQSGSD-DSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +     +  +    G    +D + K D
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRSGMSESRPVRGAEEETETKSG----DDTKKKAD 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYCV+L +K  +GK+D L+GR +EI RTIQ+LCRR KNNPL+VGDPGVGKTA
Sbjct: 176 -----ALDAYCVNLNKKAHEGKIDPLIGRDQEITRTIQVLCRRQKNNPLFVGDPGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+I DG VP++L  A +F+LDMG L+AGTRYRGDFEER+K++VKEIE+Y NAI+
Sbjct: 231 IAEGLAKRINDGDVPEVLATATVFALDMGALLAGTRYRGDFEERLKQVVKEIEAYPNAIM 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG++RC+GSTTY EYRQ+FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGSLRCMGSTTYKEYRQYFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ DAIEI+KG+KP FE++H+LRY+ +AI+AAV+LS R+   RKLPDKAIDVI
Sbjct: 351 KIDVAEPSVADAIEILKGLKPCFEDYHKLRYTNDAIKAAVELSARYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L P +KR+K I  K+I+ TIA+M R I   + S+DD  VL+ L   L  VVY
Sbjct: 411 DESGAAQMLLPEAKRKKTIGLKEIEATIATMAR-IPPKTISKDDAEVLATLRTTLKRVVY 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  L++SIK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA  LGVQLLRFDM
Sbjct: 470 GQDKAIDALAASIKLARAGLREPEKPIGSYLFSGPTGVGKTEVAKQLASVLGVQLLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQNP+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQNPHCVLLLDEIEKAHPDLFNILLQVM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+I FRNVILIMTTNAGA +++K   GF  ++ +  D EA+    +PEF 
Sbjct: 590 DHGKLTDHNGKQIDFRNVILIMTTNAGAADLAKPAYGFTRTKREGDDSEAINRTFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++IPF  L  ++I QVV KF+++LE QL ++ ++   S+E   WLV  GYD  MGA
Sbjct: 650 NRLDAVIPFGHLPPEVITQVVEKFVLQLEAQLADRNVTIELSDEAGAWLVDRGYDEHMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RP+ R+I+EH+K PLAD +LFG LK GG V
Sbjct: 710 RPMARVIQEHIKTPLADLVLFGALKNGGHV 739


>gi|75675887|ref|YP_318308.1| AAA ATPase [Nitrobacter winogradskyi Nb-255]
 gi|74420757|gb|ABA04956.1| AAA ATPase [Nitrobacter winogradskyi Nb-255]
          Length = 801

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/762 (61%), Positives = 607/762 (79%), Gaps = 11/762 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+L+DDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLVDDSDAAAVMRACSVDLDKLRGSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N +      + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VNYLETEFENLVTAEAADDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +    G    +D + K D
Sbjct: 121 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKSG----DDAKKKGD 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D +VGR+ EINR IQ+LCRR KNNPL+VGD GVGKTA
Sbjct: 177 -----ALETYCVNLNKKARDGKIDPVVGRNTEINRAIQVLCRRQKNNPLFVGDAGVGKTA 231

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VP++L  A IFSLDMG L+AGTRYRGDFEER+K+++KE+E++ NA+L
Sbjct: 232 IAEGLAKRIVDSEVPEVLAAATIFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAVL 291

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 292 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTIRCMGSTTYKEYRQHFEKDRALVRRFQ 351

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDAI I+KG+KPYFE++H+L+Y+ +AI AAVQLS R+   RKLPDKAIDVI
Sbjct: 352 KIDVNEPSVEDAIAILKGLKPYFEDYHKLKYTNDAIEAAVQLSSRYIHDRKLPDKAIDVI 411

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L   +KR+K I  K+I+ TIA+M R I   S S+DD  VL +LE+ L  VV+
Sbjct: 412 DESGAAQMLVTENKRKKTIGIKEIETTIAAMAR-IPPKSMSKDDAEVLKHLEQTLKRVVF 470

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L++SIK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA ALGV+LLRFDM
Sbjct: 471 GQDRAIEALTASIKLARAGLREPEKPIGSYLFSGPTGVGKTEVAKQLAEALGVELLRFDM 530

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+SVVLLDEIEK+HPDV N+LLQIM
Sbjct: 531 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHSVVLLDEIEKAHPDVYNVLLQIM 590

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD  GK+++FRNVILIMTTNAGA +M+KA  GF  ++ +  D+EA+    SPEF 
Sbjct: 591 DHGRLTDHHGKQVNFRNVILIMTTNAGASDMAKAAFGFTRNKREGDDREAINRQFSPEFR 650

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+++ F  L++D+I  VV KF+++LE QL ++ ++   S+    WLV HGYD +MGA
Sbjct: 651 NRLDAVVSFGHLNTDVIGMVVEKFVLQLEAQLADRYVTIELSDTAKAWLVQHGYDEQMGA 710

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSAS 762
           RP+ R+I+EH+K PLADE+LFGKL KGGG V+V L  D++ +
Sbjct: 711 RPMARVIQEHIKKPLADEVLFGKL-KGGGHVRVVLVKDEAVA 751


>gi|85716349|ref|ZP_01047322.1| AAA ATPase [Nitrobacter sp. Nb-311A]
 gi|85696865|gb|EAQ34750.1| AAA ATPase [Nitrobacter sp. Nb-311A]
          Length = 802

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/762 (61%), Positives = 606/762 (79%), Gaps = 11/762 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+L+DDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLVDDSDAAAVMRACSVDLDKLRGSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N +      + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VNYLETEFENLVTAEAADDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +    G    +D + K D
Sbjct: 121 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKSG----DDAKKKGD 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D +VGR+ EINR IQ+LCRR KNNPL+VGD GVGKTA
Sbjct: 177 -----ALETYCVNLNKKARDGKIDPVVGRNAEINRAIQVLCRRQKNNPLFVGDAGVGKTA 231

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NA+L
Sbjct: 232 IAEGLAKRIVDSEVPEVLAAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAVL 291

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL++G +RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 292 FIDEIHTVIGAGATSGGAMDASNLLKPALAAGTIRCMGSTTYKEYRQHFEKDRALVRRFQ 351

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDAI I+KG+KPYFE++H+L+Y+ +AI AAVQLS R+   RKLPDKAIDVI
Sbjct: 352 KIDVNEPSVEDAIAILKGLKPYFEDYHKLKYTNDAIEAAVQLSSRYIHDRKLPDKAIDVI 411

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L   SKR+K I  K+I+ TIA+M R I   S S+DD  VL +LE+ L  VV+
Sbjct: 412 DESGAAQMLVTESKRKKTIGIKEIETTIAAMAR-IPPKSMSKDDAEVLKHLEQTLKRVVF 470

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L++SIK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA ALGV+LLRFDM
Sbjct: 471 GQDRAIEALTASIKLARAGLREPEKPIGAYLFSGPTGVGKTEVAKQLAEALGVELLRFDM 530

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+SVVLLDEIEK+HPDV N+LLQIM
Sbjct: 531 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHSVVLLDEIEKAHPDVYNVLLQIM 590

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD  GK+++FRNVILIMTTNAGA +M+KA  GF  ++ +  D+EA+    SPEF 
Sbjct: 591 DHGRLTDHHGKQVNFRNVILIMTTNAGASDMAKAAFGFTRNKREGDDREAINRQFSPEFR 650

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ + F  LS+D+I  VV KF+++LE QL ++ ++   S+    WLV HGYD +MGA
Sbjct: 651 NRLDATVSFGHLSTDVIGLVVEKFVLQLEAQLADRFVTIDLSDPAKAWLVEHGYDEQMGA 710

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSAS 762
           RP+ R+I+EH+K PLADE+LFGKL KGGG V+V L  D++ +
Sbjct: 711 RPMARVIQEHIKKPLADEVLFGKL-KGGGHVRVVLVKDETVA 751


>gi|304391582|ref|ZP_07373524.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Ahrensia sp.
           R2A130]
 gi|303295811|gb|EFL90169.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Ahrensia sp.
           R2A130]
          Length = 817

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/750 (62%), Positives = 593/750 (79%), Gaps = 10/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+++LE  LH+AL  ANER+ EYATLEHLLLAL++D DAA V+ +CNV  + L ++L
Sbjct: 1   MPSFTDSLENALHRALTFANERDQEYATLEHLLLALVEDEDAAAVLRACNVSTQKLADDL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             YID++ SN +      + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  QEYIDSELSNLVTEALD-DSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQ+Q+MT YDAVNFISHGI+KR   ++ +    VD  +A  +GEG   +   K +
Sbjct: 120 HAAYFLQQQDMTRYDAVNFISHGIAKRPGASSARPVEGVD-PTAMPEGEG--GEMPKKGE 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+AYCV+L +K   GKVD L+GR  E+NRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 177 -----ALAAYCVNLNQKAMDGKVDPLIGRTSEVNRTIQVLCRRSKNNPLYVGDPGVGKTA 231

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VP++LL   I+SLDMG L+AGTRYRGDFEER+K+++KEIE    AI+
Sbjct: 232 IAEGLAKRIVDKDVPEVLLDCTIYSLDMGILLAGTRYRGDFEERLKQVMKEIEETDGAIM 291

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALS GA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 292 FIDEIHTVIGAGATSGGAMDASNLLKPALSGGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 351

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI DAIEI+KG+KPYFE+ H++++S +AI  +V+LS R+   RKLPDKAIDVI
Sbjct: 352 KIDVNEPSIPDAIEIMKGLKPYFEDFHKVKFSNDAIIQSVELSSRYINDRKLPDKAIDVI 411

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P  KR+K +  +DI+ TIA+M R I   + S+DD  VL N+   L  +VY
Sbjct: 412 DETGASQMLLPAEKRKKTLGTEDIEATIATMAR-IPAKTVSKDDAEVLKNINDELKRMVY 470

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  LSS+IK+ARAGL +PNKPIG Y+FSGPTGVGKTE+ KQLA  LGV+LLRFDM
Sbjct: 471 GQDKAIDALSSAIKLARAGLREPNKPIGSYLFSGPTGVGKTEVVKQLADTLGVELLRFDM 530

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 531 SEYMERHTVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 590

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +GKK+ FRNVI++MTTNAGA E +K+ IGFGSS+    D EA+    +PEF 
Sbjct: 591 DNGALTDHNGKKVDFRNVIIVMTTNAGASEAAKSAIGFGSSKRTGDDMEAINRLFAPEFR 650

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF  L  ++I QVV KF+M+LE QL E+G++F  + + ++W+   GYD +MGA
Sbjct: 651 NRLDAIIPFDGLKPEVIHQVVQKFVMQLEAQLSERGVTFDLTPDAVSWIAKEGYDDRMGA 710

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RPL R+I+EH+K PLADE+LFGKL+KGG V
Sbjct: 711 RPLGRVIQEHIKKPLADEVLFGKLQKGGTV 740


>gi|158423219|ref|YP_001524511.1| AAA ATPase [Azorhizobium caulinodans ORS 571]
 gi|158330108|dbj|BAF87593.1| AAA ATPase [Azorhizobium caulinodans ORS 571]
          Length = 817

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/745 (62%), Positives = 594/745 (79%), Gaps = 11/745 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LH+AL LANER+HEYATLEHLLL+L+DD DAA VM +CNVDL  L+ NL
Sbjct: 1   MPTFSRSLEQSLHRALALANERHHEYATLEHLLLSLVDDQDAAAVMRACNVDLDKLRRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y+D +  N ++ G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYVDTELENLVQAGGD-DSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +     +  +    GE    + + K D
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRAGMSESRPVRGAEDETETKSGE----EPKKKAD 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYCV+L +K  +GK+D L+GR +EI RTIQ+LCRR KNNPL+VGDPGVGKTA
Sbjct: 176 -----ALDAYCVNLNKKAHEGKIDPLIGRDKEIQRTIQVLCRRQKNNPLFVGDPGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++I++G VP++L  A IF+LDMG L+AGTRYRGDFEER+K++VKEIE+Y NAI+
Sbjct: 231 IAEGLARRIINGDVPEVLATATIFALDMGALLAGTRYRGDFEERLKQVVKEIEAYPNAIM 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ+FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTLRCMGSTTYKEYRQYFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ D IEI+KG+KPYFE++H+LRY+ EAI+AAV+LS R+   RKLPDKAIDVI
Sbjct: 351 KIDVAEPTVPDTIEILKGLKPYFEDYHKLRYTNEAIKAAVELSARYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L P ++R+K I  K+I+ T+A+M R I   S S+DD  +LSNLE  L  VVY
Sbjct: 411 DESGAAQMLVPEARRKKTIGLKEIEATVATMAR-IPPKSVSKDDTEMLSNLETTLKRVVY 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L+SSIK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA  LGV LLRFDM
Sbjct: 470 GQDKAIEALASSIKLARAGLREPEKPIGSYLFSGPTGVGKTEVAKQLASTLGVNLLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQTPHCVLLLDEIEKAHPDLFNILLQVM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK++ FRNVILIMTTNAGA ++S+A  GF  ++ +  D EA+    +PEF 
Sbjct: 590 DHGKLTDHNGKQVDFRNVILIMTTNAGAADLSRAAYGFTRNKREGDDVEAINRTFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++IPF  LS +II  VV KF+++LE QL ++ ++   S+E   WLV  GYD +MGA
Sbjct: 650 NRLDAVIPFAHLSPEIIGLVVEKFVLQLEAQLADRNVTIGLSDEATRWLVDRGYDEQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLK 745
           RP+ R+I+E +K PLADE+LFG+LK
Sbjct: 710 RPMGRVIQEFIKTPLADEVLFGRLK 734


>gi|39936210|ref|NP_948486.1| endopeptidase Clp ATP-binding subunit A [Rhodopseudomonas palustris
           CGA009]
 gi|192291926|ref|YP_001992531.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Rhodopseudomonas palustris TIE-1]
 gi|39650065|emb|CAE28588.1| endopeptidase Clp: ATP-binding chain A [Rhodopseudomonas palustris
           CGA009]
 gi|192285675|gb|ACF02056.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Rhodopseudomonas palustris TIE-1]
          Length = 794

 Score =  973 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/773 (60%), Positives = 612/773 (79%), Gaps = 15/773 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+L+DDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLVDDSDAAAVMRACSVDLDKLRTSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N + +G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VNYLETEFENLVTDGSE-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +    G    +D + K D
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKGG----DDSKKKGD 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D ++GR+ EI+R IQ+LCRR KNNPL+VG+ GVGKTA
Sbjct: 176 -----ALETYCVNLNKKARDGKIDPVIGRNAEISRAIQVLCRRQKNNPLFVGEAGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVDG VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NAIL
Sbjct: 231 IAEGLAKRIVDGEVPEVLSAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAIL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTIRCMGSTTYKEYRQHFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++EDAI I+KG+KPYFE++H+L+Y+ EAI +AVQLS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPTVEDAIAILKGLKPYFEDYHKLKYTNEAIESAVQLSSRYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L   +KR+K I  K+I+ T+A+M R I   S S+DD  VL +LE+ L  VV+
Sbjct: 411 DESGAAQMLLSENKRKKTIGIKEIEATVATMAR-IPPKSVSKDDAEVLKHLEQTLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ LS+SIK+ARAGL +P KPIGCY+FSGPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 470 GQDKAIEALSASIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLASTLGVELLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQIM
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQIM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+++FRNVILIMTTNAGA ++++   GF  ++ +  D EA+    +PEF 
Sbjct: 590 DHGRLTDHNGKQVNFRNVILIMTTNAGAADLARQAFGFTRNKREGDDHEAINRQFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L++D+I  VV KF+++LE QL ++ ++   SE    WLV HGYD +MGA
Sbjct: 650 NRLDAIVSFAHLNADVIGMVVEKFVLQLEAQLADRDVTIELSEPAKAWLVQHGYDEQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSG 773
           RP+ R+I+EH+K PLADE+LFGKL KGGG VKV L  D + +     E+E  G
Sbjct: 710 RPMARVIQEHIKKPLADEVLFGKL-KGGGHVKVVLVKDDAVAG---VELEKIG 758


>gi|92117937|ref|YP_577666.1| ATPase AAA-2 [Nitrobacter hamburgensis X14]
 gi|91800831|gb|ABE63206.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Nitrobacter
           hamburgensis X14]
          Length = 799

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/762 (61%), Positives = 604/762 (79%), Gaps = 10/762 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+L+DDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLVDDSDAAAVMRACSVDLDKLRGSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N +      + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VNYLETEFENLVAADAADDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +    G    +D + K D
Sbjct: 121 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETESKSGG---DDAKKKGD 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D ++GRH EINR IQ+LCRR KNNPL+VGD GVGKTA
Sbjct: 178 -----ALETYCVNLNKKARDGKIDPVIGRHAEINRAIQVLCRRQKNNPLFVGDAGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VP++L  + +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NAIL
Sbjct: 233 IAEGLAKRIVDSEVPEVLSASTVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAIL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTIRCMGSTTYKEYRQHFEKDRALVRRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDAI I+KG+KPYFE++H+L+Y+ +AI AAVQLS R+   RKLPDKAIDVI
Sbjct: 353 KIDVNEPSVEDAIAILKGLKPYFEDYHKLKYTNDAIEAAVQLSSRYIHDRKLPDKAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L   ++R+K I  K+I+ TIA+M R I   S S+DD  VL +LE+ L  VV+
Sbjct: 413 DESGAAQMLVSENRRKKTIGIKEIETTIAAMAR-IPPKSMSKDDAEVLKHLEQTLKRVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L+++IK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA A+GV+LLRFDM
Sbjct: 472 GQDLAIEALTAAIKLARAGLREPEKPIGSYLFSGPTGVGKTEVAKQLAAAMGVELLRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPDV N+LLQIM
Sbjct: 532 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDVYNVLLQIM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD  GK+++FRNVILIMTTNAGA +M+KA  GF  S+ +  D EA+    SPEF 
Sbjct: 592 DHGRLTDHHGKQVNFRNVILIMTTNAGASDMAKAAFGFTRSKREGDDHEAINRQFSPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ + F  LS+D+I  VV KF+++LE QL ++ ++   SE    WLV HGYD +MGA
Sbjct: 652 NRLDATVSFGHLSTDVIGMVVEKFVLQLEAQLADRFVTIELSEPAKAWLVQHGYDEQMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSAS 762
           RP+ R+I+EH+K PLADE+LFGKL KGGG V+V L  D++ +
Sbjct: 712 RPMARVIQEHIKKPLADEVLFGKL-KGGGHVRVVLVKDEAVA 752


>gi|188584528|ref|YP_001927973.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Methylobacterium populi BJ001]
 gi|179348026|gb|ACB83438.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Methylobacterium populi BJ001]
          Length = 832

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/758 (60%), Positives = 596/758 (78%), Gaps = 5/758 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LH+AL LA ER HEYATLEHLLLAL+DD DAA VM +CNV++ VL+ NL
Sbjct: 1   MPSFSRSLEQALHRALALAGERRHEYATLEHLLLALVDDQDAAAVMRACNVEIDVLRRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y+D + SN   +G R + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYVDTELSNLTSDG-RQDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +     +  SA     G  N+ + K  
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGASEAKPVRGAEEESAAERPGGEDNEARPKKK 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            +   AL AYCV+L +K + GK+D L+GRH E+ RTIQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 180 GD---ALEAYCVNLNKKARDGKIDPLIGRHSEVERTIQVLCRRQKNNPLLVGDPGVGKTA 236

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++I+   VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KEIE++ NAI+
Sbjct: 237 IAEGLARKIIQHEVPEVLADATVFSLDMGTLLAGTRYRGDFEERLKQVMKEIEAHPNAIM 296

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SGA+RCIGSTTY EYRQ+FEKD+ALVRRFQ
Sbjct: 297 FIDEIHTVIGAGATSGGAMDASNLLKPALASGALRCIGSTTYKEYRQYFEKDRALVRRFQ 356

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFEE H+L+Y+ +A++AAV+LS R+   RKLPDKAIDVI
Sbjct: 357 KIDVNEPSIPDTIEILKGLKPYFEEFHKLKYTTDAVKAAVELSARYINDRKLPDKAIDVI 416

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P ++R++ I  K+I+ TIA+M R I   + S+DD  VL NL +NL  VVY
Sbjct: 417 DETGASQMLVPEARRKRTIGVKEIETTIATMAR-IPPKTVSKDDAVVLKNLTENLKRVVY 475

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ  AI+ L+S+IK+ARAGL DP+KPIG Y+F+GPTGVGKTE +KQLA +LGV++LRFDM
Sbjct: 476 GQTNAIEALTSAIKLARAGLRDPDKPIGSYLFAGPTGVGKTEAAKQLAASLGVEMLRFDM 535

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D +DQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 536 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGIDQHPHCVLLLDEIEKAHPDLFNILLQVM 595

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK++ FRNVI+IMT+NAGA +++K+  GF  S+    D EA+    +PEF 
Sbjct: 596 DHGKLTDHNGKQVDFRNVIIIMTSNAGASDLAKSAYGFTQSKRTGDDVEAINRLFAPEFR 655

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  L  +++ +VV KF+++LE QL ++ ++   S+E  +WLV +GYD  MGA
Sbjct: 656 NRLDAIISFGHLPKEVVAKVVDKFVLQLEAQLADRNVTIELSDEARDWLVENGYDDAMGA 715

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           RP+ R+I+  +K PLADE+LFG+LK GG V  V   P+
Sbjct: 716 RPMARLIQSTIKTPLADEVLFGRLKDGGAVRVVLKKPE 753


>gi|220920394|ref|YP_002495695.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Methylobacterium nodulans ORS 2060]
 gi|219945000|gb|ACL55392.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Methylobacterium nodulans ORS 2060]
          Length = 817

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/769 (60%), Positives = 601/769 (78%), Gaps = 17/769 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LH+AL LA ER HEYATLEHLLLAL+DD DAA VM +CNVD+++LK NL
Sbjct: 1   MPSFSRSLEQALHRALALAGERRHEYATLEHLLLALVDDQDAAAVMRACNVDVELLKRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + YID + +N   +G R + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  IEYIDTELANLTGDG-RQDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKR------KEFANFQSKLNVDGSSAGSDGEGFVND 174
           HA YFLQEQ+MT YDAVN+ISHGI+KR      K     + +   +  S G D  G    
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGLSEAKPVRGAEEEGGSERPSGGEDERG---- 175

Query: 175 YQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDP 234
            + K D     AL AYCV+L +K ++GK+D L+GR  E+ RTIQ+LCRR KNNPL VGDP
Sbjct: 176 PKKKGD-----ALDAYCVNLNKKAREGKIDPLIGREAEVQRTIQVLCRRQKNNPLLVGDP 230

Query: 235 GVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES 294
           GVGKTAIAEG A++I+   VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KEIE+
Sbjct: 231 GVGKTAIAEGLARKIIQHEVPEVLADATVFSLDMGTLLAGTRYRGDFEERLKQVMKEIEA 290

Query: 295 YANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKA 354
           + NAI++IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RCIGSTTY EYRQ+FEKD+A
Sbjct: 291 HPNAIMFIDEIHTVIGAGATSGGAMDASNLLKPALASGTLRCIGSTTYKEYRQYFEKDRA 350

Query: 355 LVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD 414
           LVRRFQKIDV+EPSI DAIEI+KG++PYFEE H+L+Y+ +A++AAV+LS R+ + RKLPD
Sbjct: 351 LVRRFQKIDVNEPSIPDAIEILKGLRPYFEEFHKLKYTTDAVKAAVELSARYISDRKLPD 410

Query: 415 KAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKN 474
           KAIDVIDE GASQ+L P S+R++ I  K+++ TIA+M R I   + S+DD  VL+NL  +
Sbjct: 411 KAIDVIDETGASQMLVPESRRKRTIGVKEVEATIATMAR-IPPKTVSKDDAVVLANLTDS 469

Query: 475 LGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQ 534
           L  VVYGQ+ AI+ L++SIK+ARAGL DP+KPIG Y+F+GPTGVGKTE++KQLA ALGV+
Sbjct: 470 LKRVVYGQDSAIEALTASIKLARAGLRDPDKPIGSYLFAGPTGVGKTEVAKQLAVALGVE 529

Query: 535 LLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLN 594
           +LRFDMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ N
Sbjct: 530 MLRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFN 589

Query: 595 ILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNF 654
           ILLQ+MD+G LTD +GK++ FRNVI+IMT+NAGA ++++A  GF  S+    D+EA+   
Sbjct: 590 ILLQVMDHGKLTDHNGKQVDFRNVIIIMTSNAGAQDLARAAFGFTQSKRTGDDQEAINRL 649

Query: 655 LSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGY 714
            +PEF NRLD+I+ F  L  +++ +VV KF+++LE QL ++ ++   S+E   WLV +GY
Sbjct: 650 FAPEFRNRLDAIVSFGHLPREVVSKVVDKFVLQLEAQLADRNVTIELSDEAREWLVENGY 709

Query: 715 DVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASS 763
           D  MGARP+ R+I+  +K PLADE+LFGKLK GG V  V   P+    S
Sbjct: 710 DETMGARPMARLIQSTIKTPLADEVLFGKLKDGGAVRVVVKRPETGKPS 758


>gi|86749516|ref|YP_486012.1| AAA_5 ATPase [Rhodopseudomonas palustris HaA2]
 gi|86572544|gb|ABD07101.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Rhodopseudomonas palustris HaA2]
          Length = 801

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/762 (60%), Positives = 608/762 (79%), Gaps = 12/762 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+L+DDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLVDDSDAAAVMRACSVDLDKLRASL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N + +G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VNYLETEFENLVTDGSE-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +    GE    D + K D
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKSGE----DSKKKGD 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D ++GR+ EINR IQ+LCRR KNNPL+VG+ GVGKTA
Sbjct: 176 -----ALETYCVNLNKKARDGKIDPVIGRNAEINRAIQVLCRRQKNNPLFVGEAGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NAIL
Sbjct: 231 IAEGLAKRIVDSEVPEVLAAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAIL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTIRCMGSTTYKEYRQHFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++EDAI I+KG+KPYFE++H+L+Y+ EAI +AV+LS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPTVEDAIAILKGLKPYFEDYHKLKYTNEAIESAVELSSRYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L   +KR+K I  K+I+ T+A+M R I   S S+DD  VL +LE  L  VV+
Sbjct: 411 DESGAAQMLVAENKRKKTIGIKEIEATVATMAR-IPPKSVSKDDAEVLKHLETTLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ LS+SIK+ARAGL +P KPIGCY+FSGPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 470 GQDKAIESLSASIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLASTLGVELLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQIM
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQIM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+++FRNVILIMTTNAGA ++++   GF  ++ +  D EA+    +PEF 
Sbjct: 590 DHGRLTDHNGKQVNFRNVILIMTTNAGAADLARQAFGFTRNKREGDDHEAINRQFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L++D+I  VV KF+++LE QL ++ ++   ++E   WLV HGYD +MGA
Sbjct: 650 NRLDAIVSFAHLNADVIGMVVEKFVLQLEAQLADRDVTIELTDEAKAWLVQHGYDEQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSAS 762
           RP+ R+I+EH+K PLADE+LFG+L KGGG VKV L  D++ +
Sbjct: 710 RPMSRVIQEHIKKPLADEVLFGQL-KGGGHVKVVLVKDEAVA 750


>gi|316933621|ref|YP_004108603.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Rhodopseudomonas palustris DX-1]
 gi|315601335|gb|ADU43870.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Rhodopseudomonas palustris DX-1]
          Length = 795

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/773 (60%), Positives = 613/773 (79%), Gaps = 15/773 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+L+DDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLVDDSDAAAVMRACSVDLDKLRASL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N + +G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VNYLETEFENLVTDGSE-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +    G    +D + K D
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEDTETKAG----DDGKKKGD 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D ++GR+ EI+R IQ+LCRR KNNPL+VG+ GVGKTA
Sbjct: 176 -----ALETYCVNLNKKARDGKIDPVIGRNAEISRAIQVLCRRQKNNPLFVGEAGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVDG VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NAIL
Sbjct: 231 IAEGLAKRIVDGEVPEVLSAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAIL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTIRCMGSTTYKEYRQHFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++EDAI I+KG+KPYFE++H+L+Y+ EAI +AVQLS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPTVEDAIAILKGLKPYFEDYHKLKYTNEAIESAVQLSSRYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L   +KR+K I  K+I+ T+A+M R I   S S+DD  VL +LE+ L  VV+
Sbjct: 411 DESGAAQMLLSENKRKKTIGIKEIEATVATMAR-IPPKSVSKDDAEVLKHLEQTLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ LS+SIK+ARAGL +P KPIGCY+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 470 GQDKAIEALSASIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQIM
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQIM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+++FRNVILIMTTNAGA ++++   GF  S+ +  D EA+    +PEF 
Sbjct: 590 DHGRLTDHNGKQVNFRNVILIMTTNAGAADLARQAFGFTRSKREGDDHEAINRQFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L++D+I  VV KF+++LE QL ++ ++   SE    WLV HGYD +MGA
Sbjct: 650 NRLDAIVSFAHLNADVIGMVVEKFVLQLEAQLADRDVTIELSEPAKAWLVQHGYDEQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSG 773
           RP+ R+I+EH+K PLADE+LFG+L KGGG V+V L  D+  +     E+E  G
Sbjct: 710 RPMSRVIQEHIKKPLADEVLFGRL-KGGGHVRVVLVKDEGVAG---VELEKIG 758


>gi|148256119|ref|YP_001240704.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Bradyrhizobium
           sp. BTAi1]
 gi|146408292|gb|ABQ36798.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Bradyrhizobium
           sp. BTAi1]
          Length = 796

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/768 (60%), Positives = 606/768 (78%), Gaps = 11/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+LIDDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLIDDSDAAAVMRACSVDLDKLRGSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N + +G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VNYLETEFENLVTDGSD-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +     E    D + K +
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKGNE----DSKKKGE 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D ++GR+ EINR IQ+LCRR KNNPL+VG+ GVGKTA
Sbjct: 176 -----ALETYCVNLNKKARDGKIDPVIGRNSEINRAIQVLCRRQKNNPLFVGEAGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NAIL
Sbjct: 231 IAEGLAKRIVDSDVPEVLSAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAIL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG++RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGSIRCMGSTTYKEYRQHFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDAI I+KG+KPYFE++H+L+Y+ EAI AAVQLS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPSVEDAIAILKGLKPYFEDYHRLKYTNEAIEAAVQLSSRYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L   +KR+K I  K+I+ TIA+M R I   S S+DD  VL +LE+ L  VV+
Sbjct: 411 DESGAAQMLLAENKRKKTIGIKEIETTIATMAR-IPPKSVSKDDAEVLKHLEQTLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  LS+SIK+ARAGL +P KPIGCY+FSGPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 470 GQDKAIDSLSASIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLAATLGVELLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQIM
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQIM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+++FRNVILIMTTNAGA +++K   GF  S+ +  D EA+    + EF 
Sbjct: 590 DHGRLTDHNGKQVNFRNVILIMTTNAGAADLAKQAFGFHRSKREGDDHEAINRQFASEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  LS D+I  VV KF+++LE QL ++ ++   SE   +WL+ HGYD +MGA
Sbjct: 650 NRLDAIVSFAHLSVDVIGMVVEKFVLQLEAQLADRDVTIELSEPAKSWLIQHGYDEQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RP+ R+I+EH+K PLADE+LFGKLK GG V  V +  ++ A   I FE
Sbjct: 710 RPMGRVIQEHIKKPLADEVLFGKLKGGGHVRVVLVKDEEGADEKIGFE 757


>gi|182678641|ref|YP_001832787.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182634524|gb|ACB95298.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 829

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/772 (60%), Positives = 603/772 (78%), Gaps = 16/772 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS NLE+ LH+AL +ANER+HEYATLEHLLL+L DD+DAA V+ +C+VDL +LK NL
Sbjct: 1   MPSFSRNLEQSLHRALAIANERHHEYATLEHLLLSLTDDADAAAVLRACSVDLDLLKKNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N + +G R + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  RDYIDQELDNLVSDG-REDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSA--GSDGEG---FVNDY 175
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +        D S A  G++ EG      D 
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGLS--------DSSKAPRGAEEEGENREGKDG 171

Query: 176 QAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPG 235
           +         AL AYC++L +K K G++D L+GR  E+ RTIQ+LCRR KNNPL VGDPG
Sbjct: 172 KEGEGKKKEGALDAYCINLNKKAKDGRIDPLIGREAEVQRTIQVLCRRHKNNPLLVGDPG 231

Query: 236 VGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY 295
           VGKTAIAEG A++IV G VP++L  A +F+LDMG L+AGTRYRGDFEER+K+++KEIE++
Sbjct: 232 VGKTAIAEGLARKIVKGEVPEVLAEATVFALDMGTLLAGTRYRGDFEERLKQVMKEIETH 291

Query: 296 ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKAL 355
             AIL+IDEIHT++GAG+ SG ++DASNLLKPAL+ G++RCIGSTTY EYRQ+FEKD+AL
Sbjct: 292 KKAILFIDEIHTVIGAGATSGGAMDASNLLKPALAQGSLRCIGSTTYKEYRQYFEKDRAL 351

Query: 356 VRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK 415
           VRRFQKIDV+EPS+ DAIEI+KG+KPYFEE H++RY+ EA++AAV+LS R+   RKLPDK
Sbjct: 352 VRRFQKIDVNEPSVPDAIEIIKGLKPYFEEFHKIRYTTEAVKAAVELSARYIHDRKLPDK 411

Query: 416 AIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNL 475
           AIDVIDE GASQ+L P  KR+K I  K+I+ TIA+M R I   + S+DD  VL +L + L
Sbjct: 412 AIDVIDETGASQMLLPEGKRKKTIGIKEIEATIATMAR-IPPKTVSKDDAEVLEHLTETL 470

Query: 476 GTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQL 535
             VVYGQ  AI+ L+++IK+ARAGL D  KPIG Y+FSGPTGVGKTE+++QLA +LGV+L
Sbjct: 471 ERVVYGQNSAIEALTAAIKLARAGLRDGEKPIGSYLFSGPTGVGKTEVARQLATSLGVEL 530

Query: 536 LRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNI 595
           +RFDMSEYMERH VSRLIGAPPGYVGF QGG+L DS+DQ+P+ V+LLDEIEK+HPD+ NI
Sbjct: 531 VRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDSIDQHPHCVLLLDEIEKAHPDLYNI 590

Query: 596 LLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFL 655
           LLQ+MD+G LTD SGK++ FRNVILIMTTNAGA +M +A  GF  ++ +  D EA+    
Sbjct: 591 LLQVMDHGKLTDHSGKQVDFRNVILIMTTNAGAADMQRAAYGFTQNKREGEDLEAINRLF 650

Query: 656 SPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYD 715
           +PEF NRLD+I+ F  L  ++I +VV KFIM+LE QL ++ ++   ++E  NWLV HGYD
Sbjct: 651 APEFRNRLDAIVTFGHLPPEVIVKVVDKFIMQLEAQLADRNVTIELTDEARNWLVEHGYD 710

Query: 716 VKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFF 767
            +MGARP+ R+I++ +K PLADE+LFG+LK  GG VKV +  D++ +  + F
Sbjct: 711 QQMGARPMARVIQQTIKTPLADEVLFGRLKN-GGTVKVMVTTDENGAKKLGF 761


>gi|146341454|ref|YP_001206502.1| ATP-dependent specificity subunit of clpA-clpP serine protease
           [Bradyrhizobium sp. ORS278]
 gi|146194260|emb|CAL78282.1| ATP-dependent specificity subunit of clpA-clpP serine protease
           [Bradyrhizobium sp. ORS278]
          Length = 795

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/768 (60%), Positives = 604/768 (78%), Gaps = 11/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+LIDDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLIDDSDAAAVMRACSVDLDKLRGSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N + +G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VNYLETEFENLVTDGSD-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +     E    D + K +
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKGNE----DSKKKGE 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D ++GR+ EINR IQ+LCRR KNNPL+VG+ GVGKTA
Sbjct: 176 -----ALETYCVNLNKKARDGKIDPVIGRNSEINRAIQVLCRRQKNNPLFVGEAGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NAIL
Sbjct: 231 IAEGLAKRIVDSEVPEVLSAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAIL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG++RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGSIRCMGSTTYKEYRQHFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDAI I+KG+KPYFE++H+L+Y+ EAI AAVQLS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPSVEDAIAILKGLKPYFEDYHRLKYTNEAIEAAVQLSSRYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L   +KR+K I  K+I+ TIA+M R I   S S+DD  VL +LE+ L  VV+
Sbjct: 411 DESGAAQMLLAENKRKKTIGIKEIETTIATMAR-IPPKSVSKDDAEVLKHLEQTLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  LS+SIK+ARAGL +P KPIGCY+FSGPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 470 GQDKAIDSLSASIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLASTLGVELLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQIM
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQIM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+++FRNVILIMTTNAGA +++K   GF  S+ +  D EA+    +PEF 
Sbjct: 590 DHGRLTDHNGKQVNFRNVILIMTTNAGAADLAKQAFGFHRSKREGDDHEAINRQFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  LS D+I  VV KF+++LE QL ++ ++   SE    WL+ HGYD +MGA
Sbjct: 650 NRLDAIVSFGHLSVDVIGMVVEKFVLQLEAQLADRDVTIELSEPAKAWLIQHGYDEQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RP+ R+I+EH+K PLADE+LFGKLK GG V  V +  +      I FE
Sbjct: 710 RPMGRVIQEHIKKPLADEVLFGKLKSGGHVRVVLVKDESGVDEKIGFE 757


>gi|115525405|ref|YP_782316.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Rhodopseudomonas palustris BisA53]
 gi|115519352|gb|ABJ07336.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Rhodopseudomonas palustris BisA53]
          Length = 804

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/768 (60%), Positives = 609/768 (79%), Gaps = 12/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+L+DDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLVDDSDAAAVMRACSVDLDKLRASL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N + +G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VNYLETEFENLVTDGSE-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +    G    +D + K D
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKSG----DDSKKKGD 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D ++GR+ EINR IQ+LCRR KNNPL+VG+ GVGKTA
Sbjct: 176 -----ALETYCVNLNKKARDGKIDPVIGRNAEINRAIQVLCRRQKNNPLFVGEAGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VPD+L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NAIL
Sbjct: 231 IAEGLAKRIVDSEVPDVLAAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAIL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTIRCMGSTTYKEYRQHFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++EDAI I+KG+KPYFE++H+L+Y+ EAI +AVQLS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPTVEDAIAILKGLKPYFEDYHKLKYTNEAIESAVQLSSRYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L   +KR+K I  K+I+ T+A+M R I   S S+DD  VL +LE  L  VV+
Sbjct: 411 DESGAAQMLVAENKRKKTIGIKEIEATVATMAR-IPPKSVSKDDAEVLKHLETTLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L++SIK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 470 GQDKAIESLAASIKLARAGLREPEKPIGSYLFSGPTGVGKTEVAKQLAASLGVELLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQIM
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQIM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+++FRNVILIMTTNAGA ++++   GF  ++ +  D EA+    +PEF 
Sbjct: 590 DHGRLTDHNGKQVNFRNVILIMTTNAGAADLARQAFGFTRNKREGDDHEAINRQFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L++D+I  VV KF+++LE QL ++ ++   SE    WLV HGYD +MGA
Sbjct: 650 NRLDAIVSFAHLNADVIGMVVEKFVLQLEAQLADRDVTIELSETAKAWLVQHGYDEQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RP+ R+I+EH+K PLADE+LFGKL KGGG V+V L  D++  S +  E
Sbjct: 710 RPMARVIQEHIKKPLADEVLFGKL-KGGGHVRVVLVKDEAVVSGVELE 756


>gi|163854198|ref|YP_001642241.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Methylobacterium extorquens PA1]
 gi|218533143|ref|YP_002423959.1| ATP-dependent Clp protease ATP-binding subunit clpA
           [Methylobacterium chloromethanicum CM4]
 gi|254564166|ref|YP_003071261.1| ATPase and specificity subunit of ClpA-ClpP ATP-dependent serine
           protease, chaperone activity [Methylobacterium
           extorquens DM4]
 gi|163665803|gb|ABY33170.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Methylobacterium extorquens PA1]
 gi|218525446|gb|ACK86031.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Methylobacterium chloromethanicum CM4]
 gi|254271444|emb|CAX27459.1| ATPase and specificity subunit of ClpA-ClpP ATP-dependent serine
           protease, chaperone activity [Methylobacterium
           extorquens DM4]
          Length = 827

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/758 (60%), Positives = 593/758 (78%), Gaps = 5/758 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LH+AL LA ER HEYATLEHLLLAL+DD DAA VM +CNV+  VL+ NL
Sbjct: 1   MPSFSRSLEQALHRALALAGERRHEYATLEHLLLALVDDQDAAAVMRACNVETDVLRRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y+D + SN   +G R + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYVDTELSNLTGDG-RQDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +     +  +A     G   + + K  
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGASEAKPVRGAEEEAASERPGGEETEARPKKK 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            +   AL AYCV+L +K + GK+D L+GRH E+ RTIQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 180 GD---ALDAYCVNLNKKARDGKIDPLIGRHSEVERTIQVLCRRQKNNPLLVGDPGVGKTA 236

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++I+   VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KEIE++ NAI+
Sbjct: 237 IAEGLARKIIQHEVPEVLADATVFSLDMGTLLAGTRYRGDFEERLKQVMKEIEAHPNAIM 296

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SGA+RCIGSTTY EYRQ+FEKD+ALVRRFQ
Sbjct: 297 FIDEIHTVIGAGATSGGAMDASNLLKPALASGALRCIGSTTYKEYRQYFEKDRALVRRFQ 356

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFEE H+L+Y+ EA++AAV+LS R+   RKLPDKAIDVI
Sbjct: 357 KIDVNEPSIPDTIEILKGLKPYFEEFHKLKYTTEAVKAAVELSARYINDRKLPDKAIDVI 416

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P ++R++ I  K+I+ TIA+M R I   + S+DD  VL NL +NL  VVY
Sbjct: 417 DETGASQMLVPEARRKRTIGVKEIETTIATMAR-IPPKTVSKDDAVVLKNLTENLKRVVY 475

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ  AI+ L+S+IK+ARAGL DP+KPIG Y+F+GPTGVGKTE +KQLA +LGV++LRFDM
Sbjct: 476 GQTNAIEALTSAIKLARAGLRDPDKPIGSYLFAGPTGVGKTEAAKQLAASLGVEMLRFDM 535

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D +DQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 536 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGIDQHPHCVLLLDEIEKAHPDLFNILLQVM 595

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK++ FRNVI+IMT+NAGA +++K+  GF  S+    D EA+    +PEF 
Sbjct: 596 DHGKLTDHNGKQVDFRNVIIIMTSNAGASDLAKSAYGFTQSKRTGDDVEAINRLFAPEFR 655

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  L  +++ +VV KF+++LE QL ++ ++   S+E   WLV +GYD  MGA
Sbjct: 656 NRLDAIISFGHLPKEVVAKVVDKFVLQLEAQLADRNVTIELSDEAREWLVENGYDDAMGA 715

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           RP+ R+I+  +K PLADE+LFG+LK GG V  V   P+
Sbjct: 716 RPMARLIQSTIKTPLADEVLFGRLKDGGAVKVVLKKPE 753


>gi|27380264|ref|NP_771793.1| ClpA-like protein [Bradyrhizobium japonicum USDA 110]
 gi|27353428|dbj|BAC50418.1| ClpA-like protein [Bradyrhizobium japonicum USDA 110]
          Length = 802

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/752 (61%), Positives = 600/752 (79%), Gaps = 15/752 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+LIDDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLIDDSDAAAVMRACSVDLDKLRTSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N + +G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VNYLETEFENLVTDGAD-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVD--GSSAGSDGEGFVNDYQAK 178
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD    + GSD      D + K
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKGSD------DAKKK 173

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
            +     AL  YCV+L +K + GK+D ++GR+ EINR IQ+LCRR KNNPL+VG+ GVGK
Sbjct: 174 GE-----ALETYCVNLNKKARDGKIDPVIGRNSEINRAIQVLCRRQKNNPLFVGEAGVGK 228

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG AK+IVD  VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NA
Sbjct: 229 TAIAEGLAKRIVDSEVPEVLAAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNA 288

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRR
Sbjct: 289 ILFIDEIHTVIGAGATSGGAMDASNLLKPALASGTIRCMGSTTYKEYRQHFEKDRALVRR 348

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKID++EP++EDAI I+KG+KPYFE++H+L+Y+ EAI AAVQLS R+   RKLPDKAID
Sbjct: 349 FQKIDINEPTVEDAIAILKGLKPYFEDYHRLKYTNEAIEAAVQLSSRYIHDRKLPDKAID 408

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDE+GA+Q+L   +KR+K I  K+I+ TIASM R I   S S+DD  VL +LE+ L   
Sbjct: 409 VIDESGAAQMLVAENKRKKTIGIKEIETTIASMAR-IPPKSVSKDDAEVLKHLEQTLKRT 467

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ++AI+ L++SIK+ARAGL +P KPIGCY+FSGPTGVGKTE++KQLA +LGV+LLRF
Sbjct: 468 VFGQDKAIESLAASIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLAASLGVELLRF 527

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQ
Sbjct: 528 DMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQ 587

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           IMD+G LTD +GK+++FRNVILIMTTNAGA +++K   GF  S+ +  D EA+    +PE
Sbjct: 588 IMDHGRLTDHNGKQVNFRNVILIMTTNAGASDLAKQAFGFTRSKREGDDHEAINRQFAPE 647

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+I+ F  LS ++I  VV KF+++LE QL ++ ++   SE    WLV HGYD +M
Sbjct: 648 FRNRLDAIVSFSHLSVEVIGTVVEKFVLQLEAQLGDRDVTIELSEPAKAWLVQHGYDEQM 707

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           GARP+ R+I+EH+K PLADE+LFGKLK GG V
Sbjct: 708 GARPMARVIQEHIKKPLADEVLFGKLKSGGHV 739


>gi|170747221|ref|YP_001753481.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Methylobacterium radiotolerans JCM 2831]
 gi|170653743|gb|ACB22798.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Methylobacterium radiotolerans JCM 2831]
          Length = 828

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/760 (60%), Positives = 594/760 (78%), Gaps = 9/760 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LH+AL LA ER HEYATLEHLLLAL+DD DAA VM +CNV++  LK +L
Sbjct: 1   MPSFSRSLEQALHRALALAGERRHEYATLEHLLLALVDDQDAAAVMRACNVEIDTLKRSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           ++Y+D + SN   +G R + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VDYVDTELSNLTGDG-RQDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVD--GSSAGSDGEGFVNDYQAK 178
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +     D  G+S     +G     + K
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGASEAKPVRGADEEGASERPSDDGDPRGAKKK 179

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
            D     AL AYCV+L +K + GK+D L+GR  E+ RTIQ+LCRR KNNPL VGDPGVGK
Sbjct: 180 GD-----ALDAYCVNLNKKARDGKIDPLIGRESEVQRTIQVLCRRQKNNPLLVGDPGVGK 234

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A++I+   VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KEIE++ NA
Sbjct: 235 TAIAEGLARKIIQHEVPEVLADATVFSLDMGTLLAGTRYRGDFEERLKQVMKEIEAHPNA 294

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           I++IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RCIGSTTY EYRQ+FEKD+ALVRR
Sbjct: 295 IMFIDEIHTVIGAGATSGGAMDASNLLKPALASGTLRCIGSTTYKEYRQYFEKDRALVRR 354

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV+EPSI D IEIVKG++PYFEE H+L+Y+ EA++AAV+LS R+   RKLPDKAID
Sbjct: 355 FQKIDVNEPSIPDTIEIVKGLRPYFEEFHKLKYTTEAVKAAVELSARYINDRKLPDKAID 414

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDE GASQ+L P ++R++ I  K+I+ TIA+M R I   + S+DD  VL +L +NL  V
Sbjct: 415 VIDETGASQMLVPEARRKRTIGIKEIEATIATMAR-IPPKTVSKDDAVVLQHLTENLKRV 473

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           VYGQ  AI+ L+S+IK+ARAGL DP+KPIG Y+F+GPTGVGKTE +KQLA +LGV++LRF
Sbjct: 474 VYGQPNAIEALTSAIKLARAGLRDPDKPIGSYLFAGPTGVGKTEAAKQLAASLGVEMLRF 533

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH VSRLIGAPPGYVGF QGG+L D +DQ+P+ V+LLDEIEK+HPD+ NILLQ
Sbjct: 534 DMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGIDQHPHCVLLLDEIEKAHPDLFNILLQ 593

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +GK++ FRNVI+IMT+NAGA +++KA  GF  S+    D EA+    +PE
Sbjct: 594 VMDHGKLTDHNGKQVDFRNVIIIMTSNAGASDLAKAAYGFTQSKRSGDDVEAINRLFAPE 653

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+II F  L  +++ +VV KF+++LE QL ++ ++   S+E  +WLV HGYD  M
Sbjct: 654 FRNRLDAIISFGHLPKEVVAKVVDKFVLQLEAQLADRNVTIELSDEARDWLVEHGYDDAM 713

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           GARP+ R+I+  +K PLADE+LFG+LK GG V  V   P+
Sbjct: 714 GARPMARLIQSTIKTPLADEVLFGRLKDGGAVRVVVRKPE 753


>gi|91977523|ref|YP_570182.1| ATPase AAA-2 [Rhodopseudomonas palustris BisB5]
 gi|91683979|gb|ABE40281.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Rhodopseudomonas palustris BisB5]
          Length = 801

 Score =  966 bits (2498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/762 (60%), Positives = 607/762 (79%), Gaps = 12/762 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+L+DDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLVDDSDAAAVMRACSVDLDKLRASL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N + +G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VNYLETEFENLITDGSE-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +    GE    D + K D
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKSGE----DSKKKGD 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D ++GR+ EINR IQ+LCRR KNNPL+VG+ GVGKTA
Sbjct: 176 -----ALETYCVNLNKKARDGKIDPVIGRNAEINRAIQVLCRRQKNNPLFVGEAGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NAIL
Sbjct: 231 IAEGLAKRIVDSEVPEVLAAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAIL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTIRCMGSTTYKEYRQHFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ DAI I+KG+KPYFE++H+L+Y+ EAI +AV+LS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPTVADAIAILKGLKPYFEDYHKLKYTNEAIESAVELSSRYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L   +KR+K I  K+I+ T+A+M R I   S S+DD  VL +LE+ L  VV+
Sbjct: 411 DESGAAQMLVAENKRKKTIGIKEIEATVATMAR-IPPKSVSKDDAEVLMHLEQTLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L++SIK+ARAGL +P KPIGCY+FSGPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 470 GQDKAIESLAASIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLALTLGVELLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQIM
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQIM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+++FRNVILIMTTNAGA ++++   GF  ++ +  D EA+    +PEF 
Sbjct: 590 DHGRLTDHNGKQVNFRNVILIMTTNAGAADLARQAFGFTRNKREGDDHEAINRQFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L++D+I  VV KF+++LE QL ++ ++   S+    WLV HGYD +MGA
Sbjct: 650 NRLDAIVSFAHLNADVIGMVVEKFVLQLEAQLADRDVTIELSDAAKAWLVQHGYDEQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSAS 762
           RP+ R+I+EH+K PLADE+LFG+L KGGG V+V L  D++ +
Sbjct: 710 RPMARVIQEHIKKPLADEVLFGQL-KGGGHVRVVLVKDEAVA 750


>gi|118591080|ref|ZP_01548479.1| endopeptidase Clp ATP-binding chain A [Stappia aggregata IAM 12614]
 gi|118436156|gb|EAV42798.1| endopeptidase Clp ATP-binding chain A [Stappia aggregata IAM 12614]
          Length = 815

 Score =  966 bits (2498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/758 (62%), Positives = 602/758 (79%), Gaps = 9/758 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER  EYATLEHLLLAL+DD DAA VM +CNVDL  ++ NL
Sbjct: 1   MPSFSRSLEKALHQALAFANERQQEYATLEHLLLALLDDQDAAAVMRACNVDLDTIRRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + YI+ +  N + +    + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYIETELDNLVTDSDE-DSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQ+Q+MT YDAVN+ISHGI+KR   +  +     D        E      Q KTD
Sbjct: 120 HAAYFLQDQDMTRYDAVNYISHGIAKRPGMSEARPVEGADEEDVMPGAETEKKSSQ-KTD 178

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYCV+L  K   GK+D L+GR  EI+RTIQILCRRSKNNPL+VGDPGVGKTA
Sbjct: 179 -----ALEAYCVNLNTKATNGKIDPLIGRDSEISRTIQILCRRSKNNPLFVGDPGVGKTA 233

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +IV+G VPD+L  A IFSLDMG+L+AGTRYRGDFEER+K++VKEIE Y  A++
Sbjct: 234 IAEGLAHRIVNGDVPDVLKDATIFSLDMGSLLAGTRYRGDFEERLKQVVKEIEDYPGAVM 293

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 294 FIDEIHTVIGAGATSGGAMDASNLLKPALASGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 353

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI DAI+I+KG+KPYFE+ H++RY+ +AI+ AV+LS ++ + RKLPDKAIDV+
Sbjct: 354 KIDVNEPSIPDAIDILKGLKPYFEDFHKVRYTNDAIKVAVELSAKYISDRKLPDKAIDVL 413

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P ++RRK I  K+I+ TIA+M R I   S S+DD  VL NL K+L  VVY
Sbjct: 414 DETGASQMLVPEARRRKTIGVKEIENTIATMAR-IPPKSVSKDDAEVLENLGKDLKRVVY 472

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+EAI  L+S+IK+ARAGL +P+KPIG Y+FSGPTGVGKTE+++QLA +LGV+L+RFDM
Sbjct: 473 GQDEAIGTLASAIKLARAGLREPDKPIGSYLFSGPTGVGKTEVARQLASSLGVELIRFDM 532

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 533 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 592

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK++ FRNVILIMTTNAGA +M+K  +GF   + +  D EA+    +PEF 
Sbjct: 593 DHGKLTDHNGKQVDFRNVILIMTTNAGAADMAKMPVGFNRIKREGDDAEAINKLFTPEFR 652

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF  L  +++ +VV KF+M+LE+QL ++G++F  +E+ + WL   GYD +MGA
Sbjct: 653 NRLDAIIPFGNLPMEVVYKVVEKFVMQLEVQLADRGVTFELTEDAVKWLADKGYDSQMGA 712

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           RPL RII+EH+K PLADE+LFGKLKK GG+VKV+++ D
Sbjct: 713 RPLGRIIQEHIKRPLADEVLFGKLKK-GGMVKVTVSED 749


>gi|240141658|ref|YP_002966138.1| ATPase and specificity subunit of ClpA-ClpP ATP-dependent serine
           protease, chaperone activity [Methylobacterium
           extorquens AM1]
 gi|240011635|gb|ACS42861.1| ATPase and specificity subunit of ClpA-ClpP ATP-dependent serine
           protease, chaperone activity [Methylobacterium
           extorquens AM1]
          Length = 827

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/758 (60%), Positives = 592/758 (78%), Gaps = 5/758 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LH+AL LA ER HEYATLEHLLLAL+DD DAA VM +CNV+  VL+ NL
Sbjct: 1   MPSFSRSLEQALHRALALAGERRHEYATLEHLLLALVDDQDAAAVMRACNVETDVLRRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y+D + SN   +G R + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYVDTELSNLTGDG-RQDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +     +  +A         + + K  
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGASEAKPVRGAEEEAASERPGSEETEARPKKK 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            +   AL AYCV+L +K + GK+D L+GRH E+ RTIQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 180 GD---ALDAYCVNLNKKARDGKIDPLIGRHSEVERTIQVLCRRQKNNPLLVGDPGVGKTA 236

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++I+   VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KEIE++ NAI+
Sbjct: 237 IAEGLARKIIQHEVPEVLADATVFSLDMGTLLAGTRYRGDFEERLKQVMKEIEAHPNAIM 296

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SGA+RCIGSTTY EYRQ+FEKD+ALVRRFQ
Sbjct: 297 FIDEIHTVIGAGATSGGAMDASNLLKPALASGALRCIGSTTYKEYRQYFEKDRALVRRFQ 356

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFEE H+L+Y+ EA++AAV+LS R+   RKLPDKAIDVI
Sbjct: 357 KIDVNEPSIPDTIEILKGLKPYFEEFHKLKYTTEAVKAAVELSARYINDRKLPDKAIDVI 416

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P ++R++ I  K+I+ TIA+M R I   + S+DD  VL NL +NL  VVY
Sbjct: 417 DETGASQMLVPEARRKRTIGVKEIETTIATMAR-IPPKTVSKDDAVVLKNLTENLKRVVY 475

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ  AI+ L+S+IK+ARAGL DP+KPIG Y+F+GPTGVGKTE +KQLA +LGV++LRFDM
Sbjct: 476 GQTNAIEALTSAIKLARAGLRDPDKPIGSYLFAGPTGVGKTEAAKQLAASLGVEMLRFDM 535

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D +DQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 536 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGIDQHPHCVLLLDEIEKAHPDLFNILLQVM 595

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK++ FRNVI+IMT+NAGA +++K+  GF  S+    D EA+    +PEF 
Sbjct: 596 DHGKLTDHNGKQVDFRNVIIIMTSNAGASDLAKSAYGFTQSKRTGDDVEAINRLFAPEFR 655

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  L  +++ +VV KF+++LE QL ++ ++   S+E   WLV +GYD  MGA
Sbjct: 656 NRLDAIISFGHLPKEVVAKVVDKFVLQLEAQLADRNVTIELSDEAREWLVENGYDDAMGA 715

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           RP+ R+I+  +K PLADE+LFG+LK GG V  V   P+
Sbjct: 716 RPMARLIQSTIKTPLADEVLFGRLKDGGAVKVVLKKPE 753


>gi|10442010|gb|AAG17282.1|AF254897_1 ClpA-like protein [Bradyrhizobium japonicum USDA 110]
          Length = 802

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/752 (61%), Positives = 599/752 (79%), Gaps = 15/752 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+LIDDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLIDDSDAAAVMRACSVDLDKLRTSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N + +G   + KPT  FQRV+QRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VNYLETEFENLVTDGAD-DAKPTGGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVD--GSSAGSDGEGFVNDYQAK 178
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD    + GSD      D + K
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKGSD------DAKKK 173

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
            +     AL  YCV+L +K + GK+D ++GR+ EINR IQ+LCRR KNNPL+VG+ GVGK
Sbjct: 174 GE-----ALETYCVNLNKKARDGKIDPVIGRNSEINRAIQVLCRRQKNNPLFVGEAGVGK 228

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG AK+IVD  VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NA
Sbjct: 229 TAIAEGLAKRIVDSEVPEVLAAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNA 288

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRR
Sbjct: 289 ILFIDEIHTVIGAGATSGGAMDASNLLKPALASGTIRCMGSTTYKEYRQHFEKDRALVRR 348

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKID++EP++EDAI I+KG+KPYFE++H+L+Y+ EAI AAVQLS R+   RKLPDKAID
Sbjct: 349 FQKIDINEPTVEDAIAILKGLKPYFEDYHRLKYTNEAIEAAVQLSSRYIHDRKLPDKAID 408

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDE+GA+Q+L   +KR+K I  K+I+ TIASM R I   S S+DD  VL +LE+ L   
Sbjct: 409 VIDESGAAQMLVAENKRKKTIGIKEIETTIASMAR-IPPKSVSKDDAEVLKHLEQTLKRT 467

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ++AI+ L++SIK+ARAGL +P KPIGCY+FSGPTGVGKTE++KQLA +LGV+LLRF
Sbjct: 468 VFGQDKAIESLAASIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLAASLGVELLRF 527

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQ
Sbjct: 528 DMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQ 587

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           IMD+G LTD +GK+++FRNVILIMTTNAGA +++K   GF  S+ +  D +A+    +PE
Sbjct: 588 IMDHGRLTDHNGKQVNFRNVILIMTTNAGASDLAKQAFGFTRSKREGDDHDAINRQFAPE 647

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+I+ F  LS ++I  VV KF+++LE QL ++ ++   SE    WLV HGYD +M
Sbjct: 648 FRNRLDAIVSFSHLSVEVIGTVVEKFVLQLEAQLGDRDVTIELSEPAKAWLVQHGYDEQM 707

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           GARP+ R+I+EH+K PLADE+LFGKLK GG V
Sbjct: 708 GARPMARVIQEHIKKPLADEVLFGKLKSGGHV 739


>gi|90424815|ref|YP_533185.1| ATPase AAA-2 [Rhodopseudomonas palustris BisB18]
 gi|90106829|gb|ABD88866.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Rhodopseudomonas palustris BisB18]
          Length = 802

 Score =  964 bits (2491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/762 (60%), Positives = 608/762 (79%), Gaps = 12/762 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+L+DDSDAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLVDDSDAAAVMRACSVDLDKLRTSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY++ +  N + +G   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VNYLETEFENLVTDGAD-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +    GE    D + K D
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKGGE----DSKKKGD 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D ++GR+ EINR IQ+LCRR KNNPL+VG+ GVGKTA
Sbjct: 176 -----ALDTYCVNLNKKARDGKIDPVIGRNVEINRAIQVLCRRQKNNPLFVGEAGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NAIL
Sbjct: 231 IAEGLAKRIVDSEVPEVLAAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAIL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTIRCMGSTTYKEYRQHFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++EDAI I+KG+KPYFE++H+L+Y+ EAI +AVQLS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPTVEDAIAILKGLKPYFEDYHKLKYTNEAIESAVQLSSRYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L   +KR+K I  K+I+ T+A+M R I   S S+DD  VL +LE  L  VV+
Sbjct: 411 DESGAAQMLVAENKRKKTIGIKEIEATVATMAR-IPPKSVSKDDAEVLKHLETTLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L++SIK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA +LGV+L+RFDM
Sbjct: 470 GQDKAIEALAASIKLARAGLREPEKPIGSYLFSGPTGVGKTEVAKQLAASLGVELIRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQIM
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQIM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+++FRNVILIMTTNAGA ++++   GF  ++ +  D EA+    +PEF 
Sbjct: 590 DHGRLTDHNGKQVNFRNVILIMTTNAGAADLARQAFGFTRNKREGDDHEAINRQFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L++D+I  VV KF+++LE+QL ++ ++   SE    WLV HGYD +MGA
Sbjct: 650 NRLDAIVSFAHLNADVIGMVVEKFVLQLEVQLADRDVTIELSEPAKAWLVQHGYDEQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSAS 762
           RP+ R+I+EH+K PLADE+LFG+L KGGG V+V L  D++ +
Sbjct: 710 RPMSRVIQEHIKKPLADEVLFGRL-KGGGHVRVVLIKDEAVA 750


>gi|154253239|ref|YP_001414063.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Parvibaculum
           lavamentivorans DS-1]
 gi|154157189|gb|ABS64406.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Parvibaculum
           lavamentivorans DS-1]
          Length = 794

 Score =  962 bits (2488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/772 (60%), Positives = 601/772 (77%), Gaps = 21/772 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LH+AL LANER+HEYATLEHLLL+L+DD DAA VM +CNVD+ +L+  L
Sbjct: 1   MPTFSRSLEEGLHRALALANERDHEYATLEHLLLSLMDDQDAAAVMRACNVDMDMLRQQL 60

Query: 61  LNYIDND-SSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPD 119
            NY+DN+ SS  ++NG   + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +
Sbjct: 61  TNYVDNELSSLVVENG--EDSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAMFAERE 118

Query: 120 SHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSD-GEGFVNDYQAK 178
           SHA YFLQEQ+MT YDAVN+ISHGI+KR + +  +    V G+    + GE    +   +
Sbjct: 119 SHAAYFLQEQDMTRYDAVNYISHGIAKRGDMSETRP---VRGAQEEPETGERTRKERTTE 175

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                  AL  YCV+L +K K+GK+D L+GR  E+ RTIQILCRRSKNNPL+VGDPGVGK
Sbjct: 176 -------ALDNYCVNLNDKAKQGKIDPLIGREREVERTIQILCRRSKNNPLFVGDPGVGK 228

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A++IV G VP++L  A IFSLDMG L+AGTRYRGDFEERIK ++KEIE+Y  A
Sbjct: 229 TAIAEGLARRIVKGEVPEVLRNATIFSLDMGTLLAGTRYRGDFEERIKAVIKEIEAYPGA 288

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           I++IDEIHT++GAG+ SG ++DASNLLKPAL+SG+VRCIGSTTY EYRQ FEKD+ALVRR
Sbjct: 289 IMFIDEIHTVIGAGATSGGAMDASNLLKPALASGSVRCIGSTTYKEYRQHFEKDRALVRR 348

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV+EPS+ D I+I+KG+KPYFEE H++RY+ +A++AAV LS ++   RKLPDKAID
Sbjct: 349 FQKIDVAEPSVPDTIKILKGLKPYFEEFHKVRYTNDAVKAAVDLSAKYMHDRKLPDKAID 408

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDEAGASQ+L P S+R+K I   +I+  IA+M R I   S S+ D   L +L+  L  V
Sbjct: 409 VIDEAGASQMLLPESRRKKTIGVAEIEAVIATMAR-IPPKSVSKSDTEKLKDLDTELKRV 467

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ  AI  L++SIK+ARAGL +  KPIGCY+FSGPTGVGKTE+++QLA  LGV++LRF
Sbjct: 468 VFGQNAAIDALAASIKLARAGLREAEKPIGCYLFSGPTGVGKTEVARQLASVLGVEMLRF 527

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ
Sbjct: 528 DMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQ 587

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +GKKI FRNV+LIMTTNAGA +M+K  IGF   +    D++A++   +PE
Sbjct: 588 VMDHGKLTDHNGKKIDFRNVVLIMTTNAGAADMAKPTIGFAQKKRTGDDEDAIKRLFTPE 647

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD++IPF  L  ++I QVV KF+++LE+QL ++ ++   + E  +WL   GYD +M
Sbjct: 648 FRNRLDAVIPFGHLPQEVIAQVVEKFVLQLEVQLADRNVTIELTPEANSWLAERGYDEQM 707

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIE 770
           GARPL R+I+E++K PLADE+LFG+L KGG V+ V++  D  A     F+IE
Sbjct: 708 GARPLARVIQENIKKPLADEVLFGRLVKGGHVI-VTVKDDALA-----FDIE 753


>gi|170740499|ref|YP_001769154.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Methylobacterium sp. 4-46]
 gi|168194773|gb|ACA16720.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Methylobacterium sp. 4-46]
          Length = 817

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/766 (60%), Positives = 596/766 (77%), Gaps = 5/766 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LH+AL LA ER HEYATLEHLLLAL+DD DAA VM +CNVD+ VLK NL
Sbjct: 1   MPSFSRSLEQALHRALALAGERRHEYATLEHLLLALVDDQDAAAVMRACNVDVDVLKRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + YID + +N   +G R + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEYIDTELANLTGDG-RQDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +     D   A     G   +   K  
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGLSESKPVRGADEEGASERPSGPEEERGPKKK 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            +   AL AYCV+L +K ++GK+D L+GR  E+ RTIQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 180 GD---ALDAYCVNLNKKAREGKIDPLIGRETEVQRTIQVLCRRQKNNPLLVGDPGVGKTA 236

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++I+   VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KEIE++ NAI+
Sbjct: 237 IAEGLARKIIQHEVPEVLADATVFSLDMGTLLAGTRYRGDFEERLKQVMKEIEAHPNAIM 296

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RCIGSTTY EYRQ+FEKD+ALVRRFQ
Sbjct: 297 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTLRCIGSTTYKEYRQYFEKDRALVRRFQ 356

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI DAIEI+KG++PYFEE H+L+Y+ +A++AAV+LS R+ + RKLPDKAIDVI
Sbjct: 357 KIDVNEPSIPDAIEILKGLRPYFEEFHKLKYTTDAVKAAVELSARYISDRKLPDKAIDVI 416

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P  +R++ I  K+++ TIA+M R I   + S+DD  VL+NL  +L  VVY
Sbjct: 417 DETGASQMLVPEGRRKRTIGVKEVEATIATMAR-IPPKTVSKDDAVVLANLTDSLKRVVY 475

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L++SIK+ARAGL DP+KPIG Y+F+GPTGVGKTE++KQLA ALGV++LRFDM
Sbjct: 476 GQDNAIEALTASIKLARAGLRDPDKPIGSYLFAGPTGVGKTEVAKQLASALGVEMLRFDM 535

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 536 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 595

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK++ FRNVI+IMT+NAGA ++++A  GF  S+    D EA+    +PEF 
Sbjct: 596 DHGKLTDHNGKQVDFRNVIIIMTSNAGAADLARAAFGFTQSKRTGDDHEAINRLFAPEFR 655

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L  +++ +VV KF+++LE QL ++ ++   S+E   WLV HGYD  MGA
Sbjct: 656 NRLDAIVSFGHLPKEVVSKVVDKFVLQLEAQLADRNVTIELSDEAREWLVEHGYDETMGA 715

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIF 766
           RP+ R+I+  +K PLADE+LFGKLK GG V  +   P+    S  F
Sbjct: 716 RPMARLIQATIKTPLADEVLFGKLKDGGAVRVIVKRPEGEKPSLCF 761


>gi|329889201|ref|ZP_08267544.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brevundimonas
           diminuta ATCC 11568]
 gi|328844502|gb|EGF94066.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brevundimonas
           diminuta ATCC 11568]
          Length = 767

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/783 (60%), Positives = 599/783 (76%), Gaps = 19/783 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ LH+A+  ANER HEYATLEHLLLALIDD DA+ VM +CNVDL  LK  L
Sbjct: 1   MPSFSRPLEETLHRAVHYANERRHEYATLEHLLLALIDDPDASAVMTACNVDLGALKAAL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +Y+D D +  L      + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+FSE +S
Sbjct: 61  GSYVDTDLA-ALATADGDDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVNFI+HGI+K+   A  +S   V G+S     +G V     +  
Sbjct: 120 HAAYFLQEQDMTRYDAVNFIAHGIAKKAGAAEARS---VRGASPEEAEDGSVVKQGGE-- 174

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYC+DL EK + GK+D L+GR  E+ R+IQILCRR+KNNPL VGDPGVGKTA
Sbjct: 175 -----ALEAYCIDLNEKARNGKIDPLIGRQAEVERSIQILCRRTKNNPLLVGDPGVGKTA 229

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G VP++L  A I+SLDMG+L+AGTRYRGDFEER+K++VKE+ES+ NA+L
Sbjct: 230 IAEGLARKIVNGEVPEVLKDATIYSLDMGSLLAGTRYRGDFEERLKQVVKELESHENAVL 289

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG++RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 290 FIDEIHTVIGAGATSGGAMDASNLLKPALASGSLRCMGSTTYKEYRQHFEKDRALVRRFQ 349

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+IED ++I+KG+K  +E HH+LRY+  AIR AV LS R+ T RKLPDKAIDVI
Sbjct: 350 KIDVNEPTIEDTVKILKGLKTTYETHHKLRYTDSAIRTAVDLSARYITDRKLPDKAIDVI 409

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGASQ+L P SKR+K I +K+++  IA M R I   S S+ D   L  LE +L  VV+
Sbjct: 410 DEAGASQMLLPESKRKKVIGQKEVEAVIAKMAR-IPPKSVSKSDTESLRELETDLKRVVF 468

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQE+AI ++S+++K+ARAGL DPNKPIG ++FSGPTGVGKTE++ QLA  LG+++ RFDM
Sbjct: 469 GQEQAIDQVSAAMKLARAGLRDPNKPIGAFLFSGPTGVGKTEVANQLAATLGIEMQRFDM 528

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVG  QGG+L D+VDQ+P+SVVLLDEIEK+HPDV NILLQ+M
Sbjct: 529 SEYMERHTVSRLIGAPPGYVGHDQGGLLTDAVDQHPHSVVLLDEIEKAHPDVYNILLQVM 588

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GKK+ FRNVILIMTTNAGA + ++A IGFG  + +  D +A++   +PEF 
Sbjct: 589 DNGTLTDAVGKKVDFRNVILIMTTNAGAADNARASIGFGRGKVEGEDDKAIQRLFAPEFR 648

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F PL ++ IR VV KF+++LE QL ++ I+   ++E  +WL  +G+D   GA
Sbjct: 649 NRLDAIVAFKPLGAETIRSVVTKFVLQLEAQLADRNITIELTDEATDWLAKNGFDELYGA 708

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIE-NSGSNISLE 779
           RPL R+I+EH+K PLAD+ILFG+L +GG  VKV L   K     I F+I    G+ +  E
Sbjct: 709 RPLARVIQEHIKKPLADDILFGRLTRGGH-VKVELKDGK-----IAFDITPTKGAAVKEE 762

Query: 780 TEE 782
            EE
Sbjct: 763 EEE 765


>gi|299135163|ref|ZP_07028354.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Afipia sp.
           1NLS2]
 gi|298590140|gb|EFI50344.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Afipia sp.
           1NLS2]
          Length = 786

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/768 (60%), Positives = 606/768 (78%), Gaps = 12/768 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+LIDD+DAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLIDDTDAAAVMRACSVDLDKLRGSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y++ +  N + +G   + KPT+ FQRVVQRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VGYLETEFENLIGDGAE-DAKPTAGFQRVVQRAVIHVQSSGREEVTGANVLIAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +    GE    D + K +
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDDDTDTKGGE----DTKKKGE 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D ++GR+ EINR IQ+LCRR KNNPL+VG+ GVGKTA
Sbjct: 176 -----ALETYCVNLNKKARDGKIDPVIGRNAEINRAIQVLCRRQKNNPLFVGEAGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NAIL
Sbjct: 231 IAEGLAKRIVDSDVPEVLSAATVFSLDMGTLLAGTRYRGDFEERLKQVIKELEAHPNAIL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGGIRCMGSTTYKEYRQHFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS++DAI I+KG+KPYFE++H+L+Y+ +AI AAV LS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPSVDDAISILKGLKPYFEDYHKLKYTNDAIEAAVNLSARYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L P  KR+K I  K+I+ TIA+M R I   S S+DD  VL +LE  L   V+
Sbjct: 411 DESGAAQMLVPEGKRKKTIGIKEIETTIATMAR-IPPKSVSKDDAEVLRHLETTLKRTVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L++SIK+ARAGL +P KPIGCY+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 470 GQDKAIEALAASIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQIM
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQIM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK ++FRN+ILIMTTNAGA +M+KA  GF  S+ +  D EA+    +PEF 
Sbjct: 590 DHGKLTDHNGKSVNFRNIILIMTTNAGAADMAKAAFGFTRSKREGEDHEAINRQFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L +D+I  VV KF+M+LE QL ++ ++   S+    WLV  GYD +MGA
Sbjct: 650 NRLDAIVSFAHLDADVIGMVVEKFVMQLEAQLGDRNVTIELSDPAKAWLVKEGYDEQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           RP+ R+I+EH+K PLADE+LFGKL KGGG V+V L P ++ +  I FE
Sbjct: 710 RPMARVIQEHIKKPLADEVLFGKL-KGGGHVRVVLVPGEAGAEKIGFE 756


>gi|254420804|ref|ZP_05034528.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brevundimonas
           sp. BAL3]
 gi|196186981|gb|EDX81957.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Brevundimonas
           sp. BAL3]
          Length = 767

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/785 (59%), Positives = 604/785 (76%), Gaps = 19/785 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ LH+A+  AN R HEYATLEHLLLALIDD DA  VM +CNVDL  LK  L
Sbjct: 1   MPSFSRPLEETLHRAVGYANARRHEYATLEHLLLALIDDPDATAVMSACNVDLTALKAAL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+DND +  L      E KPT+ FQRV+QRAV+HVQS+GR  V+GAN+LVA+FSE +S
Sbjct: 61  TLYVDNDLA-ALATSDGEEAKPTAGFQRVIQRAVIHVQSSGREEVSGANVLVAIFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVNFI+HGI+K+   +  +        + GS  E   +    K+ 
Sbjct: 120 HAAYFLQEQDMTRYDAVNFIAHGIAKKAGASETRP-------AKGSSPEEAEDQSAVKSG 172

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYCVDL EK ++GKVD L+GR  E+ R+IQILCRR+KNNPL VGDPGVGKTA
Sbjct: 173 GE---ALQAYCVDLNEKSRQGKVDPLIGRQAEVERSIQILCRRTKNNPLLVGDPGVGKTA 229

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G VPD+L  A I+SLDMG L+AGTRYRGDFEER+K++VKE+ES+ NA+L
Sbjct: 230 IAEGLARKIVNGEVPDVLKDATIYSLDMGALLAGTRYRGDFEERLKQVVKELESHDNAVL 289

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG++RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 290 FIDEIHTVIGAGATSGGAMDASNLLKPALASGSLRCMGSTTYKEYRQHFEKDRALVRRFQ 349

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ED ++I+KG+K Y+E+HH++RY+  AIR AV LS R+ T RKLPDKAIDVI
Sbjct: 350 KIDVNEPTVEDTVKILKGLKTYYEQHHKVRYTDSAIRTAVDLSARYMTDRKLPDKAIDVI 409

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGASQ+L   SKR+K I +K+I+  IA M R I   S S+ D   L  LE +L   V+
Sbjct: 410 DEAGASQMLVVESKRKKVIGQKEIEAVIAKMAR-IPAKSVSKSDTESLRELEVDLKRAVF 468

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQE+AI+++S+++K+ARAGL DPNKPIG ++FSGPTGVGKTE++KQLA  LG+++ RFDM
Sbjct: 469 GQEQAIEQVSAAMKLARAGLRDPNKPIGSFLFSGPTGVGKTEVAKQLASTLGIEMQRFDM 528

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVG  QGG+L D+VDQ+P+SVVLLDEIEK+HPDV NILLQ+M
Sbjct: 529 SEYMERHTVSRLIGAPPGYVGHDQGGLLTDAVDQHPHSVVLLDEIEKAHPDVYNILLQVM 588

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G+LTD  GKK+ FRNVILIMTTNAGA + ++A IGFG  + +  D +A++   +PEF 
Sbjct: 589 DNGMLTDAVGKKVDFRNVILIMTTNAGAADNARASIGFGRGKVEGEDDKAIQRLFAPEFR 648

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F PL +D IR VV KFI++LE QL ++ I+   ++E  +WL  +G+D   GA
Sbjct: 649 NRLDAIVAFKPLQADTIRSVVTKFILQLEAQLADRNITIELTDEAADWLAKNGFDELYGA 708

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RPL R+I++ +K PLAD+ILFG+L +GG  VKV L   K     I F+I+++G  +++++
Sbjct: 709 RPLARVIQDSIKKPLADDILFGRLTRGGH-VKVQLKDGK-----IDFDIKSAG-GVAVKS 761

Query: 781 EEKEV 785
           EE+E 
Sbjct: 762 EEEET 766


>gi|209884901|ref|YP_002288758.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Oligotropha
           carboxidovorans OM5]
 gi|209873097|gb|ACI92893.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Oligotropha
           carboxidovorans OM5]
          Length = 793

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/761 (61%), Positives = 604/761 (79%), Gaps = 12/761 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS++LE+ LH+AL +ANER+H+YATLEHLLL+LIDD+DAA VM +C+VDL  L+ +L
Sbjct: 1   MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLIDDTDAAAVMRACSVDLDKLRGSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y++ +  N + +G   + KPT+ FQRVVQRAV+HVQS+GR  VTGAN+L+A+F+E +S
Sbjct: 61  VGYLETEFENLIGDGVD-DAKPTAGFQRVVQRAVIHVQSSGREEVTGANVLIAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +  +    VD  +    GE    D + K +
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDDDTDTKGGE----DSKKKGE 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K + GK+D ++GR+ EINR IQ+LCRR KNNPL+VG+ GVGKTA
Sbjct: 176 -----ALETYCVNLNKKARDGKIDPVIGRNAEINRAIQVLCRRQKNNPLFVGEAGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVD  VP++L  A +FSLDMG L+AGTRYRGDFEER+K+++KE+E++ NAIL
Sbjct: 231 IAEGLAKRIVDSEVPEVLAAATVFSLDMGTLLAGTRYRGDFEERLKQVIKELEAHPNAIL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALASGGIRCMGSTTYKEYRQHFEKDRALVRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDAI I+KG+KPYFE++H+L+Y+ +AI AAV LS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPSVEDAIGILKGLKPYFEDYHKLKYTNDAIEAAVNLSARYIHDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L P  KR+K I  K+I+ TIA+M R I   S S+DD  VL +LE  L   V+
Sbjct: 411 DESGAAQMLVPEGKRKKTIGIKEIETTIATMAR-IPPKSVSKDDVEVLKHLEATLKRTVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ LS+SIK+ARAGL +P KPIGCY+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 470 GQDKAIEALSASIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLAASLGVELLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ VVLLDEIEK+HPD+ N+LLQIM
Sbjct: 530 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQIM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK+++FRN+ILIMTTNAGA +M+KA  GF  ++ +  D EA+    +PEF 
Sbjct: 590 DHGKLTDHNGKQVNFRNIILIMTTNAGAADMAKAAFGFTRNKREGEDHEAINRQFAPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L +D+I  VV KF+M+LE QL ++ ++   SE    WLV  GYD +MGA
Sbjct: 650 NRLDAIVSFAHLDADVIGMVVEKFVMQLEAQLGDRNVTIELSEPAKAWLVKEGYDEQMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSA 761
           RP+ R+I+EH+K PLADE+LFGKL KGGG V+V L  D++A
Sbjct: 710 RPMARVIQEHIKKPLADEVLFGKL-KGGGHVRVVLVKDEAA 749


>gi|307946409|ref|ZP_07661744.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Roseibium sp.
           TrichSKD4]
 gi|307770073|gb|EFO29299.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Roseibium sp.
           TrichSKD4]
          Length = 824

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/763 (61%), Positives = 605/763 (79%), Gaps = 10/763 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LEK LHQAL  ANER  EYATLEHLLLAL+DD DAA VM +CNVDL V++ NL
Sbjct: 1   MPSFSRSLEKALHQALAFANEREQEYATLEHLLLALLDDQDAAAVMRACNVDLDVIRRNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           ++YI+N+  N + +    + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VDYIENELENLVTDSDE-DSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSA--GSDGEGFVNDYQAK 178
           HA YFLQ+Q+MT YDAVN+ISHGI+KR   +  +    V+   A  G+   G      +K
Sbjct: 120 HAAYFLQDQDMTRYDAVNYISHGIAKRPGLSETRPVDGVEDEEAVSGNAQGGGEKKAGSK 179

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
           TD     AL AYCV+L +K   GKVD L+GR  EI+RTIQILCRRSKNNPL+VGDPGVGK
Sbjct: 180 TD-----ALEAYCVNLNKKAADGKVDPLIGRDTEISRTIQILCRRSKNNPLFVGDPGVGK 234

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A +IV+  VPD+L G  IFSLDMG+L+AGTRYRGDFEER+K++VKEIE +  A
Sbjct: 235 TAIAEGLALRIVNEDVPDVLKGNTIFSLDMGSLLAGTRYRGDFEERLKQVVKEIEEFDGA 294

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           +++IDEIHT++GAG+ SG ++DASNLLKPAL++G +RCIGSTTY EYRQFFEKD+ALVRR
Sbjct: 295 VMFIDEIHTVIGAGATSGGAMDASNLLKPALAAGTIRCIGSTTYKEYRQFFEKDRALVRR 354

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV+EP+I DAI+I+KG+KPYFE+ H++RY+ +AI+ AV+LS ++ + RKLPDKAID
Sbjct: 355 FQKIDVNEPTIPDAIDILKGLKPYFEDFHKVRYTNDAIKTAVELSAKYISDRKLPDKAID 414

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           V+DE GASQ+L P ++RRK I  K+I+ TIA+M R I   S S+DD  VLS+L   L  V
Sbjct: 415 VLDETGASQMLVPEARRRKTIGVKEIENTIATMAR-IPPKSVSKDDAEVLSSLSAELKRV 473

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           VYGQ +AI  L+S+IK+ARAGL +P+KPIG Y+FSGPTGVGKTE+++QLA +LGV+L+RF
Sbjct: 474 VYGQNDAIDTLASAIKLARAGLREPDKPIGSYLFSGPTGVGKTEVARQLASSLGVELIRF 533

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ
Sbjct: 534 DMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLYNILLQ 593

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +GK++ FRNVILIMTTNAGA +M+KA IGF   + +  D+EA+    +PE
Sbjct: 594 VMDHGKLTDHNGKQVDFRNVILIMTTNAGAADMAKAPIGFNRVKREGDDQEAINKLFTPE 653

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+II F  L  +++ +VV KF+M+LE QL E+G++F  ++    WL   GYD +M
Sbjct: 654 FRNRLDAIIAFGNLPIEVVYKVVEKFVMQLEAQLSERGVTFELTDAATKWLADKGYDNQM 713

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSA 761
           GARPL R+I+EH+K PLADE+LFGKL+K GG VKVS++ D++ 
Sbjct: 714 GARPLGRVIQEHIKRPLADEVLFGKLQK-GGTVKVSVSEDEAG 755


>gi|323138621|ref|ZP_08073688.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylocystis
           sp. ATCC 49242]
 gi|322396109|gb|EFX98643.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylocystis
           sp. ATCC 49242]
          Length = 813

 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/747 (61%), Positives = 594/747 (79%), Gaps = 9/747 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS NL++ L +AL  A ER+HEYATLEHLLL+LI+D+DA+ V+ +C+VDL +L  NL
Sbjct: 1   MPAFSRNLKQTLDRALASARERHHEYATLEHLLLSLIEDADASAVLRACSVDLDLLGKNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L N    ECKPT+ FQRVVQRA++ VQS+GR  V+GAN+LVALF+E +S
Sbjct: 61  RDYIDRELDN-LVNEDADECKPTAGFQRVVQRAIISVQSSGREDVSGANVLVALFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANF-QSKLNVDGSSAGSDG-EGFVNDYQAK 178
           HA YFLQEQ+MT YDAVN+ISHGI+KR   ++  ++   V+     ++G EG   + + K
Sbjct: 120 HAVYFLQEQDMTRYDAVNYISHGIAKRPGLSDASRTPRGVEDEGDRAEGREGRDGESRKK 179

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                  AL AYCV+L +K + G++D L+GR  E+ RTIQ+LCRR KNNPL VGDPGVGK
Sbjct: 180 EG-----ALEAYCVNLNKKARDGRIDPLIGREPEVLRTIQVLCRRHKNNPLLVGDPGVGK 234

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A++IV G VPD+L GA +F+LDMG L+AGTRYRGDFEER+K++VKEIE++ NA
Sbjct: 235 TAIAEGLARKIVQGEVPDVLSGATVFALDMGALLAGTRYRGDFEERLKQVVKEIENHKNA 294

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHT++GAG+ SG ++DASNLLKPAL+ G +RCIGSTTY EYRQ+FEKD+ALVRR
Sbjct: 295 ILFIDEIHTVIGAGATSGGAMDASNLLKPALAQGVLRCIGSTTYKEYRQYFEKDRALVRR 354

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV+EPSI DAIEI+KG+KPYFEE H++RY+ +A++AAV+LS R+   RKLPDKAID
Sbjct: 355 FQKIDVNEPSIPDAIEIIKGLKPYFEEFHKIRYTNDALKAAVELSARYIHDRKLPDKAID 414

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDE GA+Q+L   +KR+K I  K+I+ TIA+M R +   + S+DD  VL++L++ L  V
Sbjct: 415 VIDETGAAQMLLAENKRKKTIGLKEIEATIATMAR-VPPKTVSKDDAEVLAHLDETLRRV 473

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           VYGQ++AI  L+S+IK+ARAGL D  KPIGCY+FSGPTGVGKTE ++QLA +LG++L+RF
Sbjct: 474 VYGQDKAISALTSAIKLARAGLRDQEKPIGCYLFSGPTGVGKTEAARQLATSLGIELVRF 533

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH VSRLIGAPPGYVGF QGG+L DS+DQ+P+ V+LLDEIEK+HPD+ NILLQ
Sbjct: 534 DMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDSIDQHPHCVLLLDEIEKAHPDLYNILLQ 593

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +GK I FRNVILIMTTNAGA ++++  IGF  +R D  D EA+    +PE
Sbjct: 594 VMDHGKLTDHNGKTIDFRNVILIMTTNAGAQDLARTPIGFTRTRADLDDSEAINRLFAPE 653

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+I+PF  L  D+I++VV KF+M+LE QL ++ ++   ++E  +WLV HGYD  M
Sbjct: 654 FRNRLDAIVPFGHLPVDVIKRVVDKFVMQLEAQLADRNVTIELTDEARSWLVEHGYDEAM 713

Query: 719 GARPLERIIKEHVKVPLADEILFGKLK 745
           GARP+ R+I +H+K PLADE+LFG+LK
Sbjct: 714 GARPMSRVIHQHIKTPLADEVLFGRLK 740


>gi|16126707|ref|NP_421271.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Caulobacter
           crescentus CB15]
 gi|221235489|ref|YP_002517926.1| ATP-dependent clp protease ATP-binding subunit ClpA [Caulobacter
           crescentus NA1000]
 gi|13424017|gb|AAK24439.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Caulobacter
           crescentus CB15]
 gi|220964662|gb|ACL96018.1| ATP-dependent clp protease ATP-binding subunit ClpA [Caulobacter
           crescentus NA1000]
          Length = 776

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/784 (59%), Positives = 606/784 (77%), Gaps = 13/784 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ LH+A+  AN+R HEYATLEHLLL+L DD DAA VM +C+VDL  LK +L
Sbjct: 1   MPSFSRPLEESLHRAVAYANQRKHEYATLEHLLLSLTDDEDAAGVMRACDVDLAALKKSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            NY+D + ++ + +    + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+FSE +S
Sbjct: 61  SNYLDVELTSLVVDD-EEDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVNFI+HGI+K+   A      +V G+S GS+      D    T 
Sbjct: 120 HAAYFLQEQDMTRYDAVNFIAHGIAKK---AGASEPKSVKGASTGSNATE--EDGDKSTT 174

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYCVDL EK ++GKVD L+GR  E+ R IQILCRR+KNNPL VGDPGVGKTA
Sbjct: 175 KTGGEALEAYCVDLNEKARQGKVDPLIGRANEVERAIQILCRRTKNNPLLVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV   VP++L GA I+SLDMG L+AGTRYRGDFEER+K++VKE+E++ NA+L
Sbjct: 235 IAEGLARKIVTHQVPEVLEGATIYSLDMGALLAGTRYRGDFEERLKQVVKELENHPNAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY E+RQ FEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTLRCMGSTTYKEFRQHFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ED I+I+KG+K Y+E+ H+L+Y+ +A++ AV+LS ++ T RKLPDKAIDVI
Sbjct: 355 KIDVNEPTVEDTIKILKGLKTYYEDFHKLKYTADALKVAVELSAKYITDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGASQ+L P S+R+K I  K+I+  +A + R I   S S+ D   L  LE +L   V+
Sbjct: 415 DEAGASQMLLPESRRKKTIGVKEIESVVAKIAR-IPPKSVSKSDTEALKELESDLKRAVF 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+EA+ +L++++K+ARAGL +PNKPIG Y+FSGPTGVGKTE +KQLA  LG+++LRFDM
Sbjct: 474 GQDEALSQLAAAMKLARAGLREPNKPIGSYLFSGPTGVGKTEAAKQLAQTLGIEMLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG L D+VDQ+P++VVLLDEIEK+H DV NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGQLTDAVDQHPHAVVLLDEIEKAHGDVYNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +GKK+ FRNV+LIMTTNAGA +  +  IGFG S+ +  ++ AL+   +PEF 
Sbjct: 594 DNGTLTDSNGKKVDFRNVVLIMTTNAGASDAQRNSIGFGRSKVEGEEEAALKRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+++ F PLS+DIIRQVV KF+M+LE QL ++ I+   S++  +WL  +G+D   GA
Sbjct: 654 NRLDAVVAFKPLSADIIRQVVQKFVMQLEAQLADRNITIELSDDAADWLAKNGFDELYGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RPL R+I+EH+K PLAD+ILFG+L +GG  VKV L       S I FEI++S +  + +T
Sbjct: 714 RPLARVIQEHIKKPLADDILFGRLVRGGH-VKVVLK-----DSKIDFEIDSSTAPKAGKT 767

Query: 781 EEKE 784
           +E E
Sbjct: 768 DETE 771


>gi|217976933|ref|YP_002361080.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylocella
           silvestris BL2]
 gi|217502309|gb|ACK49718.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylocella
           silvestris BL2]
          Length = 826

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/756 (60%), Positives = 586/756 (77%), Gaps = 16/756 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS NLE+ LH+AL +ANER+HEYATLEHLLL+L DD+DA+ V+ +C+VDL  LK NL
Sbjct: 1   MPSFSRNLEQSLHRALAVANERHHEYATLEHLLLSLTDDTDASSVLRACSVDLDQLKKNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YI+ +  N + +G R + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  RDYIEQELDNLVGDG-REDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +        D S      E      +AK  
Sbjct: 120 HAAYFLQEQDMTRYDAVNYISHGIAKRPGLS--------DPSKTPRGAEEDPESREAKEG 171

Query: 181 LNLFP------ALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDP 234
            +         AL AYCV+L +K + G++D L+GR  E+ RTIQ+LCRR KNNPL VGDP
Sbjct: 172 KDTGESKKKEGALDAYCVNLNKKARDGRIDPLIGREAEVQRTIQVLCRRHKNNPLLVGDP 231

Query: 235 GVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES 294
           GVGKTAIAEG A++IV   VP++L  A +F+LDMG L+AGTRYRGDFEER+K+++KEIE+
Sbjct: 232 GVGKTAIAEGLARKIVKSEVPEVLAEATVFALDMGTLLAGTRYRGDFEERLKQVMKEIEN 291

Query: 295 YANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKA 354
           + NAIL+IDEIHT++GAG+ SG ++DASNLLKPAL+ G +RCIGSTTY EYRQ+FEKD+A
Sbjct: 292 HKNAILFIDEIHTVIGAGATSGGAMDASNLLKPALAQGTLRCIGSTTYKEYRQYFEKDRA 351

Query: 355 LVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD 414
           LVRRFQKIDV+EPS+ DAIEI+KG+KPYFEE H++RY+ EAI+AAV+LS R+   RKLPD
Sbjct: 352 LVRRFQKIDVNEPSVPDAIEIMKGLKPYFEEFHKIRYTNEAIKAAVELSARYIHDRKLPD 411

Query: 415 KAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKN 474
           KAIDVIDE GASQ+L P +KR+K I  K+++ TIA+M R I   + S+DD  VL +L + 
Sbjct: 412 KAIDVIDETGASQMLLPENKRKKTIGIKEVEATIATMAR-IPPKTVSKDDAEVLEHLTQT 470

Query: 475 LGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQ 534
           L  VVYGQ  AI  L+S+IK+ARAGL D  KPIG Y+FSGPTGVGKTE+++QLA ALGV+
Sbjct: 471 LERVVYGQNAAISALTSAIKLARAGLRDGEKPIGSYLFSGPTGVGKTEVARQLAVALGVE 530

Query: 535 LLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLN 594
           L+RFDMSEYMERH VSRLIGAPPGYVGF QGG+L DS+DQ+P+ V+LLDEIEK+HPD+ N
Sbjct: 531 LVRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDSIDQHPHCVLLLDEIEKAHPDLYN 590

Query: 595 ILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNF 654
           ILLQ+MD+G LTD SGK++ FRNVILIMTTNAGA +M +   GF + +    D EA+   
Sbjct: 591 ILLQVMDHGKLTDHSGKQVDFRNVILIMTTNAGASDMQRESFGFTAGKRKGEDVEAINRM 650

Query: 655 LSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGY 714
            +PEF NRLD+++ F  L  ++I +VV KFIM+LE QL ++ ++   +++   WLV HGY
Sbjct: 651 FAPEFRNRLDAVVTFGHLPHEVIVKVVDKFIMQLEAQLADRNVTIELADDARAWLVEHGY 710

Query: 715 DVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           D +MGARP+ R+I++ +K PLADE+LFG+LK GG V
Sbjct: 711 DERMGARPMARVIQQTIKTPLADEVLFGRLKNGGTV 746


>gi|306841892|ref|ZP_07474572.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella sp.
           BO2]
 gi|306288022|gb|EFM59424.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella sp.
           BO2]
          Length = 779

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/723 (63%), Positives = 575/723 (79%), Gaps = 8/723 (1%)

Query: 46  MLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIV 105
           M +CNVDL  LK+ + +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  V
Sbjct: 1   MRACNVDLDYLKHIVTDYIDRELDN-LITGYDEDSKPTAAFQRVIQRAVIHVQSSNRDEV 59

Query: 106 TGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAG 165
           TGAN+LVA+F+E +SHA YFLQEQ+MT YDAVN+ISHGISKR + +  ++   V+ +S  
Sbjct: 60  TGANVLVAIFAERESHAAYFLQEQQMTRYDAVNYISHGISKRPQGSEPRTPRGVESASEE 119

Query: 166 SDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSK 225
             G       + K D     ALSAYC++L EK K G++D L+GR  EINRTIQ+LCRRSK
Sbjct: 120 RTGIEQEEAPKKKQD-----ALSAYCINLNEKAKAGRIDPLIGRDSEINRTIQVLCRRSK 174

Query: 226 NNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERI 285
           NNPLYVGDPGVGKTAIAEG AK+IV+G VP  L  A IFSLDMG L+AGTRYRGDFEER+
Sbjct: 175 NNPLYVGDPGVGKTAIAEGLAKRIVEGQVPAALADATIFSLDMGTLLAGTRYRGDFEERL 234

Query: 286 KKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEY 345
           K++VKE+E +  A+L+IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EY
Sbjct: 235 KQVVKELEEFPGAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEY 294

Query: 346 RQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVR 405
           RQFFEKD+ALVRRFQKIDV+EPSI D IEI+KG+KPYFE+ H+++Y+ +AI++AV+LS R
Sbjct: 295 RQFFEKDRALVRRFQKIDVNEPSIPDTIEIMKGLKPYFEDFHKVKYTVDAIKSAVELSAR 354

Query: 406 HFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDD 465
           + + RKLPDKAIDVIDE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+
Sbjct: 355 YISDRKLPDKAIDVIDETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDE 413

Query: 466 SVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISK 525
            VLS+LE  L  VVYGQ+ AI  LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++K
Sbjct: 414 EVLSHLEAELKRVVYGQDLAIDALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAK 473

Query: 526 QLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEI 585
           QLA +LGV+LLRFDMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEI
Sbjct: 474 QLASSLGVELLRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEI 533

Query: 586 EKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDD 645
           EK+HPD+ NILLQ+MD+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R + 
Sbjct: 534 EKAHPDLFNILLQVMDHGALTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREG 593

Query: 646 ADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEV 705
            D EA+    +PEF NRLD+IIPF PL   +I QVV KF+++LE QL E+G++F  ++  
Sbjct: 594 DDMEAINRLFTPEFRNRLDAIIPFGPLPVPVIHQVVQKFVLQLEAQLAERGVTFELTDAA 653

Query: 706 INWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPI 765
           I WL   GYD +MGARPL R+I+EH+K PLADE+LFGKLK  GG V+V +   +  ++ +
Sbjct: 654 IAWLADKGYDERMGARPLARVIQEHIKKPLADEVLFGKLKH-GGTVRVDVTTREDGNTDL 712

Query: 766 FFE 768
             E
Sbjct: 713 MLE 715


>gi|296446321|ref|ZP_06888267.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylosinus
           trichosporium OB3b]
 gi|296256222|gb|EFH03303.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylosinus
           trichosporium OB3b]
          Length = 820

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/773 (59%), Positives = 595/773 (76%), Gaps = 17/773 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS NL++ L +AL  A ER+HEYATLEHLLL+LIDD+DAA V+ +C+VDL +L  NL
Sbjct: 1   MPTFSRNLKQSLDRALASARERHHEYATLEHLLLSLIDDTDAAAVLRACSVDLDLLGKNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L N    +CKPT+ FQRVVQRA++ VQS+GR  V GAN+LVALF+E +S
Sbjct: 61  RDYIDRELDN-LVNESAGDCKPTAGFQRVVQRAIISVQSSGREDVNGANVLVALFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGI+KR   +        DGS A    E   +    +  
Sbjct: 120 HAVYFLQEQDMTRYDAVNYISHGIAKRPGLS--------DGSRAPRGVEDEADRGDTREQ 171

Query: 181 LNLFP-----ALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPG 235
               P     AL AYCV+L  K + G++D L+GR  E+ RTIQ+LCRR KNNPL VGDPG
Sbjct: 172 REGEPRKKEGALEAYCVNLNRKARDGRIDPLIGRESEVLRTIQVLCRRQKNNPLLVGDPG 231

Query: 236 VGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY 295
           VGKTAIAEG A++I+   VPD+L  A +F+LDMG L+AGTRYRGDFEER+K+++KEIE++
Sbjct: 232 VGKTAIAEGLARKIIQNEVPDVLSSATVFALDMGTLLAGTRYRGDFEERLKQVIKEIENH 291

Query: 296 ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKAL 355
            NAIL+IDEIHT++GAG+ SG ++DASNLLKPAL+ G +RCIGSTTY EYRQ+FEKD+AL
Sbjct: 292 KNAILFIDEIHTVIGAGATSGGAMDASNLLKPALAQGTLRCIGSTTYREYRQYFEKDRAL 351

Query: 356 VRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK 415
           VRRFQKIDV+EPSI DAIEI+KG+KPYFEE H++RY+ EA++AAV+LS R+   RKLPDK
Sbjct: 352 VRRFQKIDVNEPSIPDAIEIMKGLKPYFEEFHKIRYTTEAVKAAVELSARYIHDRKLPDK 411

Query: 416 AIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNL 475
           AIDVIDE GA+Q+L P SKR+K I  K+I+ TI++M R I   + S+DD  VL++L++ L
Sbjct: 412 AIDVIDETGAAQMLLPESKRKKTIGLKEIETTISTMAR-IPAKTVSKDDAEVLAHLDETL 470

Query: 476 GTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQL 535
             VVYGQ++A+  L+S+IK+ARAGL DP KPIGCY+FSGPTGVGKTE ++QLA +LG++L
Sbjct: 471 KRVVYGQDKAVTALTSAIKLARAGLRDPEKPIGCYLFSGPTGVGKTEAARQLATSLGIEL 530

Query: 536 LRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNI 595
           +RFDMSEYMERH VSRLIGAPPGYVGF QGG+L DS+DQ+P+ V+LLDEIEK+H D+ NI
Sbjct: 531 VRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDSIDQHPHCVLLLDEIEKAHSDLYNI 590

Query: 596 LLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSR-NDDADKEALRNF 654
           LLQ+MD+G LTD +GK+I FRNVILIMTTNAGA ++++  IGF  ++ +   D EA+   
Sbjct: 591 LLQVMDHGKLTDHNGKQIDFRNVILIMTTNAGAADLARTPIGFTRAKVHSSDDNEAINRL 650

Query: 655 LSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGY 714
            +PEF NRLD+I+ F  L  ++I +VV KF+M+LE QL ++ ++   ++E   WLV HGY
Sbjct: 651 FAPEFRNRLDAIVTFGHLPEEVIARVVDKFVMQLEAQLADRNVTIELTDEARAWLVEHGY 710

Query: 715 DVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFF 767
           D  MGARP+ R+I + +K PLADE+LFG+LK GG  V+V +  D+S +  + F
Sbjct: 711 DQAMGARPMARVIHQSIKTPLADEVLFGRLKNGGA-VRVVVVTDESGAKTLGF 762


>gi|288957527|ref|YP_003447868.1| ATP-dependent Clp protease ATP-binding subunit [Azospirillum sp.
           B510]
 gi|288909835|dbj|BAI71324.1| ATP-dependent Clp protease ATP-binding subunit [Azospirillum sp.
           B510]
          Length = 771

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/759 (60%), Positives = 587/759 (77%), Gaps = 14/759 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL  ANER HEYATLEHLLLAL +DSDA  V+ +C +DL  L+  L +
Sbjct: 1   MLSRNLEQTLHRALAHANERRHEYATLEHLLLALTEDSDATAVLRACGIDLDRLRAELSD 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           Y+DN+ +N + N    + KPT+ FQRV+QRA +HVQS+GR  VTGAN+LVALFSE +SHA
Sbjct: 61  YLDNELANLITNRPD-DAKPTAGFQRVLQRAAIHVQSSGREEVTGANVLVALFSERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQEQEMT +DAVN+ISHGI+K    ++ +         +G+D E        K    
Sbjct: 120 VYFLQEQEMTRFDAVNYISHGIAKAPGRSDTKR-------VSGADDEAAAEKVVKKGS-- 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL AYCV+L +K   GK+D L+GR +E+ RTIQILCRRSKNNPLYVGDPGVGKTAIA
Sbjct: 171 --EALEAYCVNLNKKASGGKIDPLIGREQEVERTIQILCRRSKNNPLYVGDPGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV   VP++L  A IF+LDMG+L+AGTRYRGDFEER+K +V E+E+   AIL+I
Sbjct: 229 EGLARRIVQQEVPEVLRNATIFALDMGSLLAGTRYRGDFEERLKAVVSELEATEGAILFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ SG ++DASNLLKPAL+SG++RCIGSTTY EYR +FEKD+ALVRRFQKI
Sbjct: 289 DEIHTVIGAGATSGGAMDASNLLKPALASGSLRCIGSTTYKEYRSYFEKDRALVRRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPSIEDAI+I++G+KPY+E+HH++ Y+ +AIR AV+LS ++   RKLPDKAID+IDE
Sbjct: 349 DVNEPSIEDAIKILQGLKPYYEKHHKVTYTNDAIRVAVELSAKYIGDRKLPDKAIDIIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
            GA+Q+L P +KRRK I  KD++  +A + R I   S SRDD   L NLE++L T+V+GQ
Sbjct: 409 VGAAQMLLPENKRRKKIGVKDVEAVVAKIAR-IPPKSVSRDDKETLLNLERDLKTMVFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
            +AI  L S+IK+ARAGL +P KPIG Y+F+GPTGVGKTE+++QLA  LG++L RFDMSE
Sbjct: 468 NKAIDALVSAIKLARAGLREPEKPIGNYLFTGPTGVGKTEVARQLAMTLGIELTRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L D++DQ+P+ V+LLDEIEK+HPD+ NILLQIMD+
Sbjct: 528 YMERHTVSRLIGAPPGYVGFDQGGMLTDAIDQHPHCVLLLDEIEKAHPDLFNILLQIMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +GK + FRNVILIMT+NAGA +M+K  IGF   R    D EA+    +PEF NR
Sbjct: 588 GKLTDHNGKIVDFRNVILIMTSNAGAADMAKPAIGFERDRRVGEDIEAVEKMFTPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+IIPF PL+ ++I +VV KFIM++E QL+++G+S   +EE   WL   GYD   GARP
Sbjct: 648 LDAIIPFAPLTQEVINRVVDKFIMQMEAQLEDRGVSIELNEEAREWLGKKGYDPLYGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSA 761
           L R+I+E++K PLA+E+LFGKL K GG+VKV++  DK A
Sbjct: 708 LGRVIQEYIKKPLAEELLFGKLSK-GGLVKVTVKDDKPA 745


>gi|197104768|ref|YP_002130145.1| ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Phenylobacterium zucineum HLK1]
 gi|196478188|gb|ACG77716.1| ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Phenylobacterium zucineum HLK1]
          Length = 771

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/789 (58%), Positives = 600/789 (76%), Gaps = 21/789 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ LH+A+  AN+R HEYATLEHLLL+L+DD DAA VM +C+VDL  L+  L
Sbjct: 1   MPSFSRQLEESLHRAVAYANQRKHEYATLEHLLLSLVDDEDAAGVMRACDVDLGALRTTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            NY+DN+  + + +    + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+FSE +S
Sbjct: 61  TNYVDNELRSLVVDDGE-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+I+HGI+K+             G++     +G  +D + +  
Sbjct: 120 HAAYFLQEQDMTRYDAVNYIAHGIAKKA------------GATEAKPVKGAEDDEKPQVK 167

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYC++L EK K+GKVD L+GR  E+ R IQILCRR+KNNPL VGDPGVGKTA
Sbjct: 168 TG-GEALEAYCINLNEKAKQGKVDPLIGRMAEVERCIQILCRRTKNNPLLVGDPGVGKTA 226

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+  VP++L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E++ +A+L
Sbjct: 227 IAEGLARKIVNKQVPEVLANATIFSLDMGALLAGTRYRGDFEERVKQVVKELENHPDAVL 286

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY E+RQ FEKD+ALVRRFQ
Sbjct: 287 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTLRCMGSTTYKEFRQHFEKDRALVRRFQ 346

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+I+D I+I+KG+K Y+EE H+LRY+ +AI+AAV+LS ++ T RKLPDKAID+I
Sbjct: 347 KIDVNEPTIDDTIKILKGLKSYYEEFHKLRYTNDAIKAAVELSAKYITDRKLPDKAIDII 406

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGASQ+L P  +R+K +  K+++  +A + R I   S S+ D   L  LE +L   VY
Sbjct: 407 DEAGASQMLLPEGRRKKTLGVKEVEAVVAKIAR-IPPKSVSKSDTEALKQLEGDLKRAVY 465

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+EAI++LS+++K+ARAGL D NKPIGCY+F+GPTG GKTE ++QLA  LG++LLRFDM
Sbjct: 466 GQDEAIEQLSAAMKMARAGLRDANKPIGCYLFTGPTGTGKTETARQLAGTLGIELLRFDM 525

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D+VDQ+P++VVLLDEIEK+HPDV NILLQ+M
Sbjct: 526 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVDQHPHAVVLLDEIEKAHPDVYNILLQVM 585

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GKKI FRNV+LIMTTNAGA +  +  IGFG  + DD  +EAL+   +PEF 
Sbjct: 586 DHGQLTDSNGKKIDFRNVVLIMTTNAGAADAQRNAIGFGRGKQDDEVEEALKRQFTPEFR 645

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L+ +IIRQVV KF+M+LE QL ++ ++    +E  +WL  +G+D   GA
Sbjct: 646 NRLDAIVHFHALTPEIIRQVVLKFVMQLEAQLADRHVTIETDDEAADWLAKNGFDELYGA 705

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RPL R+I+E++K PLADEILFG+L KGG  VKV L   K A     FEIE          
Sbjct: 706 RPLARVIQENIKKPLADEILFGRLTKGGH-VKVVLKDGKLA-----FEIEGQTREPGAPV 759

Query: 781 EEKEVEDIK 789
            EK  E+ +
Sbjct: 760 VEKPAEETE 768


>gi|144898736|emb|CAM75600.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 764

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/756 (60%), Positives = 585/756 (77%), Gaps = 14/756 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+NLE+ L +AL LA ER HEYATLEHLLLAL +D+DA  VM +CNVD+  L  +L +
Sbjct: 1   MLSQNLEQSLRRALALAAERRHEYATLEHLLLALTEDNDALAVMRACNVDVGRLTGDLRD 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D+ S N L +   VE KPT+ FQRVVQRA +HVQS+GR  VTGAN++VALFSE +SHA
Sbjct: 61  FVDH-SLNDLISDKLVEPKPTAGFQRVVQRAAIHVQSSGREEVTGANVIVALFSERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQ Q+MT  DAVN+ISHG++K    A       V G+   ++ E  V          
Sbjct: 120 VYFLQTQDMTRLDAVNYISHGVAK---AAGRSQNRTVHGADEEANPEKVVKKGHE----- 171

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+AYC+DL +K   GK+D L+GR  EI RTIQILCRRSKNNPLYVGDPGVGKTAIA
Sbjct: 172 ---ALNAYCIDLNKKASVGKIDPLIGREAEIERTIQILCRRSKNNPLYVGDPGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +IV G VPD+L GA IFSLDMG L+AGTRYRGDFEER+K +V E+E++  AI++I
Sbjct: 229 EGLALRIVKGEVPDVLRGATIFSLDMGTLLAGTRYRGDFEERLKAVVTELENFPGAIMFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ SG S+DASNLLKPAL+SGA+RCIGSTTY EYR  FEKD+ALVRRFQKI
Sbjct: 289 DEIHTVIGAGATSGGSMDASNLLKPALASGALRCIGSTTYKEYRNHFEKDRALVRRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPS+ED+I+I+ GIK Y+E HH ++Y+ +AI+AAV+L+ ++ T RKLPDKAIDVIDE
Sbjct: 349 DVNEPSVEDSIKILNGIKVYYENHHHVKYTNDAIKAAVELAAKYITDRKLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
            GA+++L P SKRRK +T KD++  +A + R I   S S +D   L  LE++L T+V+GQ
Sbjct: 409 VGAARMLLPESKRRKTVTVKDVEDIVAKIAR-IPPKSVSTNDVEALRTLERDLKTLVFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           E+AI+ L+S+IK+ARAGL +P KPIGCY+FSGPTGVGKTE+++QLA  +G++L RFDMSE
Sbjct: 468 EKAIEALASAIKLARAGLREPEKPIGCYLFSGPTGVGKTEVARQLARIMGIELTRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH+VSRLIGAPPGYVGF QGG+L D++DQ+P+ V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 528 YMERHSVSRLIGAPPGYVGFDQGGLLTDAIDQHPHCVLLLDEIEKAHPDLFNILLQVMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +GK + FRNVILIMTTNAGA +M+K  IGF     +  D+EA++   +PEF NR
Sbjct: 588 GRLTDHNGKNVDFRNVILIMTTNAGAADMAKPAIGFERESREGDDQEAIQRMFTPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LDSIIPF  LS++I+ QVV KF+++LE QL ++ +    +E    WLV  GYD   GARP
Sbjct: 648 LDSIIPFASLSTEIVAQVVDKFVIQLEAQLSDRDVHIELTESARQWLVKKGYDRAFGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           L R+I+EH+K PLA+E+LFGKL K GGVVKV ++ D
Sbjct: 708 LGRVIQEHIKKPLAEELLFGKLAK-GGVVKVGVDDD 742


>gi|300022148|ref|YP_003754759.1| ATP-dependent Clp protease ATP-binding subunit clpA [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523969|gb|ADJ22438.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 816

 Score =  942 bits (2435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/785 (57%), Positives = 599/785 (76%), Gaps = 17/785 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M+  S+NLE  LH+A+  AN R+HE+ATLEHLLLAL+DD DAA VM +C+VDL+ L+  L
Sbjct: 1   MTSLSKNLEASLHRAVQYANVRHHEFATLEHLLLALVDDRDAAAVMRACSVDLEQLRARL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + Y+D +    +    R +  PT+SFQRVVQRA++HVQ++GR  VTGAN+LV +FSE +S
Sbjct: 61  IEYLDTELKPIVSKSAR-DAHPTNSFQRVVQRAIVHVQTSGREEVTGANVLVGIFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQEMT +DAV +I+HGI+KR      ++   VD  +  ++GE          +
Sbjct: 120 HAAYFLQEQEMTRFDAVQYIAHGIAKRPGMFEPRTVRGVDEDATATEGE----------E 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCV+L +K + GK+D L+GR +E+ RT+Q+LCRR KNNPL+VGDPGVGKTA
Sbjct: 170 RKPGDALNTYCVNLNKKARDGKIDPLIGREQEVMRTVQVLCRRQKNNPLFVGDPGVGKTA 229

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G VPD+L GA IF+LDMG L+AGTRYRGDFEER+K ++KE+E++  A+L
Sbjct: 230 IAEGLARKIVGGQVPDVLKGATIFALDMGALLAGTRYRGDFEERLKAVMKEVEAFPGAVL 289

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL SG +RCIGSTTY EYRQ FEKD+ALVRRFQ
Sbjct: 290 FIDEIHTVIGAGATSGGAMDASNLLKPALQSGTLRCIGSTTYKEYRQHFEKDRALVRRFQ 349

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP++EDAIEI+KG+K  FE++H+++Y+ EAI+AAV LS ++   RKLPDKAIDVI
Sbjct: 350 KIDVKEPTVEDAIEILKGLKTVFEDYHKVKYTNEAIKAAVDLSAKYIHDRKLPDKAIDVI 409

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P  KR++ IT K+I+ T+A M R I   + ++ D  V+++++++L  +V+
Sbjct: 410 DETGASQMLLPEGKRKRKITTKEIEATVAVMAR-IPPKTVTKSDAQVIAHIDRDLKRLVF 468

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ LSS+IK+ARAGL +P KPIGCY+FSGPTGVGKTE++KQLA  +GV+LLRFDM
Sbjct: 469 GQDKAIEALSSAIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLANLMGVELLRFDM 528

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+H VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 529 SEYMEKHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 588

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +GK + FRNVILIMTTNAGA +M++  +GF   + +  D EA+    +PEF 
Sbjct: 589 DHGKLTDHNGKSVDFRNVILIMTTNAGASDMARPPMGFNRQKREGEDTEAVTKLFTPEFR 648

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF  LS +II QVV KFI +LE QL ++ +S   S+E   WL   GYD K GA
Sbjct: 649 NRLDAIVPFSGLSPEIIAQVVEKFIFQLEAQLADRSVSIELSDEATRWLAEKGYDEKFGA 708

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLN---PDKSASSPIFFEIENSGSNIS 777
           RPL R+I+E++K PLA+E+LFGKL + GG VKV +    PD+  +   F  ++ S    S
Sbjct: 709 RPLARVIQEYIKKPLAEELLFGKL-ENGGTVKVLVKGKGPDRELAFE-FLPLDPSKRVRS 766

Query: 778 LETEE 782
            E EE
Sbjct: 767 AEDEE 771


>gi|302382576|ref|YP_003818399.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193204|gb|ADL00776.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 770

 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/763 (59%), Positives = 590/763 (77%), Gaps = 27/763 (3%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ LH+A+  ANER HEYATLEHLLLAL+DD+DA+ VM +CNVDL  LK  L
Sbjct: 1   MPSFSRPLEETLHRAVSYANERRHEYATLEHLLLALVDDADASAVMKACNVDLTALKTAL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D D +  L      + KPT+ FQRV+QRAV+HVQS+GR  V+GAN+LVA+FSE +S
Sbjct: 61  TLYVDTDLA-ALATSDGEDAKPTAGFQRVIQRAVIHVQSSGREEVSGANVLVAIFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISK-------RKEFANFQSKLNV-DGSSAGSDGEGFV 172
           HA YFLQEQ+MT YDAVNFI+HGI K       R   A  QS     D ++  S GE   
Sbjct: 120 HAAYFLQEQDMTRYDAVNFIAHGIPKKAGAGEARPPKAQGQSPEEAEDAAAVKSGGE--- 176

Query: 173 NDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVG 232
                        AL AYCVDL EK K GK+D L+GR  E++R+IQILCRR+KNNPL VG
Sbjct: 177 -------------ALEAYCVDLNEKSKNGKIDPLIGRQAEVDRSIQILCRRTKNNPLLVG 223

Query: 233 DPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEI 292
           +PGVGKTAIAEG A +IV G VPD+L GA I+SLDMG L+AGTRYRGDFEER+K++VKE+
Sbjct: 224 EPGVGKTAIAEGLALKIVKGEVPDVLKGATIYSLDMGALLAGTRYRGDFEERLKQVVKEL 283

Query: 293 ESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKD 352
           E++ +AIL+IDEIHT++GAG+ SG ++DASNLLKPAL+SG++RC+GSTTY EYRQ FEKD
Sbjct: 284 ETHEDAILFIDEIHTVIGAGATSGGAMDASNLLKPALASGSLRCMGSTTYKEYRQHFEKD 343

Query: 353 KALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKL 412
           +ALVRRFQKIDV+EP++ED ++I+KG+K  +E HH+LRY+  AIR+AV+LS R+ T RKL
Sbjct: 344 RALVRRFQKIDVNEPTVEDTVKILKGLKTAYEGHHKLRYTDAAIRSAVELSARYMTDRKL 403

Query: 413 PDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLE 472
           PDKAIDVIDEAGASQ+L P SKR+K I +K+++  +A M R I   S S+ D   L  L+
Sbjct: 404 PDKAIDVIDEAGASQMLLPESKRKKVIGQKEVEAVVAKMAR-IPPKSVSKTDTEGLRELQ 462

Query: 473 KNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALG 532
            +L   V+GQ+ AI++++S++K+ARAGL DP KPIG ++F+GPTGVGKTE++KQLA  LG
Sbjct: 463 TDLNRAVFGQDAAIEQVASAMKLARAGLRDPQKPIGSFLFAGPTGVGKTEVAKQLASTLG 522

Query: 533 VQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDV 592
           +++LRFDMSEYMERH VSRLIGAPPGYVG  QGG+L D+VDQ+P++VVLLDEIEK+HPDV
Sbjct: 523 IEMLRFDMSEYMERHTVSRLIGAPPGYVGHDQGGLLTDAVDQHPHAVVLLDEIEKAHPDV 582

Query: 593 LNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALR 652
            NILLQ+MD G+LTD  GKK+ FRNV+LIMTTNAGA + ++A IGFG  + +  D++A++
Sbjct: 583 YNILLQVMDNGMLTDAVGKKVDFRNVVLIMTTNAGAADNARASIGFGRGKVEGEDEKAIQ 642

Query: 653 NFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSH 712
              +PEF NRLD+++ F PL+++ IR VV KF+++LE QL ++ I+   +++  +WL  +
Sbjct: 643 RLFAPEFRNRLDAVVSFKPLAAETIRMVVTKFVLQLEAQLADRNITIELTDDAADWLAKN 702

Query: 713 GYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           G+D   GARPL R+I+E++K PLAD+ILFG+L +GG  VKV+L
Sbjct: 703 GFDELYGARPLGRVIQENIKKPLADDILFGRLTRGGH-VKVAL 744


>gi|23016165|ref|ZP_00055924.1| COG0542: ATPases with chaperone activity, ATP-binding subunit
           [Magnetospirillum magnetotacticum MS-1]
          Length = 765

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/774 (59%), Positives = 592/774 (76%), Gaps = 14/774 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL  A+ER HEYATLEHLLLAL DD DA  V+ +CNVD+  LK +L  
Sbjct: 1   MLSRNLEQSLHRALSQASERRHEYATLEHLLLALTDDQDAVAVLRACNVDIDKLKRDLGE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID + S +L +    + KPT+ FQRVVQRA +HVQS+GR  VTGAN++VALFSE +SHA
Sbjct: 61  FIDTNLS-ELVSPRGTDPKPTAGFQRVVQRAAIHVQSSGREEVTGANVIVALFSERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQ Q+MT  DAVN+ISHG++K       QS+  V G+   ++ +  V   Q      
Sbjct: 120 VYFLQNQDMTRLDAVNYISHGVAKAP--GRGQSR-TVHGADEDANPDKVVKKGQE----- 171

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+AYCV+L +K  +GK+D L+GR EEI+RTIQILCRRSKNNPLYVGDPGVGKTAIA
Sbjct: 172 ---ALNAYCVNLNKKAAQGKIDPLIGRDEEIDRTIQILCRRSKNNPLYVGDPGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VPD+L  A IF+LDMG L+AGTRYRGDFEER+K +V E+E+Y  A+++I
Sbjct: 229 EGLARRIVNGEVPDVLKNATIFALDMGALLAGTRYRGDFEERLKAVVTELENYDGAVMFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ SG S+DASNLLKPAL+SG++RCIGSTTY E+R  FEKD+ALVRRFQKI
Sbjct: 289 DEIHTVIGAGATSGGSMDASNLLKPALASGSLRCIGSTTYKEFRNHFEKDRALVRRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPSI DAI+I+ GIK Y+E HH++RY+ EAI+AAV+LS ++ T RKLPDKAIDVIDE
Sbjct: 349 DVAEPSIPDAIKILNGIKTYYESHHKVRYTAEAIKAAVELSAKYITDRKLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
            GAS++L P SKRRK +T KDI+  +A + R I   S S +D   L NLE++L T+V+GQ
Sbjct: 409 VGASRMLLPESKRRKTVTVKDIEDIVAKIAR-IPPKSVSTNDVEALRNLERDLKTLVFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ L+S+IK+ARAGL +P KPIGCY+FSGPTGVGKTE+++QLA  +G++L RFDMSE
Sbjct: 468 DKAIEALASAIKLARAGLREPEKPIGCYLFSGPTGVGKTEVARQLAKIMGIELTRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH+VSRLIGAPPGYVGF QGG+L D++DQ+P+SV+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 528 YMERHSVSRLIGAPPGYVGFDQGGLLTDAIDQHPHSVLLLDEIEKAHPDLFNILLQVMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +GK + FRNVILIMTTNAGA +++K+ IGFG    +  D +A+    SPEF NR
Sbjct: 588 GRLTDHNGKTVDFRNVILIMTTNAGAADLAKSAIGFGRESREGDDTDAINRMFSPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LDS I F  L+ +I+ QVV KF+M LE QL ++ ++   ++E   WL   GYD   GARP
Sbjct: 648 LDSTIAFASLTPEIVAQVVDKFVMHLETQLGDRDVTIELTDEARAWLSKKGYDRSFGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNI 776
           L R+I+EH+K PLA+E+LFG+L K GG+V++ +  D   +      I  +   I
Sbjct: 708 LARVIQEHIKKPLAEELLFGRLSK-GGIVRIRVGEDNKLAFEFLATIHKTADKI 760


>gi|315498281|ref|YP_004087085.1| ATP-dependent clp protease, ATP-binding subunit clpa [Asticcacaulis
           excentricus CB 48]
 gi|315416293|gb|ADU12934.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Asticcacaulis
           excentricus CB 48]
          Length = 769

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/752 (60%), Positives = 582/752 (77%), Gaps = 11/752 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ LH+A+  AN  +HEYATLEHLLLAL+DD+DAA VM +CNVDL  L+  L
Sbjct: 1   MPSFSSALEETLHRAVGHANTHHHEYATLEHLLLALVDDADAAGVMTACNVDLTKLRTAL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             YI+ D  + L      E KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+FSE +S
Sbjct: 61  TAYIETDLKS-LVVPHSEEAKPTAGFQRVIQRAVIHVQSSGRDEVTGANVLVAIFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSA-GSDGEGFVNDYQAKT 179
           HA +FLQEQEMT YDAVN+I+HGI+K+   +  ++   V GSS  GS      +   A T
Sbjct: 120 HAAFFLQEQEMTRYDAVNYIAHGIAKKPGASEPRT---VRGSSEDGSPSSEEKSGKAAST 176

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
           D     AL+AYCVDL EK + GKVD L+GR  E+ R IQILCRR+KNNPL VGDPGVGKT
Sbjct: 177 D-----ALAAYCVDLNEKSRHGKVDPLIGRSAEVERAIQILCRRTKNNPLLVGDPGVGKT 231

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG AK+IV+G VP++L GA I+SLDMG L+AGTRYRGDFEER+K++VKE+E++ NAI
Sbjct: 232 AIAEGLAKKIVEGEVPEVLSGATIYSLDMGTLLAGTRYRGDFEERVKQVVKELEAHPNAI 291

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHT++GAG+ SG ++DASNLLKPAL+SGA+RC+GSTTY EYRQ FEKD+ALVRRF
Sbjct: 292 LFIDEIHTVIGAGATSGGAMDASNLLKPALASGALRCMGSTTYKEYRQHFEKDRALVRRF 351

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV+EPS++D ++I+KG+KPY+E  H L+Y+  AI+ AV+LS R+ T RKLPDKAIDV
Sbjct: 352 QKIDVTEPSLDDTVKILKGLKPYYETFHNLKYTDAAIKTAVELSARYITDRKLPDKAIDV 411

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA Q++ P  KR+K I  K+I+  IA + R I + S S+ D   L +L  +L  VV
Sbjct: 412 IDEAGALQVILPEGKRKKVIGPKEIETVIAKIAR-IPSKSVSKTDTEALRDLTNDLQRVV 470

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ+EAI++LS+++K+ARAGL D NKPIG Y+FSGPTGVGKTE++KQL+  LG++LLRFD
Sbjct: 471 FGQDEAIEQLSAAMKLARAGLRDANKPIGSYLFSGPTGVGKTEVAKQLSQTLGIELLRFD 530

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERH VSRLIGAPPGYVG  QGG+L D+VDQ P+++VLLDEIEK+HPD+ NILLQ+
Sbjct: 531 MSEYMERHTVSRLIGAPPGYVGHDQGGLLTDAVDQTPHAIVLLDEIEKAHPDIYNILLQV 590

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD G LTD  GKK+ FRNV+LIMTTNAGA +  K  IGFG  +    D+ A++   +PEF
Sbjct: 591 MDNGTLTDAVGKKVDFRNVVLIMTTNAGASDNQKNSIGFGREKVSGEDEVAIKRLFTPEF 650

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+I+ F  L  ++I QVV KFI++LE+QL ++ I+   S +   WL  +GYD   G
Sbjct: 651 RNRLDAIVTFRQLKPEVIGQVVQKFILQLEMQLADRNITIELSPDAEKWLAENGYDELYG 710

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           ARPL R+I+E++K PLADEILFGKL +GG ++
Sbjct: 711 ARPLARVIQENIKKPLADEILFGKLVRGGHIL 742


>gi|163797887|ref|ZP_02191831.1| ATPase with chaperone activity, ATP-binding subunit [alpha
           proteobacterium BAL199]
 gi|159176849|gb|EDP61417.1| ATPase with chaperone activity, ATP-binding subunit [alpha
           proteobacterium BAL199]
          Length = 783

 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/760 (60%), Positives = 587/760 (77%), Gaps = 20/760 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+NLE+ LH+AL +ANE++HEYATLEHLL AL +D DA  V+ +C VD+  L+ +L+ 
Sbjct: 1   MLSKNLEQSLHRALGIANEKHHEYATLEHLLYALSEDQDALAVLKACGVDVDKLRLDLMT 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           YID +  N L      + KPT+ FQRVVQRAV+HVQS+GR  VTGAN++VAL SE +SHA
Sbjct: 61  YIDTEL-NGLVGAALEDAKPTAGFQRVVQRAVIHVQSSGREEVTGANVMVALLSERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISK-RKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDL 181
            YFLQEQEMT +DAV++ISHGI+K   +  + Q K  VDG+           D QAK D 
Sbjct: 120 VYFLQEQEMTRFDAVSYISHGIAKVHGQTGSEQRK--VDGA-----------DEQAKADQ 166

Query: 182 ---NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                  AL AYCVDL  K   GK+D L+GR +E++RTIQILCRR+KNNPL+VGDPGVGK
Sbjct: 167 VNKQGHEALDAYCVDLNTKAAAGKIDPLIGREKEVDRTIQILCRRTKNNPLFVGDPGVGK 226

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG AK+IVDG VP++L+  RIF+LDMG L+AGTRYRGDFEER+K +V E+E   +A
Sbjct: 227 TAIAEGLAKRIVDGDVPEVLINNRIFALDMGALLAGTRYRGDFEERLKAVVNELEQNPHA 286

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHT++GAG+ SG ++DASNLLKPAL SG +RCIGSTTY EYR +FEKD+ALVRR
Sbjct: 287 ILFIDEIHTVIGAGATSGGAMDASNLLKPALQSGGLRCIGSTTYKEYRGYFEKDRALVRR 346

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV+EPSIED I+I+KG+KPY+E+HH +RY+ +A++ AV+LS ++   RKLPDKAID
Sbjct: 347 FQKIDVNEPSIEDTIKILKGLKPYYEKHHNVRYTADALKTAVELSAKYIGDRKLPDKAID 406

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           +IDE GA+Q+L P S+RRK I  K+I++ +A + R I   S S DD +VL+NLE++L TV
Sbjct: 407 IIDEVGAAQMLVPASRRRKTIGVKEIEEIVAMIAR-IPPKSVSTDDKTVLANLERDLKTV 465

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ+ AI  L+S+IK+ARAGL +  KPIG Y+FSGPTGVGKTE+++QLA  LGV+L+RF
Sbjct: 466 VFGQDSAIASLASAIKLARAGLRESEKPIGSYLFSGPTGVGKTEVARQLALTLGVELIRF 525

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH+VSRLIGAPPGYVGF QGG+L D +DQ+P+ V+LLDEIEK+HPD+ N+LLQ
Sbjct: 526 DMSEYMERHSVSRLIGAPPGYVGFDQGGLLTDQIDQHPHCVLLLDEIEKAHPDLFNVLLQ 585

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +GK + FRNVILIMTTNAGA +++K  IGFG S  +  D EA+    +PE
Sbjct: 586 VMDHGKLTDHNGKSVDFRNVILIMTTNAGAADLAKEAIGFGRSVREGDDTEAINRMFTPE 645

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+I+ F  LS + I +VV KF+M+LE QL ++G+S   +E    WL   GYD   
Sbjct: 646 FRNRLDAIVGFKALSPETIDRVVDKFVMQLEAQLADRGVSIELTEAARGWLAKRGYDRLY 705

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           GARPL R+I+EHVK PLA+E+LFGKL K GG+V+V +  D
Sbjct: 706 GARPLARVIQEHVKKPLAEELLFGKLVK-GGLVRVDMVDD 744


>gi|329851349|ref|ZP_08266106.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Asticcacaulis
           biprosthecum C19]
 gi|328840195|gb|EGF89767.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Asticcacaulis
           biprosthecum C19]
          Length = 771

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/754 (59%), Positives = 582/754 (77%), Gaps = 16/754 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ LH+A+  AN  +HEYATLEHLLLALIDD DAA VM +CNVDL  L+  L
Sbjct: 1   MPSFSSALEETLHRAVGHANAHHHEYATLEHLLLALIDDVDAAAVMTACNVDLPKLRTAL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             YI+ D  + L      E KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+FSE +S
Sbjct: 61  DAYIETDLKS-LVEPQSEEAKPTAGFQRVIQRAVIHVQSSGRDEVTGANVLVAIFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKR---KEFANFQSKLNVDGSSAGSDGEGFVNDYQA 177
           HA +FLQEQEMT YDAVN+I+HGI+K+    E  + +S    + S++    +    D   
Sbjct: 120 HAAFFLQEQEMTRYDAVNYIAHGIAKKPGASEPRSVRSATEDNNSTSEEKAKAGSTD--- 176

Query: 178 KTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG 237
                   AL+AYCVDL EK + GKVD L+GR  E+ R IQILCRR+KNNPL VGDPGVG
Sbjct: 177 --------ALTAYCVDLNEKSRHGKVDPLIGRSAEVERAIQILCRRTKNNPLLVGDPGVG 228

Query: 238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN 297
           KTAIAEG AK+IVDG VP++L GA I+SLDMG L+AGTRYRGDFEER+K++VKE+E++ N
Sbjct: 229 KTAIAEGLAKKIVDGEVPEVLAGATIYSLDMGTLLAGTRYRGDFEERVKQVVKELEAHPN 288

Query: 298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR 357
           A+L+IDEIHT++GAG+ SG ++DASNLLKPAL++G++RC+GSTTY EYRQ FEKD+ALVR
Sbjct: 289 AVLFIDEIHTVIGAGATSGGAMDASNLLKPALAAGSLRCMGSTTYKEYRQHFEKDRALVR 348

Query: 358 RFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI 417
           RFQKIDV+EP+++D I+I++G+KPY+E  H L+Y+  AI+ AV+LS R+ T RKLPDKAI
Sbjct: 349 RFQKIDVNEPTLDDTIKILRGLKPYYETFHHLKYTDAAIKMAVELSARYITDRKLPDKAI 408

Query: 418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGT 477
           DVIDEAGA Q++ P  KR+K I  K+I+  I+ + R + + + SRDD   L +++ +L  
Sbjct: 409 DVIDEAGALQMVLPEHKRKKVIGPKEIEYVISKIAR-VPSKTVSRDDTQALRDMKTDLQR 467

Query: 478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLR 537
           VV+GQ+EAI++LS++IK+ARAGL DP KPIGCY+FSGPTGVGKTE++KQL+  +G+ LLR
Sbjct: 468 VVFGQDEAIEQLSTAIKLARAGLRDPQKPIGCYLFSGPTGVGKTEVAKQLSATMGIDLLR 527

Query: 538 FDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL 597
           FDMSEYMERH VSRLIGAPPGY+G  QGG+L D+VDQ P+++VLLDEIEK+H D+ NILL
Sbjct: 528 FDMSEYMERHTVSRLIGAPPGYIGHDQGGLLTDAVDQQPHAIVLLDEIEKAHQDIYNILL 587

Query: 598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP 657
           Q+MD+G LTD  GKK+ FRNV+LIMTTNAGA +  K  IGFG  +    D++A++   +P
Sbjct: 588 QVMDHGQLTDAVGKKVDFRNVVLIMTTNAGASDNQKNSIGFGREKVTGEDEQAIKRLFTP 647

Query: 658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVK 717
           EF NRLD+I+ F  L  ++I +VV KFI++LE+QL ++ IS   +E+   WL  +GYD  
Sbjct: 648 EFRNRLDAIVTFRQLKPEVISKVVEKFILQLEMQLADRHISIEMTEDAGKWLAENGYDEL 707

Query: 718 MGARPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
            GARPL R+I+E++K PLADEILFGKL KGG ++
Sbjct: 708 YGARPLARVIQENIKKPLADEILFGKLVKGGHIL 741


>gi|221638713|ref|YP_002524975.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhodobacter
           sphaeroides KD131]
 gi|221159494|gb|ACM00474.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhodobacter
           sphaeroides KD131]
          Length = 771

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/758 (60%), Positives = 576/758 (75%), Gaps = 11/758 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE ATLEHLLLALID+ DA+ VM +C+VDL  L+  L
Sbjct: 1   MPSFSTTLEQAIHGALALANARRHELATLEHLLLALIDEPDASRVMKACSVDLDELRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +++ID+D S  + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VDFIDDDLSTLVTSVEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +     +        E      +AK  
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPSYGEPRPVTGAEEHHETPKAEAG----EAKES 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALS YCVDL  K +KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 177 -----ALSKYCVDLNVKARKGDVDPLIGREHEVERCIQVLCRRRKNNPLLVGDPGVGKTA 231

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G  PDIL  A IFSLDMG L+AGTRYRGDFEER+K +VKE+E + +AIL
Sbjct: 232 IAEGLARKIVNGETPDILARATIFSLDMGALLAGTRYRGDFEERLKAVVKEMEDHPDAIL 291

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY EYRQ FEKD+AL RRFQ
Sbjct: 292 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEYRQHFEKDRALSRRFQ 351

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ED ++I+ G+KPYFEEHH LRY+++AIR AV+LS R+   RKLPDKAIDVI
Sbjct: 352 KIDVNEPSVEDTVKILMGLKPYFEEHHDLRYTQDAIRTAVELSARYIHDRKLPDKAIDVI 411

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  ++I+  +A + R I   S S+DD  VL +LEK L  VV+
Sbjct: 412 DEAGAAQHLLADSKRRKTIGPREIEAVVAKIAR-IPPKSVSKDDAEVLRDLEKTLKRVVF 470

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 471 GQDRAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLASILGVELLRFDM 530

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 531 SEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEIEKAHPDVYNILLQVM 590

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNVILIMT+NAGA E++K+ IGFG  R +  D  A+    +PEF 
Sbjct: 591 DHGKLTDHNGRSVDFRNVILIMTSNAGAAELAKSAIGFGRDRREGEDTAAIERTFTPEFR 650

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  +II QVV KF+++LE QL ++G+    S E   WL   GYD KMGA
Sbjct: 651 NRLDAVISFAPLGKEIILQVVEKFVLQLEAQLMDRGVHIELSPEAAAWLGDKGYDDKMGA 710

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           RPL R+I+E++K PLA+E+LFG+L K GG+VKV +  D
Sbjct: 711 RPLGRVIQENIKKPLAEELLFGRLVK-GGLVKVGVKDD 747


>gi|254502453|ref|ZP_05114604.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Labrenzia
           alexandrii DFL-11]
 gi|222438524|gb|EEE45203.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Labrenzia
           alexandrii DFL-11]
          Length = 799

 Score =  935 bits (2416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/748 (62%), Positives = 596/748 (79%), Gaps = 19/748 (2%)

Query: 16  LVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNG 75
           + LANER  EYATLEHLLLAL+DD DAA VM +CNVDL  ++ NL+ YI+ +  N + + 
Sbjct: 1   MALANERQQEYATLEHLLLALLDDQDAAAVMRACNVDLDTIRQNLIEYIETELDNLVTDS 60

Query: 76  FRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYD 135
              + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+F+E +SHA YFLQ+Q+MT YD
Sbjct: 61  DE-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERESHAAYFLQDQDMTRYD 119

Query: 136 AVNFISHGISKRKEFANFQSKLNVDGSS-----AGSDGEGFVNDYQAKTDLNLFPALSAY 190
           AVN+ISHGI+KR   +  +    V+G+      +G+D E        KTD     AL AY
Sbjct: 120 AVNYISHGIAKRPGMSETRP---VEGAEEEDVLSGNDAE---KKPTQKTD-----ALEAY 168

Query: 191 CVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIV 250
           CV+L EK +KGK+D L+GR  EI RTIQILCRRSKNNPL+VGDPGVGKTAIAEG A +IV
Sbjct: 169 CVNLNEKAEKGKIDPLIGRDSEIQRTIQILCRRSKNNPLFVGDPGVGKTAIAEGLAHRIV 228

Query: 251 DGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVG 310
           +  VP++L  A IFSLDMG L+AGTRYRGDFEER+K++VKEIE Y  A+++IDEIHT++G
Sbjct: 229 NADVPEVLQDATIFSLDMGALLAGTRYRGDFEERLKQVVKEIEDYPGAVMFIDEIHTVIG 288

Query: 311 AGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIE 370
           AG+ SG ++DASNLLKPAL+SGA+RCIGSTTY EYRQFFEKD+ALVRRFQKIDV+EP+I 
Sbjct: 289 AGATSGGAMDASNLLKPALASGAIRCIGSTTYKEYRQFFEKDRALVRRFQKIDVNEPTIP 348

Query: 371 DAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQ 430
           DAI+I+KG+KPYFE+ H++RY+ +AI+ AV+LS ++   RKLPDKAIDV+DE GASQ+L 
Sbjct: 349 DAIDILKGLKPYFEDFHKVRYTHDAIKTAVELSAKYIADRKLPDKAIDVLDETGASQMLV 408

Query: 431 PLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLS 490
           P ++RRK I  K+I+ TIA+M R I   S S+DD  VL NL K+L  VVYGQ+ AI+ L+
Sbjct: 409 PENRRRKTIGVKEIENTIATMAR-IPPKSVSKDDAEVLENLGKDLKRVVYGQDNAIETLA 467

Query: 491 SSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVS 550
           S+IK+ARAGL +P+KPIG Y+FSGPTGVGKTE+++QLA ++GV+L+RFDMSEYMERH VS
Sbjct: 468 SAIKLARAGLREPDKPIGSYLFSGPTGVGKTEVARQLASSMGVELIRFDMSEYMERHTVS 527

Query: 551 RLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSG 610
           RLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+MD+G LTD +G
Sbjct: 528 RLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVMDHGKLTDHNG 587

Query: 611 KKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFF 670
           K++ FRNVILIMTTNAGA +M+K  +GF   + +  D+EA+    +PEF NRLDSIIPF 
Sbjct: 588 KQVDFRNVILIMTTNAGAADMAKMPVGFNRIKREGDDQEAINKLFTPEFRNRLDSIIPFG 647

Query: 671 PLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEH 730
            L  +++ +VV KF+M+LE+QL ++ ++F   ++ + WL   GYD +MGARPL RII+EH
Sbjct: 648 NLPVEVVYKVVEKFVMQLEVQLADRNVTFELGDDAVKWLADKGYDSQMGARPLGRIIQEH 707

Query: 731 VKVPLADEILFGKLKKGGGVVKVSLNPD 758
           +K PLADE+LFGKLKK GG+VKVS++ D
Sbjct: 708 IKRPLADEVLFGKLKK-GGMVKVSVSED 734


>gi|114569836|ref|YP_756516.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Maricaulis
           maris MCS10]
 gi|114340298|gb|ABI65578.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Maricaulis
           maris MCS10]
          Length = 770

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/753 (59%), Positives = 580/753 (77%), Gaps = 18/753 (2%)

Query: 4   FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNY 63
           FS +LE  LH+AL  ANER HE+ATLEHLLLAL+DD D A VM +C+VDL  L+  L  Y
Sbjct: 5   FSSDLEDSLHRALGYANERGHEFATLEHLLLALVDDQDGAAVMKACDVDLDELRATLTEY 64

Query: 64  IDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHAT 123
           +DN+ +  + +    + KPT+ FQRV+QRAV+HVQ+ GR  VTGAN+LVALF+E +SHA 
Sbjct: 65  VDNELTELVVDDDE-DAKPTAGFQRVIQRAVIHVQNAGREEVTGANVLVALFAERESHAA 123

Query: 124 YFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNL 183
           YFL E++MT YDAVNFISHGI ++             G+S      G     + + D + 
Sbjct: 124 YFLAERDMTRYDAVNFISHGIGRKP------------GASEERAVRGTEPAEEPQKDGD- 170

Query: 184 FPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAE 243
             AL+AY V+L EK + G VD L+GR  E+ R +Q+LCRR KNNPL VGDPGVGKTAIAE
Sbjct: 171 --ALTAYTVNLNEKARNGGVDPLIGRDSEVERCVQVLCRRRKNNPLLVGDPGVGKTAIAE 228

Query: 244 GFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYID 303
           G A++IV+  VPD+L GA I+SLDMG+L+AGTRYRGDFEER+K++VKE+E   NA+L+ID
Sbjct: 229 GIARKIVENQVPDVLEGATIYSLDMGSLLAGTRYRGDFEERVKQVVKELEEKDNAVLFID 288

Query: 304 EIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKID 363
           EIHT++GAG+ SG ++DASNLLKPAL SG +RC+GSTTY EYRQ FEKD+ALVRRFQKID
Sbjct: 289 EIHTVIGAGATSGGAMDASNLLKPALQSGNLRCMGSTTYKEYRQHFEKDRALVRRFQKID 348

Query: 364 VSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEA 423
           V+EPS+ DAI+I++G+K YFE+ H +R++ +A+++AV+LS R+   RKLPDKAIDVIDEA
Sbjct: 349 VAEPSVPDAIKILQGLKTYFEDFHDVRFTNDALKSAVELSSRYMGDRKLPDKAIDVIDEA 408

Query: 424 GASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQE 483
           GA   LQP+SKR+K I  K+++  +A+M R I   S S+DD+  L NLE  L  VV+GQ+
Sbjct: 409 GAQMRLQPVSKRKKTIGVKEVEGIVATMAR-IPPKSVSKDDEQSLRNLETELKHVVFGQD 467

Query: 484 EAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEY 543
           EAI +LS++IK++RAGL +PNKPIGCY+FSGPTGVGKTE++KQLA  +GV+L RFDMSEY
Sbjct: 468 EAISQLSTAIKLSRAGLREPNKPIGCYLFSGPTGVGKTEVTKQLADTMGVELQRFDMSEY 527

Query: 544 MERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYG 603
           MERHAVSRLIGAPPGYVGF QGG+L D +DQ+P+ V+LLDEIEK+HPD+ NILLQ+MD G
Sbjct: 528 MERHAVSRLIGAPPGYVGFDQGGLLTDGIDQHPHCVLLLDEIEKAHPDLFNILLQVMDNG 587

Query: 604 ILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRL 663
            LTD +GKK+ FRNVIL+MTTNAGA +  K  IGFG  +  D   +A+    +PEF NRL
Sbjct: 588 TLTDTNGKKVDFRNVILVMTTNAGASDAQKESIGFGRGKKTDEADKAVERLFTPEFRNRL 647

Query: 664 DSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPL 723
           D++IPF PLS D I +VV KF+++LE QL ++G++F  + +   WL   GYD + GARPL
Sbjct: 648 DAVIPFAPLSPDSIGRVVEKFVLQLEAQLIDRGVTFELTPDATAWLAERGYDSRFGARPL 707

Query: 724 ERIIKEHVKVPLADEILFGKLKKGGGVVKVSLN 756
            R+I+EH+K PLAD+ILFG+LKK GG+VKV ++
Sbjct: 708 ARVIQEHIKKPLADQILFGELKK-GGLVKVDVD 739


>gi|312113136|ref|YP_004010732.1| ATP-dependent Clp protease ATP-binding subunit clpA [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218265|gb|ADP69633.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 786

 Score =  934 bits (2413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/771 (59%), Positives = 599/771 (77%), Gaps = 16/771 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LH+A+  ANER+HEYATLEHLLL+L+DD DA+ V+ +CNVD++ L+  L
Sbjct: 1   MPSFSNSLEESLHRAIEYANERHHEYATLEHLLLSLLDDRDASSVLRACNVDVERLRAKL 60

Query: 61  LNYIDNDSSNKL--KNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEP 118
             ++D + +N +  ++G   E +PT+SFQRV+ RAV+HVQS+GR  VTGAN+LVA+F+E 
Sbjct: 61  TEFLDKELNNLVLDQDG---EAQPTASFQRVIHRAVVHVQSSGREEVTGANVLVAVFAER 117

Query: 119 DSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAK 178
           +S+A YFLQEQ+MT +DAVNFISHGISKR   +  +    V+  +   DG     + +  
Sbjct: 118 ESNAAYFLQEQDMTRFDAVNFISHGISKRAGMSEPRGVRGVEDDATTVDG---AEEKKRS 174

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
           TD     AL AYCV+L +K K G++D L+GR +EI RTIQ+LCRRSKNNPLYVGDPGVGK
Sbjct: 175 TD-----ALEAYCVNLNQKAKDGRIDPLIGRDKEIERTIQVLCRRSKNNPLYVGDPGVGK 229

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A++IV G VP +L  A +FSLDMG L+AGTRYRGDFEER+K ++KEIE+Y  A
Sbjct: 230 TAIAEGLARKIVRGEVPQVLANATVFSLDMGTLLAGTRYRGDFEERLKAVMKEIEAYPGA 289

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHT++GAG+ SG ++DASNLLKPAL SG +RCIGSTTY EYRQ FEKD+ALVRR
Sbjct: 290 ILFIDEIHTVIGAGATSGGAMDASNLLKPALQSGVLRCIGSTTYKEYRQHFEKDRALVRR 349

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV+EP++EDAIEI+KG+KPYFE+ H ++Y+ +AI+AAV+LS ++   RKLPDKAID
Sbjct: 350 FQKIDVAEPTVEDAIEIMKGLKPYFEDFHNIKYTNQAIKAAVELSAKYIHDRKLPDKAID 409

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDE GASQ+L   SKR++ I  K+++ T+A+M R I   + S+ D  +L NLE +L  V
Sbjct: 410 VIDETGASQMLLAPSKRKRTIGVKEVEATVATMAR-IPPKTVSKTDTELLRNLEGDLRRV 468

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ++AI  LS++IK+ARAGL D  KPIG Y+FSGPTGVGKTE+++QLA  LGVQ+LRF
Sbjct: 469 VFGQDQAIHALSAAIKLARAGLRDAEKPIGSYLFSGPTGVGKTEVARQLASLLGVQILRF 528

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH VSRLIGAPPGYVGF QGG+L D VDQNP+ V+LLDEIEK+HPD+ N+LLQ
Sbjct: 529 DMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQNPHCVLLLDEIEKAHPDLFNVLLQ 588

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +GK++ FRNV+LIMTTNAGA +M+K  IGFGS +    D+EA++   SPE
Sbjct: 589 VMDHGKLTDHNGKQVDFRNVVLIMTTNAGAADMAKPAIGFGSQQRVGEDEEAIKRMFSPE 648

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD++IPF  LS ++I +VV KFI +LE QL ++ +    + E + WL  HGYD   
Sbjct: 649 FRNRLDAVIPFARLSREMIGRVVEKFIFQLEAQLADRNVIIELTPEAMEWLADHGYDEMY 708

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEI 769
           GARPL R+I+E +K PLA+E+LFGKL +GGG V+V +  +K     + FE+
Sbjct: 709 GARPLARVIQESIKKPLAEELLFGKL-EGGGTVRVVVE-EKDGQKQLAFEV 757


>gi|209964987|ref|YP_002297902.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Rhodospirillum
           centenum SW]
 gi|209958453|gb|ACI99089.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Rhodospirillum
           centenum SW]
          Length = 765

 Score =  934 bits (2413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/743 (61%), Positives = 580/743 (78%), Gaps = 15/743 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL  ANER HEYATLEHLLLAL +D DA  V+ +C VD++ ++ +L+ 
Sbjct: 1   MLSRNLEQTLHRALAFANERRHEYATLEHLLLALTEDQDAVAVLRACGVDMQKIRADLVE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           Y+DN+ SN + N    + KPT+ FQRV+QRA +HVQS+GR  VTGAN+LVALFSE +SHA
Sbjct: 61  YLDNELSNLITNRPD-DAKPTAGFQRVLQRAAIHVQSSGREEVTGANVLVALFSERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQA-KTDL 181
            YFLQEQEMT +DAVN+ISHGI+K              G S      G  +D QA K   
Sbjct: 120 VYFLQEQEMTRFDAVNYISHGIAK------------APGRSETKRASGADDDAQAEKVVK 167

Query: 182 NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
               AL AYCV+L +K   GK+D L+GR +E+ RTIQILCRRSKNNPLYVGDPGVGKTAI
Sbjct: 168 KGTEALEAYCVNLNKKAASGKIDPLIGREQEVERTIQILCRRSKNNPLYVGDPGVGKTAI 227

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG A++IV G VP+IL  A IF+LDMG L+AGTRYRGDFEER+K ++ E+E+   +IL+
Sbjct: 228 AEGLARRIVHGEVPEILKNATIFALDMGALLAGTRYRGDFEERLKSVISELEALEGSILF 287

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHT++GAG+ SG ++DASNLLKPAL+SGA+RCIGSTTY EYR +FEKD+ALVRRFQK
Sbjct: 288 IDEIHTVIGAGATSGGAMDASNLLKPALASGALRCIGSTTYKEYRNYFEKDRALVRRFQK 347

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           IDV+EPSI+DA++I++GIKPY+E++H++RY+++AIR+AV+LS ++   RKLPDKAIDVID
Sbjct: 348 IDVNEPSIDDAVKILEGIKPYYEKYHRVRYTRDAIRSAVELSAKYIGDRKLPDKAIDVID 407

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           E GA+Q L P S+R+K IT+KD++  +A + R I   S SRDD  VL NLE++L T+V+G
Sbjct: 408 EVGAAQALVPESRRKKTITQKDVEAVVAKIAR-IPPKSVSRDDKEVLQNLERDLKTMVFG 466

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q++AI  L S+IK+ARAGL D  KPIG Y+FSGPTGVGKTE++KQLA  LG++L RFDMS
Sbjct: 467 QDQAIDTLVSAIKLARAGLRDAEKPIGNYLFSGPTGVGKTEVAKQLARTLGIELTRFDMS 526

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERH VSRLIGAPPGYVGF QGG+L D+VDQ+P+ V+LLDEIEK+HPD+ NILLQ+MD
Sbjct: 527 EYMERHTVSRLIGAPPGYVGFDQGGLLTDAVDQHPHCVLLLDEIEKAHPDLYNILLQVMD 586

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
           +G LTD +GK + FRNVILIMTTNAGA +M+KA IGFG       D+EA++   +PEF N
Sbjct: 587 HGKLTDHNGKTVDFRNVILIMTTNAGAADMAKAAIGFGREVRVGEDEEAIKKMFTPEFRN 646

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD+I+ F  L+ + + +VV KF+M+LE QL ++G++   S+E  +WL   GYD  MGAR
Sbjct: 647 RLDAIVAFAGLTQETVARVVDKFVMELEAQLSDRGVTIELSDEARDWLARKGYDPVMGAR 706

Query: 722 PLERIIKEHVKVPLADEILFGKL 744
           PL R I+EHVK PLA+E+LFG+L
Sbjct: 707 PLARTIQEHVKKPLAEELLFGRL 729


>gi|83310222|ref|YP_420486.1| ATPase with chaperone activity, ATP-binding subunit
           [Magnetospirillum magneticum AMB-1]
 gi|82945063|dbj|BAE49927.1| ATPase with chaperone activity, ATP-binding subunit
           [Magnetospirillum magneticum AMB-1]
          Length = 764

 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/756 (59%), Positives = 587/756 (77%), Gaps = 14/756 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL  A ER HEYATLEHLLLAL DD DA  V+ +CNVD+  LK +L  
Sbjct: 1   MLSRNLEQSLHRALSHATERRHEYATLEHLLLALTDDQDAVAVLRACNVDVDKLKRDLGE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID + S +L +    + KPT+ FQRVVQRA +HVQS+GR  VTGAN++VALFSE +SHA
Sbjct: 61  FIDTNLS-ELVSPRGTDPKPTAGFQRVVQRAAIHVQSSGREEVTGANVIVALFSERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQ Q+MT  DAVN+ISHG++K       ++   V G+   ++ +  V   Q      
Sbjct: 120 VYFLQSQDMTRLDAVNYISHGVAKAPGRGQNRT---VHGADDEANPDKVVKKGQE----- 171

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+AYC++L +K  +GK+D L+GR EEI+RTIQILCRRSKNNPLYVGDPGVGKTAIA
Sbjct: 172 ---ALNAYCINLNKKAAQGKIDPLIGRDEEIDRTIQILCRRSKNNPLYVGDPGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VPD+L  A IF+LDMG+L+AGTRYRGDFEER+K +V E+E+Y  A+++I
Sbjct: 229 EGLARRIVNGEVPDVLKNATIFALDMGSLLAGTRYRGDFEERLKAVVTELENYDGAVMFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ SG S+DASNLLKPAL+SG++RCIGSTTY E+R  FEKD+ALVRRFQKI
Sbjct: 289 DEIHTVIGAGATSGGSMDASNLLKPALASGSLRCIGSTTYKEFRNHFEKDRALVRRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPSI D I+I+ GIK Y+E HH++RY+ EAI+AAV+LS ++ T RKLPDKAIDVIDE
Sbjct: 349 DVNEPSIPDTIKILNGIKTYYESHHKVRYTAEAIKAAVELSAKYITDRKLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
            GAS++L P SKRRK +T +D+++ +A + R I   S S +D   L NLE++L T+V+GQ
Sbjct: 409 VGASRMLLPESKRRKTVTVRDVEEIVAKIAR-IPPKSVSTNDVEALRNLERDLKTLVFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ L+S+IK+ARAGL +P KPIGCY+FSGPTGVGKTE+++QLA  +G++L RFDMSE
Sbjct: 468 DKAIEALASAIKLARAGLREPEKPIGCYLFSGPTGVGKTEVARQLAKIMGIELTRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH+VSRLIGAPPGYVGF QGG+L D++DQ+P+SV+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 528 YMERHSVSRLIGAPPGYVGFDQGGLLTDAIDQHPHSVLLLDEIEKAHPDLFNILLQVMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +GK + FRNVILIMTTNAGA +++K+ IGFG    +  D +A+    SPEF NR
Sbjct: 588 GRLTDHNGKTVDFRNVILIMTTNAGAADLAKSAIGFGRETREGDDTDAINRMFSPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LDS I F  L+ +I+ QVV KF+M+LE QL ++ ++   ++E   WL   GYD   GARP
Sbjct: 648 LDSTIAFANLTPEIVAQVVDKFVMQLETQLGDRDVTIELTDEARAWLAKKGYDRSFGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           L R+I+EH+K  LA+E+LFG+L K GG+V+V +  D
Sbjct: 708 LARVIQEHIKKALAEELLFGRLSK-GGIVRVRVGED 742


>gi|295690175|ref|YP_003593868.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Caulobacter
           segnis ATCC 21756]
 gi|295432078|gb|ADG11250.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Caulobacter
           segnis ATCC 21756]
          Length = 776

 Score =  931 bits (2405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/784 (59%), Positives = 608/784 (77%), Gaps = 13/784 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ LH+A+  AN+R HEYATLEHLLL+L DD DAA VM +C+VDL  LK +L
Sbjct: 1   MPSFSRPLEESLHRAVAYANQRKHEYATLEHLLLSLTDDDDAAGVMRACDVDLAALKKSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            NY+D + ++ + +    + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+FSE +S
Sbjct: 61  SNYLDVELASLVVDD-EEDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVNFI+HGI+K+   +  +S   + G+SAGS+     +D +    
Sbjct: 120 HAAYFLQEQDMTRYDAVNFIAHGIAKKAGASEAKS---IKGASAGSNQAE--DDGEKPNT 174

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYCVDL EK ++GKVD L+GR  E+ R IQILCRR+KNNPL VGDPGVGKTA
Sbjct: 175 KTGGEALEAYCVDLNEKARQGKVDPLIGRANEVERAIQILCRRTKNNPLLVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV   VP++L GA I+SLDMG L+AGTRYRGDFEER+K++VKE+ES+ NA+L
Sbjct: 235 IAEGLARKIVTHQVPEVLEGATIYSLDMGALLAGTRYRGDFEERVKQVVKELESHPNAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG++RC+GSTTY E+RQ FEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALASGSLRCMGSTTYKEFRQHFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ED I+I+KG+K Y+E+ H+L+Y+ EA++ AV+LS ++ T RKLPDKAIDVI
Sbjct: 355 KIDVNEPTVEDTIKILKGLKTYYEDFHKLKYTAEALKVAVELSAKYITDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGASQ+L P S+R+K I  K+I+  +A + R I   S S+ D   L  LE +L   V+
Sbjct: 415 DEAGASQMLLPESRRKKTIGVKEIESVVAKIAR-IPPKSVSKSDTEALKELETDLKRAVF 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+EA+ +LS+++K+ARAGL +PNKPIG Y+FSGPTGVGKTE +KQLA  LG+++LRFDM
Sbjct: 474 GQDEALTQLSAAMKLARAGLREPNKPIGSYLFSGPTGVGKTEAAKQLAQTLGIEMLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG L D+VDQ+P++VVLLDEIEK+H DV NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGQLTDAVDQHPHAVVLLDEIEKAHGDVYNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +GKK+ FRNV+LIMTTNAGA +  +  IGFG S+ +  ++ AL+   +PEF 
Sbjct: 594 DNGALTDSNGKKVDFRNVVLIMTTNAGASDAQRNSIGFGRSKVEGEEEAALKRLFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+++ F PL+ +IIRQVV KF+M+LE QL ++ I+   S++  +WL  +G+D   GA
Sbjct: 654 NRLDAVVAFKPLTPEIIRQVVQKFVMQLEAQLADRNITIELSDDAADWLAKNGFDELYGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RPL R+I+EH+K PLAD+ILFG+L +GG  VKV L   K     I FEI+++    + +T
Sbjct: 714 RPLARVIQEHIKKPLADDILFGRLVRGGH-VKVVLENGK-----IEFEIDSNVDPKAGKT 767

Query: 781 EEKE 784
           +E E
Sbjct: 768 DETE 771


>gi|146278243|ref|YP_001168402.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145556484|gb|ABP71097.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 783

 Score =  931 bits (2405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/753 (60%), Positives = 575/753 (76%), Gaps = 11/753 (1%)

Query: 4   FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNY 63
           FS  LE+ +H AL LAN R HE ATLEHLLLALID+ DA+ VM +C+VDL  L+  L+++
Sbjct: 16  FSTTLEQAIHGALALANARRHELATLEHLLLALIDEPDASRVMKACSVDLDELRKTLVDF 75

Query: 64  IDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHAT 123
           ID+D S  +      E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S+A 
Sbjct: 76  IDDDLSTLVTTVEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERESNAA 135

Query: 124 YFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNL 183
           YFLQEQ+MT YDAVNFI+HG++K   +   +           S  E      +A+     
Sbjct: 136 YFLQEQDMTRYDAVNFIAHGVAKDPSYGEPRPV---------SGAEEHHETPKAEAGEAK 186

Query: 184 FPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAE 243
             ALS YCVDL  K +KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTAIAE
Sbjct: 187 ESALSKYCVDLNVKARKGDVDPLIGRELEVERCIQVLCRRRKNNPLLVGDPGVGKTAIAE 246

Query: 244 GFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYID 303
           G A++IV+G  PDIL  A IFSLDMG L+AGTRYRGDFEER+K +VKE+E + +AIL+ID
Sbjct: 247 GLARKIVNGETPDILARATIFSLDMGALLAGTRYRGDFEERLKAVVKEMEDHPDAILFID 306

Query: 304 EIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKID 363
           EIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY EYRQ FEKD+AL RRFQKID
Sbjct: 307 EIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEYRQHFEKDRALSRRFQKID 366

Query: 364 VSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEA 423
           V+EPS+ED ++I+ G+KPYFEEHH LRY+++AIR+AV+LS R+   RKLPDKAIDVIDEA
Sbjct: 367 VNEPSVEDTVKILMGLKPYFEEHHDLRYTQDAIRSAVELSARYIHDRKLPDKAIDVIDEA 426

Query: 424 GASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQE 483
           GA+Q L   SKRRK I  ++I+  +A + R I   S S+DD  VL +LEK L  VV+GQ+
Sbjct: 427 GAAQHLLADSKRRKTIGPREIEAVVAKIAR-IPPKSVSKDDAEVLRDLEKTLKRVVFGQD 485

Query: 484 EAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEY 543
           +AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDMSEY
Sbjct: 486 KAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLASILGVELLRFDMSEY 545

Query: 544 MERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYG 603
           ME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+MD+G
Sbjct: 546 MEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEIEKAHPDVYNILLQVMDHG 605

Query: 604 ILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRL 663
            LTD +G+ + FRNVILIMT+NAGA E++K+ IGFG  R +  D  A+    +PEF NRL
Sbjct: 606 KLTDHNGRSVDFRNVILIMTSNAGAAELAKSAIGFGRDRREGEDTAAIERTFTPEFRNRL 665

Query: 664 DSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPL 723
           D++I F PL  +II QVV KF+++LE QL ++G+    S E   WL   GYD KMGARPL
Sbjct: 666 DAVISFAPLGKEIILQVVEKFVLQLEAQLMDRGVHIELSPEAAAWLGDKGYDDKMGARPL 725

Query: 724 ERIIKEHVKVPLADEILFGKLKKGGGVVKVSLN 756
            R+I+E++K PLA+E+LFG+L K GG+VKV + 
Sbjct: 726 GRVIQENIKKPLAEELLFGRLVK-GGLVKVGVK 757


>gi|258541380|ref|YP_003186813.1| Clp protease ATP-binding subunit ClpA [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632458|dbj|BAH98433.1| Clp protease ATP-binding subunit ClpA [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635515|dbj|BAI01484.1| Clp protease ATP-binding subunit ClpA [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638570|dbj|BAI04532.1| Clp protease ATP-binding subunit ClpA [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641624|dbj|BAI07579.1| Clp protease ATP-binding subunit ClpA [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644679|dbj|BAI10627.1| Clp protease ATP-binding subunit ClpA [Acetobacter pasteurianus IFO
           3283-26]
 gi|256647734|dbj|BAI13675.1| Clp protease ATP-binding subunit ClpA [Acetobacter pasteurianus IFO
           3283-32]
 gi|256650787|dbj|BAI16721.1| Clp protease ATP-binding subunit ClpA [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653778|dbj|BAI19705.1| Clp protease ATP-binding subunit ClpA [Acetobacter pasteurianus IFO
           3283-12]
          Length = 781

 Score =  928 bits (2399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/788 (57%), Positives = 602/788 (76%), Gaps = 14/788 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL+LA ER+HEYATLEHLLLAL+DD+DA  V  +C VDL  L+ +L  
Sbjct: 1   MLSRNLEQTLHRALILAGERHHEYATLEHLLLALVDDADAVTVFRACGVDLDRLRTDLTG 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D D +  L +    E KPT++FQRV+QRA +HVQSTGR  VTGAN+LVALF+E +SHA
Sbjct: 61  FLDKDLAG-LASDRPTEPKPTAAFQRVIQRAAIHVQSTGRDEVTGANVLVALFAERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVND-YQAKTDL 181
            YFLQ Q+MT  DAVNF+SHGI+K  + +   ++  V G+ + ++  G   +  ++K+  
Sbjct: 120 VYFLQLQDMTRLDAVNFLSHGIAKAPDRS---TRRPVAGTESNAEKGGEEPERTESKSQK 176

Query: 182 NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
               ALS YCV+L +K   GKVD L+GR  EI RTIQILCRR+KNNPLYVGDPGVGKTAI
Sbjct: 177 GNQDALSTYCVNLNDKAIAGKVDPLIGRDTEIERTIQILCRRTKNNPLYVGDPGVGKTAI 236

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG A++IV+G VP++LL + I+SLDMG L+AGTRYRGDFEER+K +V E++   +AIL+
Sbjct: 237 AEGLARRIVEGNVPEVLLKSTIYSLDMGALLAGTRYRGDFEERLKAVVTELDQDPHAILF 296

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHT++GAG+ SG ++DASNLLKPAL++G +RCIGSTTY E+RQ FEKD+ALVRRFQK
Sbjct: 297 IDEIHTVIGAGATSGGAMDASNLLKPALAAGTLRCIGSTTYKEFRQHFEKDRALVRRFQK 356

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           IDV EP+I+DA++I++G+K  +E+HH++RY++EAIRAAV+LS ++   RKLPDKAIDVID
Sbjct: 357 IDVPEPTIDDAVKILRGLKGSYEKHHKVRYTEEAIRAAVELSAKYIHDRKLPDKAIDVID 416

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           E GAS++LQP  +RRK +  KD++  IA + R I   S S DD  VL +LE++L  +V+G
Sbjct: 417 EVGASRMLQPEGRRRKTVNLKDVEDIIARIAR-IPPKSISADDKEVLRSLERDLKGMVFG 475

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q++AI  LS++IK+ARAGL D  KPIG Y+FSGPTGVGKTE+++QLA ALG++L+RFDMS
Sbjct: 476 QDQAIDALSAAIKLARAGLRDAEKPIGNYLFSGPTGVGKTEVARQLATALGIELVRFDMS 535

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERH++SRL+GAPPGYVGF QGG+L D++DQ+P++V+LLDEIEK+HPD+ N+LLQ+MD
Sbjct: 536 EYMERHSISRLLGAPPGYVGFDQGGLLTDAIDQHPHAVLLLDEIEKAHPDLYNVLLQVMD 595

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
            G LTD +GK + FRNVILIMTTNAGA +MSK  +GFG    +  D+EA++   +PEF N
Sbjct: 596 NGKLTDHNGKTVDFRNVILIMTTNAGASDMSKEAVGFGRQVREGEDEEAIKRLFTPEFRN 655

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD+IIPF  LS +I+ QVV KF+++LE QL ++ ++   S     WL   GYD   GAR
Sbjct: 656 RLDAIIPFAHLSPEIVGQVVEKFVLQLEAQLADRNVTIELSSAAKEWLAERGYDRLYGAR 715

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEI--ENSGSNISLE 779
           PL R+I+E +K PLA+E+LFGKL K GG VK+ L      +  + F+I   NS SN   +
Sbjct: 716 PLGRVIQESIKKPLAEELLFGKLAK-GGAVKIGLK-----NGELAFDIVESNSSSNNGED 769

Query: 780 TEEKEVED 787
           T   E E+
Sbjct: 770 THGSEHEE 777


>gi|254466814|ref|ZP_05080225.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Rhodobacterales bacterium Y4I]
 gi|206687722|gb|EDZ48204.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Rhodobacterales bacterium Y4I]
          Length = 774

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/766 (59%), Positives = 581/766 (75%), Gaps = 23/766 (3%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LANER HE+ATLEHLLLALID+ DAA VM +C+VDL  L+++L
Sbjct: 1   MPSFSSTLEQAIHAALALANERRHEFATLEHLLLALIDEPDAARVMRACSVDLTELRSSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + ++D D +N + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFVDEDLANLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
            A YFLQ+QEMT YDAVNFI+HG++K   +   +    V G++            Q + +
Sbjct: 121 DAAYFLQDQEMTRYDAVNFIAHGVAKDPAYGESRP---VTGATE-----------QEEDN 166

Query: 181 LNLFP-------ALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGD 233
           L   P       AL+ YCVDL  K +KG +D L+GR +E+ R IQ+LCRR KNNPL VGD
Sbjct: 167 LTTTPEGEKKESALAKYCVDLNAKSRKGDIDPLIGRDQEVERCIQVLCRRRKNNPLLVGD 226

Query: 234 PGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIE 293
           PGVGKTAIAEG A++IV G VPD+L    I+SLDMG L+AGTRYRGDFEER+K +V E+E
Sbjct: 227 PGVGKTAIAEGLARKIVQGEVPDVLSQTTIYSLDMGALLAGTRYRGDFEERLKAVVSELE 286

Query: 294 SYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDK 353
            + +A+L+IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+
Sbjct: 287 DHPDAVLFIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDR 346

Query: 354 ALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLP 413
           AL RRFQKIDV+EPS+ED+IEI+KG+KPYFEEHH ++++ EAI+ AV+LS R+   RKLP
Sbjct: 347 ALSRRFQKIDVNEPSVEDSIEILKGLKPYFEEHHGIKFTGEAIKTAVELSARYINDRKLP 406

Query: 414 DKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEK 473
           DKAIDVIDEAGA+Q L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LEK
Sbjct: 407 DKAIDVIDEAGAAQHLLIESKRRKTIGVKEIEAVVAKIAR-IPPKNVSKDDAEVLKDLEK 465

Query: 474 NLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGV 533
           +L  VV+GQ++AI  LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV
Sbjct: 466 SLKRVVFGQDDAITALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADQLGV 525

Query: 534 QLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVL 593
           +LLRFDMSEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV 
Sbjct: 526 ELLRFDMSEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVY 585

Query: 594 NILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRN 653
           NILLQ+MD G LTD +G+ ++FRNVILIMT+NAGA E +KA IGFG  R +  D  A+  
Sbjct: 586 NILLQVMDNGQLTDHNGRTVNFRNVILIMTSNAGASEQAKAAIGFGRDRREGEDTAAIER 645

Query: 654 FLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHG 713
             +PEF NRLD++I F PL  ++I QVV KF+++LE QL ++ +S   + +   WL   G
Sbjct: 646 TFTPEFRNRLDAVISFAPLGKEVILQVVEKFVLQLEAQLMDRNVSIELTRKAAEWLADKG 705

Query: 714 YDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           YD +MGARPL R+I+EH+K PLA+E+LFGKL K GGVVKV +   K
Sbjct: 706 YDDRMGARPLGRVIQEHIKKPLAEELLFGKLTK-GGVVKVGIKDGK 750


>gi|329114969|ref|ZP_08243724.1| ClpA-like protein [Acetobacter pomorum DM001]
 gi|326695412|gb|EGE47098.1| ClpA-like protein [Acetobacter pomorum DM001]
          Length = 781

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/748 (59%), Positives = 583/748 (77%), Gaps = 5/748 (0%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL+LA ER+HEYATLEHLLLAL+DD+DA  V  +C VDL  L+ +L  
Sbjct: 1   MLSRNLEQTLHRALILAGERHHEYATLEHLLLALVDDADAVTVFRACGVDLDRLRTDLTG 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D D +  L +    E KPT++FQRV+QRA +HVQSTGR  VTGAN+LVALF+E +SHA
Sbjct: 61  FLDKDLAG-LASDRPTEPKPTAAFQRVIQRAAIHVQSTGRDEVTGANVLVALFAERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQ Q+MT  DAVNF+SHGI+K  + +   ++  V G+ + ++        ++K+   
Sbjct: 120 VYFLQLQDMTRLDAVNFLSHGIAKAPDRS---TRRPVAGTESNAEKGEEPERAESKSQKG 176

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              ALS YCV+L +K   GKVD L+GR  EI RTIQILCRR+KNNPLYVGDPGVGKTAIA
Sbjct: 177 NQDALSTYCVNLNDKAIAGKVDPLIGRDTEIERTIQILCRRTKNNPLYVGDPGVGKTAIA 236

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VP++LL + I+SLDMG L+AGTRYRGDFEER+K +V E++   +AIL+I
Sbjct: 237 EGLARRIVEGNVPEVLLKSTIYSLDMGALLAGTRYRGDFEERLKAVVTELDQDPHAILFI 296

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ SG ++DASNLLKPAL++G +RCIGSTTY E+RQ FEKD+ALVRRFQKI
Sbjct: 297 DEIHTVIGAGATSGGAMDASNLLKPALAAGTLRCIGSTTYKEFRQHFEKDRALVRRFQKI 356

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EP+I+DA++I++G+K  +E+HH++RY++EAIRAAV+LS ++   RKLPDKAIDVIDE
Sbjct: 357 DVPEPTIDDAVKILRGLKGSYEKHHKVRYTEEAIRAAVELSAKYIHDRKLPDKAIDVIDE 416

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
            GAS++LQP  +RRK +  KD++  IA + R I   S S DD  VL +LE++L  +V+GQ
Sbjct: 417 VGASRMLQPEGRRRKTVNLKDVEDIIARIAR-IPPKSISADDKEVLRSLERDLKGMVFGQ 475

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI  LS++IK+ARAGL D  KPIG Y+FSGPTGVGKTE+++QLA ALG++L+RFDMSE
Sbjct: 476 DQAIDALSAAIKLARAGLRDAEKPIGNYLFSGPTGVGKTEVARQLATALGIELVRFDMSE 535

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH++SRL+GAPPGYVGF QGG+L D++DQ+P++V+LLDEIEK+HPD+ N+LLQ+MD 
Sbjct: 536 YMERHSISRLLGAPPGYVGFDQGGLLTDAIDQHPHAVLLLDEIEKAHPDLYNVLLQVMDN 595

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +GK + FRNVILIMTTNAGA +MSK  +GFG    +  D+EA++   +PEF NR
Sbjct: 596 GKLTDHNGKTVDFRNVILIMTTNAGASDMSKEAVGFGRQVREGEDEEAIKRLFTPEFRNR 655

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+IIPF  LS +I+ QVV KF+++LE QL ++ ++   S     WL   GYD   GARP
Sbjct: 656 LDAIIPFAHLSPEIVGQVVEKFVLQLEAQLADRNVTIELSSAAKEWLAERGYDRLYGARP 715

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           L R+I+E +K PLA+E+LFGKL KGG V
Sbjct: 716 LGRVIQESIKKPLAEELLFGKLAKGGAV 743


>gi|77462844|ref|YP_352348.1| chaperonin clpA/B [Rhodobacter sphaeroides 2.4.1]
 gi|126461737|ref|YP_001042851.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhodobacter
           sphaeroides ATCC 17029]
 gi|77387262|gb|ABA78447.1| Chaperonin clpA/B [Rhodobacter sphaeroides 2.4.1]
 gi|126103401|gb|ABN76079.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 771

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/744 (60%), Positives = 567/744 (76%), Gaps = 10/744 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE ATLEHLLLALID+ DA+ VM +C+VDL  L+  L
Sbjct: 1   MPSFSTTLEQAIHGALALANARRHELATLEHLLLALIDEPDASRVMKACSVDLDELRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +++ID+D S  + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VDFIDDDLSTLVTSVEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +     +        E      +AK  
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPSYGEPRPVTGAEEHHETPKAEAG----EAKES 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALS YCVDL  K +KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 177 -----ALSKYCVDLNVKARKGDVDPLIGREHEVERCIQVLCRRRKNNPLLVGDPGVGKTA 231

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G  PDIL  A IFSLDMG L+AGTRYRGDFEER+K +VKE+E + +AIL
Sbjct: 232 IAEGLARKIVNGETPDILARATIFSLDMGALLAGTRYRGDFEERLKAVVKEMEDHPDAIL 291

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY EYRQ FEKD+AL RRFQ
Sbjct: 292 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEYRQHFEKDRALSRRFQ 351

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ED ++I+ G+KPYFEEHH LRY+++AIR AV+LS R+   RKLPDKAIDVI
Sbjct: 352 KIDVNEPSVEDTVKILMGLKPYFEEHHDLRYTQDAIRTAVELSARYIHDRKLPDKAIDVI 411

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  ++I+  +A + R I   S S+DD  VL +LEK L  VV+
Sbjct: 412 DEAGAAQHLLADSKRRKTIGPREIEAVVAKIAR-IPPKSVSKDDAEVLRDLEKTLKRVVF 470

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 471 GQDRAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLASILGVELLRFDM 530

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 531 SEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEIEKAHPDVYNILLQVM 590

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNVILIMT+NAGA E++K+ IGFG  R +  D  A+    +PEF 
Sbjct: 591 DHGKLTDHNGRSVDFRNVILIMTSNAGAAELAKSAIGFGRDRREGEDTAAIERTFTPEFR 650

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  +II QVV KF+++LE QL ++G+    S E   WL   GYD KMGA
Sbjct: 651 NRLDAVISFAPLGKEIILQVVEKFVLQLEAQLMDRGVHIELSPEAAAWLGDKGYDDKMGA 710

Query: 721 RPLERIIKEHVKVPLADEILFGKL 744
           RPL R+I+E++K PLA+E+LFG+L
Sbjct: 711 RPLGRVIQENIKKPLAEELLFGRL 734


>gi|330993781|ref|ZP_08317713.1| ClpA-like protein [Gluconacetobacter sp. SXCC-1]
 gi|329759049|gb|EGG75561.1| ClpA-like protein [Gluconacetobacter sp. SXCC-1]
          Length = 775

 Score =  925 bits (2391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/779 (57%), Positives = 592/779 (75%), Gaps = 15/779 (1%)

Query: 4   FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNY 63
            S NLE+ LH+AL LA +R HEYATLEHLLLALIDD DA  V  +C VDL  L+ +L ++
Sbjct: 1   MSRNLEQTLHRALTLAGDRRHEYATLEHLLLALIDDPDAVTVFRACGVDLNKLRTDLTDF 60

Query: 64  IDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHAT 123
           +D D +  L     V+ KPT++FQRV+QRA +HVQSTGR  VTGAN+LVALF+E +SHA 
Sbjct: 61  LDKDLAG-LAADRTVDPKPTAAFQRVIQRAAIHVQSTGRDEVTGANVLVALFAERESHAV 119

Query: 124 YFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNL 183
           YFLQ Q+MT  DAVNFISHGI+K  + +  +         AGS  EG  ++ + K     
Sbjct: 120 YFLQLQDMTRLDAVNFISHGIAKAPDRSTRRP-------VAGSPPEGGESEERGKAGQKN 172

Query: 184 FPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAE 243
             ALS YC +L EK + GKVD L+GR  EI RTIQILCRR+KNNPLYVGDPGVGKTAIAE
Sbjct: 173 QDALSTYCTNLNEKAQAGKVDPLIGRDSEIERTIQILCRRTKNNPLYVGDPGVGKTAIAE 232

Query: 244 GFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYID 303
           G AK+IV+G VP++LL + I+SLDMG L+AGTRYRGDFEER+K +V E+++   +IL+ID
Sbjct: 233 GLAKRIVEGDVPEVLLNSTIYSLDMGALLAGTRYRGDFEERLKAVVTELDNNPGSILFID 292

Query: 304 EIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKID 363
           EIHT++GAG+ SG ++DASNLLKPAL++G +RC+GSTTY EYRQ FEKD+ALVRRFQKID
Sbjct: 293 EIHTVIGAGATSGGAMDASNLLKPALAAGTLRCMGSTTYKEYRQHFEKDRALVRRFQKID 352

Query: 364 VSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEA 423
           V+EPS++DA++I++G+K  +E+HH++RY+ +AIR AV+LS ++   RKLPDKAIDVIDE 
Sbjct: 353 VAEPSVDDAVKILRGLKVNYEKHHKVRYTDDAIRGAVELSAKYIHDRKLPDKAIDVIDEV 412

Query: 424 GASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQE 483
           GAS++L P ++RRK +T KD++  +A + R I   S S DD   L +LE++L  +VYGQ+
Sbjct: 413 GASRMLVPENRRRKTVTLKDVEDIVAKIAR-IPPKSVSSDDKETLRSLERDLKGMVYGQD 471

Query: 484 EAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEY 543
           +AI+ L+++IK++RAGL DP KPIG Y+FSGPTGVGKTE++KQLA  LG++L+RFDMSEY
Sbjct: 472 KAIEALTAAIKLSRAGLRDPEKPIGNYLFSGPTGVGKTEVAKQLASTLGIELIRFDMSEY 531

Query: 544 MERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYG 603
           MERH++SRLIGAPPGYVGF QGG+L D++DQ+P++V+LLDEIEK+H D+ N+LLQ+MD+G
Sbjct: 532 MERHSISRLIGAPPGYVGFDQGGLLTDAIDQHPHAVLLLDEIEKAHQDLYNVLLQVMDHG 591

Query: 604 ILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRL 663
            LTD +GK + FRNV+LIMTTNAGA ++SK  IGFG +  +  D++A++   +PEF NRL
Sbjct: 592 RLTDHNGKTVDFRNVVLIMTTNAGAADLSKEAIGFGRTSREGEDEDAIKRLFTPEFRNRL 651

Query: 664 DSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPL 723
           D+IIPF  LS  ++ +VV KFI +LE QL ++ +    S     WL   GYD   GARPL
Sbjct: 652 DAIIPFANLSPHVVDRVVEKFIFQLEAQLADRNVMIEISSAAREWLAERGYDRLYGARPL 711

Query: 724 ERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLETEE 782
            R+I+E++K PLA+E+LFGKL K GGV K+SL   K     + FE  +   N S E +E
Sbjct: 712 GRVIQENIKKPLAEELLFGKLTK-GGVAKISLKDGK-----LDFEYISQAENASAEGDE 764


>gi|255264039|ref|ZP_05343381.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Thalassiobium
           sp. R2A62]
 gi|255106374|gb|EET49048.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Thalassiobium
           sp. R2A62]
          Length = 774

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/744 (59%), Positives = 566/744 (76%), Gaps = 10/744 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN RNHE ATLEHLLLALID+ DAA VM +C+VDL  L+  L
Sbjct: 1   MPSFSNTLEQSIHSALALANARNHELATLEHLLLALIDEPDAARVMQACSVDLDDLRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             +I++D S    +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  TTFIEDDLSTLATDVEGSEAVPTAAFQRVIQRAAIHVQSSGRNEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   F   +    V G+    D  G     + ++ 
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPAFGEARP---VSGAPDLDDELGAPETEKEES- 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCVDL  K +K ++D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 177 -----ALEKYCVDLNAKARKNEIDPLIGRSHEVERCIQVLCRRRKNNPLLVGDPGVGKTA 231

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G  P++L GA I+SLDMG L+AGTRYRGDFEER+K ++ E+E + +A+L
Sbjct: 232 IAEGLARKIVAGETPEVLSGATIYSLDMGALLAGTRYRGDFEERLKAVMTEMEDHPDAVL 291

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 292 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALSRRFQ 351

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDAI+I++G+KPYFEEHH ++Y+ +AI+ AV+LS R+   RKLPDKAIDVI
Sbjct: 352 KIDVTEPSVEDAIKILRGLKPYFEEHHSIKYTSDAIKTAVELSSRYINDRKLPDKAIDVI 411

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LEK+L  VV+
Sbjct: 412 DEAGAAQHLVAESKRRKTIGAKEIEAVVAKIAR-IPPKNVSKDDAEVLRDLEKSLKRVVF 470

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 471 GQDPAIDALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 530

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQNP+ V+LLDE+EK+HPDV NILLQ+M
Sbjct: 531 SEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQNPHCVLLLDEMEKAHPDVYNILLQVM 590

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNVILIMT+NAGA E++KA IGFG    +  D  A+    +PEF 
Sbjct: 591 DHGKLTDHNGRTVDFRNVILIMTSNAGATELAKAAIGFGRDHREGEDTAAIERTFTPEFR 650

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F PL  D+I QVV KF+++LE QL ++ ++   S+    WL   GYDVKMGA
Sbjct: 651 NRLDATISFAPLPKDVILQVVEKFVLQLEAQLMDRNVTIELSKPAAEWLADKGYDVKMGA 710

Query: 721 RPLERIIKEHVKVPLADEILFGKL 744
           RPL R+I+EH+K PLA+E+LFGKL
Sbjct: 711 RPLGRVIQEHIKKPLAEELLFGKL 734


>gi|84514770|ref|ZP_01002133.1| Chaperonin clpA/B [Loktanella vestfoldensis SKA53]
 gi|84510929|gb|EAQ07383.1| Chaperonin clpA/B [Loktanella vestfoldensis SKA53]
          Length = 772

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/773 (58%), Positives = 573/773 (74%), Gaps = 15/773 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LANER HE ATLEHLLLALID+ DAA VM +C+VDL  L+ +L
Sbjct: 1   MPSFSTTLEQSIHGALALANERKHELATLEHLLLALIDEPDAARVMRACSVDLDDLRKDL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            ++ID+D S  + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  EDFIDDDLSTLVTDVEGSEAVPTAAFQRVIQRAAIHVQSSGRSEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   F          G +    G     +     D
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPAF----------GETRPVTGAADETEQTTGAD 170

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL  K KKG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 171 PEKESALAKYCVDLNAKSKKGDVDPLIGRAHEVERCIQVLCRRRKNNPLLVGDPGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +IV+  VPD+L GA I+SLDMG L+AGTRYRGDFEER+K ++ E+E++ +A+L
Sbjct: 231 IAEGLAYKIVNKDVPDVLAGATIYSLDMGALLAGTRYRGDFEERLKAVMTEMENHKDAVL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALARRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ D+I+I+ G+KPYFEEHH ++Y+ EAI+ AV+LS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPSVPDSIKILMGLKPYFEEHHHIKYTAEAIKTAVELSARYINDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LEK+L  VV+
Sbjct: 411 DEAGAAQHLVAESKRRKTIGTKEIEAVVAKIAR-IPAKNVSKDDAEVLKDLEKSLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 470 GQDRAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQNP+ V+LLDE+EK+HPDV NILLQ+M
Sbjct: 530 SEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQNPHCVLLLDEMEKAHPDVYNILLQVM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+   FRNVILIMT+NAGA EMSK  +GFG       D  A+    +PEF 
Sbjct: 590 DHGKLTDHNGRTTDFRNVILIMTSNAGAAEMSKNALGFGREARTGEDTAAIERIFTPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  L  ++I QVV KF+++LE QL ++ +    ++    WL   GYD  MGA
Sbjct: 650 NRLDAIISFGALPKEVIMQVVEKFVLQLEAQLIDRNVHIELTQAAAEWLADKGYDANMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSG 773
           RPL R+I+EH+K PLA+E+LFG L K GG+VKV +   K+    + FE    G
Sbjct: 710 RPLGRVIQEHIKKPLAEELLFGTLVK-GGIVKVGV---KNGELDLTFEAPQQG 758


>gi|86136457|ref|ZP_01055036.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Roseobacter
           sp. MED193]
 gi|85827331|gb|EAQ47527.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Roseobacter
           sp. MED193]
          Length = 776

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/759 (58%), Positives = 578/759 (76%), Gaps = 7/759 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LANER HE+ATLEHLLLALI++ +AA VM +C VDL  L+ +L
Sbjct: 1   MPSFSSTLEQAIHAALALANERRHEFATLEHLLLALIEEPEAARVMRACGVDLGQLRASL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + ++D D +N + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  IEFVDEDLANLVTDVDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
            A YFLQ+Q+MT YDAVNFI+HG++K   F   +S+       +  +  G V   +    
Sbjct: 121 DAAYFLQDQDMTRYDAVNFIAHGVAKDPAFG--ESRPVTGAPESEEEAMGSVPPGEGDKK 178

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            +   AL  YCVDL  K ++G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 179 ES---ALDKYCVDLNAKSREGDIDPLIGRSHEVERCIQVLCRRRKNNPLLVGDPGVGKTA 235

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G VP++L    IFSLDMG L+AGTRYRGDFEER+K +V E+E + + +L
Sbjct: 236 IAEGLARKIVQGEVPNVLAETTIFSLDMGALLAGTRYRGDFEERLKAVVTELEDHPDGVL 295

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 296 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALARRFQ 355

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS++DA+EI+KG+KPYFEEHH ++++ +AI++AV+L+ R+   RKLPDKAIDVI
Sbjct: 356 KIDVNEPSVQDAVEILKGLKPYFEEHHSIKFTADAIKSAVELAARYINDRKLPDKAIDVI 415

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L P SKRRK I  K+I+  +A + R I   S ++DD  VL +LEK+L  VV+
Sbjct: 416 DEAGAAQHLVPESKRRKTIGVKEIEAVVAKIAR-IPPKSVTKDDAEVLKDLEKSLKRVVF 474

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 475 GQDDAIDALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 534

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 535 SEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNILLQVM 594

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+ ++FRNV+LIMT+NAGA +M+KA IGFG  R +  D  A+    +PEF 
Sbjct: 595 DNGQLTDHNGRAVNFRNVVLIMTSNAGASDMAKAAIGFGRDRREGEDTAAIERTFTPEFR 654

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  ++I QVV KF+++LE QL ++ +S   + +   WL   GYD +MGA
Sbjct: 655 NRLDAVIAFAPLPKEVILQVVEKFVLQLEAQLMDRNVSIELTRKAAEWLADKGYDDRMGA 714

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           RPL R+I+EH+K PLA+E+LFGKL K GG+VKV +   K
Sbjct: 715 RPLGRVIQEHIKKPLAEELLFGKLAK-GGLVKVGIKDGK 752


>gi|84683661|ref|ZP_01011564.1| ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84668404|gb|EAQ14871.1| ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Rhodobacterales bacterium HTCC2654]
          Length = 777

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/771 (58%), Positives = 577/771 (74%), Gaps = 15/771 (1%)

Query: 4   FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNY 63
           FS  LE+ +H AL  ANER HE ATLEHLLLALID+ DAA VM +C+VDL+ L+  LL Y
Sbjct: 7   FSNTLEQAIHAALAHANERQHELATLEHLLLALIDEPDAARVMKACSVDLEDLRGTLLKY 66

Query: 64  IDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHAT 123
           ID + S    N    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S+A 
Sbjct: 67  IDEELSAFETNIEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERESNAA 126

Query: 124 YFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNL 183
           YFLQEQ+MT YDAVN+I+HG++K   +   +    V G+    +      + +AK     
Sbjct: 127 YFLQEQDMTRYDAVNYIAHGVAKDPSYGETRP---VSGTPDFEEATNEAPEEEAKDS--- 180

Query: 184 FPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAE 243
             AL  YCVDL  K +KG +D L+GR +E+ R IQ+LCRR KNNPL VGDPGVGKTAIAE
Sbjct: 181 --ALGKYCVDLNAKARKGDIDPLIGRDQEVERCIQVLCRRRKNNPLLVGDPGVGKTAIAE 238

Query: 244 GFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYID 303
           G AK+I  G  P++L    IFSLDMG L+AGTRYRGDFEER+K +V E+E++ +A+L+ID
Sbjct: 239 GLAKKIEAGETPEVLSETTIFSLDMGALLAGTRYRGDFEERLKAVVSELENHPDAVLFID 298

Query: 304 EIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKID 363
           EIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL RRFQKID
Sbjct: 299 EIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALSRRFQKID 358

Query: 364 VSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEA 423
           V+EP+++D ++I+KG+KPYFEEHH ++Y+ +AI+ AV+LS R+   RKLPDKAIDVIDEA
Sbjct: 359 VNEPTVDDTVKILKGLKPYFEEHHAIKYTNDAIKTAVELSDRYINDRKLPDKAIDVIDEA 418

Query: 424 GASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQE 483
           GA+Q L   SKRRK I  K+I+  IA + R I   S S+DD  VL +LE +L  VV+GQ+
Sbjct: 419 GAAQHLVAASKRRKSIGTKEIEAIIAKIAR-IPPKSVSKDDQEVLRDLEGSLKRVVFGQD 477

Query: 484 EAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEY 543
           +AI  LSS+IK++RAGL DP KPIG Y+F+GPTGVGKTE+++QLA  LGV+LLRFDMSEY
Sbjct: 478 DAITALSSAIKLSRAGLRDPEKPIGNYLFAGPTGVGKTEVARQLASQLGVELLRFDMSEY 537

Query: 544 MERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYG 603
           ME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPDV NILLQ+MD+G
Sbjct: 538 MEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEMEKAHPDVYNILLQVMDHG 597

Query: 604 ILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRL 663
            LTD +G+ ++FRNV+LIMT+NAGA E +K  IGFG +R +  D  A+    +PEF NRL
Sbjct: 598 QLTDHNGRTVNFRNVVLIMTSNAGATEQAKEAIGFGRARREGEDTAAIERTFTPEFRNRL 657

Query: 664 DSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPL 723
           D++I F PLS D+I QVV KF+++LE QL ++ +S   +     WL   GYD KMGARPL
Sbjct: 658 DAVISFAPLSKDVITQVVEKFVLQLEAQLMDRNVSIELTPAAAEWLADKGYDDKMGARPL 717

Query: 724 ERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGS 774
            R+I+EH+K PLA+E+LFGKL K GG+V+V +         I   IE  GS
Sbjct: 718 GRVIQEHIKKPLAEELLFGKLAK-GGLVQVGVK-----DGEIDLRIEEPGS 762


>gi|167647098|ref|YP_001684761.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Caulobacter
           sp. K31]
 gi|167349528|gb|ABZ72263.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Caulobacter
           sp. K31]
          Length = 773

 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/786 (57%), Positives = 601/786 (76%), Gaps = 18/786 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ LH+A+  AN+R HEYATLEHLLL+L DD DAA VM +C+VDL  LK +L
Sbjct: 1   MPSFSRPLEESLHRAVAYANQRKHEYATLEHLLLSLTDDDDAAGVMRACDVDLNALKKSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +NY+D + ++ + +    + KPT+ FQRV+QRAV+HVQS+GR  VTGAN+LVA+FSE +S
Sbjct: 61  VNYLDVELASLVVDD-EDDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVNFI+HGI+K+   A         G++   D    V    AKT 
Sbjct: 120 HAAYFLQEQDMTRYDAVNFIAHGIAKK---AGASEPKTAKGAAVEED----VEKPNAKTG 172

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AYCVDL EK ++GKVD L+GR  E+ R IQILCRR+KNNPL VG+PGVGKTA
Sbjct: 173 GE---ALEAYCVDLNEKARQGKVDPLIGRASEVERAIQILCRRTKNNPLLVGEPGVGKTA 229

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++I+   VP++L GA I+SLDMG L+AGTRYRGDFEER+K++VKE+E++ NA+L
Sbjct: 230 IAEGLARKIITHQVPEVLAGATIYSLDMGALLAGTRYRGDFEERVKQVVKELENHPNAVL 289

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+SG +RC+GSTTY E+RQ FEKD+ALVRRFQ
Sbjct: 290 FIDEIHTVIGAGATSGGAMDASNLLKPALASGTLRCMGSTTYKEFRQHFEKDRALVRRFQ 349

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ED I+I+KG+K Y+E+ H+L+Y+ EA++ AV+LS ++ T RKLPDKAIDVI
Sbjct: 350 KIDVNEPTVEDTIKILKGLKTYYEDFHKLKYTNEALKVAVELSAKYITDRKLPDKAIDVI 409

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA Q+L P S+R+K +  K+I+  +A + R I   S S+ D   L  LE++L   V+
Sbjct: 410 DEAGAGQMLLPESRRKKVLGVKEIEAVVAKIAR-IPPKSVSKSDTESLRELERDLKGAVF 468

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+EA+ +LSS++K+ARAGL DP+KPIG Y+FSGPTGVGKTE +KQLA  LG++++RFDM
Sbjct: 469 GQDEALAQLSSAMKLARAGLRDPDKPIGSYLFSGPTGVGKTEAAKQLASTLGIEMIRFDM 528

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVG+ QGG L D+VDQ+P++VVLLDEIEK+H DV NILLQ+M
Sbjct: 529 SEYMERHTVSRLIGAPPGYVGYDQGGQLTDAVDQHPHAVVLLDEIEKAHADVYNILLQVM 588

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G+LTD +GKK+ FRNVILIMTTNAGA +  +  IGFG  +    ++ AL+   +PEF 
Sbjct: 589 DHGVLTDSNGKKVDFRNVILIMTTNAGASDAQRQSIGFGRDKVQGEEEAALKRLFTPEFR 648

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+++ F PL+ +IIR VV KF++++E+QL ++ ++   S++  +WL  +G+D   GA
Sbjct: 649 NRLDAVVAFKPLTPEIIRMVVQKFVLQMEVQLADRNVTISLSDDAADWLAKNGFDELYGA 708

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RPL R+I+EH+K PLAD+ILFG+L +GG  VKV L       S I FEIE++        
Sbjct: 709 RPLARVIQEHIKKPLADDILFGRLVRGGH-VKVVLK-----DSKIDFEIESTPEKPGKAP 762

Query: 781 EEKEVE 786
           +E E E
Sbjct: 763 KEDEAE 768


>gi|296533023|ref|ZP_06895671.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Roseomonas
           cervicalis ATCC 49957]
 gi|296266652|gb|EFH12629.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Roseomonas
           cervicalis ATCC 49957]
          Length = 790

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/751 (59%), Positives = 574/751 (76%), Gaps = 8/751 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL LANER HEYATLEHLLLAL+DD+DAA V+ +C VD   LK +L  
Sbjct: 1   MLSRNLEQTLHRALALANERRHEYATLEHLLLALVDDTDAATVLRACGVDQDKLKRDLAE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D D +  L      + KPT+ FQRVVQRA +HVQS+GR  VTGAN+LVALFSE +SHA
Sbjct: 61  FLDKDLAG-LVTERSGDPKPTAGFQRVVQRAAIHVQSSGRDEVTGANVLVALFSERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISK---RKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKT 179
            YFLQ Q+MT  DAVNFISHGI+K   R      Q      G  A   GE        + 
Sbjct: 120 VYFLQLQDMTRLDAVNFISHGIAKAPGRSASRPVQGAPPPTGQGAEEPGEKEEKPQGGRR 179

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
             +   ALS YCV+L +K ++GK+D L+GR  EI RTIQILCRR+KNNPLYVGDPGVGKT
Sbjct: 180 GQD---ALSNYCVNLNKKAQQGKIDPLIGRDSEIERTIQILCRRTKNNPLYVGDPGVGKT 236

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG AK+I++G VP++L  + I++LDMG+L+AGTRYRGDFEER+K +V E+E    +I
Sbjct: 237 AIAEGLAKRIIEGDVPEVLAKSTIYALDMGSLLAGTRYRGDFEERLKAVVNELEQQPGSI 296

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHT++GAG+ SG ++DASNLLKPAL+ G +RCIGSTTY EYR +FEKD+ALVRRF
Sbjct: 297 LFIDEIHTVIGAGATSGGAMDASNLLKPALAQGTLRCIGSTTYKEYRSYFEKDRALVRRF 356

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV+EP++EDA++I+ G+K  +E+HH+++Y+ EAIRAAV+LS ++   RKLPDKAIDV
Sbjct: 357 QKIDVNEPTVEDAVKILTGLKANYEKHHKVKYTPEAIRAAVELSAKYIHDRKLPDKAIDV 416

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDE GAS++LQP  KR+K +T KD++  +A + R I   S S DD   L NLE++L  +V
Sbjct: 417 IDEVGASRMLQPEGKRKKTVTLKDVEDIVAKIAR-IPPKSVSSDDKETLRNLERDLKAMV 475

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ++AI  LS++IK++RAGL DP KPIG Y+FSGPTGVGKTE++KQLA  LG++L+RFD
Sbjct: 476 FGQDQAIDALSAAIKLSRAGLRDPEKPIGNYLFSGPTGVGKTEVAKQLAKTLGIELIRFD 535

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERH++SRLIGAPPGYVGF QGG+L DS+DQ+P++V+LLDEIEK+H D+ NILLQ+
Sbjct: 536 MSEYMERHSISRLIGAPPGYVGFDQGGLLTDSIDQHPHAVLLLDEIEKAHQDLYNILLQV 595

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +GK + FRNVILIMTTNAGA +M+K+ IGFG       D+EA++   +PEF
Sbjct: 596 MDHGKLTDHNGKTVDFRNVILIMTTNAGAADMAKSGIGFGREERKGEDEEAVKRLFTPEF 655

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+I+PF  L+ +I+  VV KF+M+LE QL ++ ++   S     WL   GYD   G
Sbjct: 656 RNRLDAIVPFGNLTPEIVGSVVEKFVMQLEAQLADRNVTIELSSAAKEWLAEKGYDRLYG 715

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           ARPL R+I+E++K PLA+E+LFGKL KGG V
Sbjct: 716 ARPLARVIQEYIKKPLAEELLFGKLAKGGAV 746


>gi|148261529|ref|YP_001235656.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Acidiphilium
           cryptum JF-5]
 gi|326405017|ref|YP_004285099.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Acidiphilium
           multivorum AIU301]
 gi|146403210|gb|ABQ31737.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Acidiphilium
           cryptum JF-5]
 gi|325051879|dbj|BAJ82217.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Acidiphilium
           multivorum AIU301]
          Length = 775

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/748 (58%), Positives = 574/748 (76%), Gaps = 11/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL  A ER HEYATLEHLLL LIDD+DA  V+ +C VD++ L+     
Sbjct: 1   MLSRNLEQTLHRALGFAAERRHEYATLEHLLLGLIDDADALTVLRACGVDIERLRRETTE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D + +  L      + KPT+ FQRVVQRA +HVQS+GR  VTGAN+LVALFSE +SHA
Sbjct: 61  FLDKELAG-LATDRGGDPKPTAGFQRVVQRAAIHVQSSGRDEVTGANVLVALFSERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQ Q+MT  DAVNFISHGI+K    +  +      GS+ G++ E      + +    
Sbjct: 120 VYFLQAQDMTRLDAVNFISHGIAKSPGRSVPRPP---SGSAEGTEAEPEQKPKRGQD--- 173

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ YCV+L +K + GK+D L+GR  EI RTIQILCRRSKNNPL+VGDPGVGKTAIA
Sbjct: 174 ---ALANYCVNLNKKAQSGKIDPLIGRETEIERTIQILCRRSKNNPLFVGDPGVGKTAIA 230

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVDG VP++L  A I++LDMG L+AGTRYRGDFEER+K +V E+E+   A+L+I
Sbjct: 231 EGLAKRIVDGEVPEVLAKATIYALDMGALLAGTRYRGDFEERLKAVVSELEAMPGAVLFI 290

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY E+R +FEKD+ALVRRFQKI
Sbjct: 291 DEIHTVIGAGATSGGAMDASNLLKPALSSGALRCIGSTTYKEFRSYFEKDRALVRRFQKI 350

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPSI+DA++I++G+K  +E+HH++RY+ EAIRA+V+LS ++   RKLPDKAIDVIDE
Sbjct: 351 DVNEPSIDDAVKILRGLKTTYEKHHKVRYTDEAIRASVELSAKYIHDRKLPDKAIDVIDE 410

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
            GAS++L P +KRRK +T +D+++ +A + R I   S S DD   L  LE++L ++V+GQ
Sbjct: 411 VGASRMLLPENKRRKTVTLRDVEEIVAKIAR-IPPKSVSADDKETLRTLERDLKSMVFGQ 469

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI+ LS++IK+ARAGL D  KPIGCY+FSGPTGVGKTE+++QLA  LG++L RFDMSE
Sbjct: 470 DSAIEALSAAIKLARAGLRDAEKPIGCYLFSGPTGVGKTEVARQLASTLGIELTRFDMSE 529

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH++SRLIGAPPGYVGF QGG+L DSVDQ+P+ V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 530 YMERHSISRLIGAPPGYVGFDQGGLLTDSVDQHPHCVLLLDEIEKAHPDLFNILLQVMDH 589

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +GK + FRNVILIMTTNAGA +M+K  IGFG       D+EA++   +PEF NR
Sbjct: 590 GKLTDHNGKTVDFRNVILIMTTNAGAADMAKTAIGFGRDVRLGEDEEAIKRLFTPEFRNR 649

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD++IPF  L+ +I+ +VV KF+M+LE QL ++ ++   S     +L   GYD   GARP
Sbjct: 650 LDAVIPFSGLTPEIVARVVEKFVMQLEAQLADRNVTIELSSAAKEFLAERGYDPLYGARP 709

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           L R+I+E +K PLA+E+LFG+L  GGGV
Sbjct: 710 LARVIQEQIKKPLAEELLFGRLATGGGV 737


>gi|83593444|ref|YP_427196.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Rhodospirillum
           rubrum ATCC 11170]
 gi|83576358|gb|ABC22909.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Rhodospirillum
           rubrum ATCC 11170]
          Length = 779

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/748 (58%), Positives = 574/748 (76%), Gaps = 10/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL LA++R HEYATLEHLLLAL+DD DA  V+ +C+VD++ L+  L  
Sbjct: 1   MLSRNLEQTLHRALALASQRRHEYATLEHLLLALVDDQDAVSVLKACSVDVEKLRKQLAE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +++++ +  +      + KPT+ FQRVVQRA +HVQS+GR  VTGANILVALFSE +SHA
Sbjct: 61  FVEHELTGLVVAAPEGDPKPTAGFQRVVQRAAIHVQSSGREQVTGANILVALFSERESHA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQ Q+MT  DAVN+ISHGI+K       ++    D  +   +        +A     
Sbjct: 121 VYFLQMQDMTRLDAVNYISHGIAKAPGHGQARAPRGADEETKSEETATVKKGREA----- 175

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L AYCV+L EK  +GK+D L+GR +E+ RTIQILCRR+KNNPL VGDPGVGKTAI 
Sbjct: 176 ----LDAYCVNLNEKAAEGKIDPLIGRDQEVERTIQILCRRNKNNPLLVGDPGVGKTAIV 231

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV   VP++L  A IFSLDMG L+AGTRYRGDFEER+K +V E+E+Y  A+L+I
Sbjct: 232 EGLARRIVHKEVPEVLHNATIFSLDMGALLAGTRYRGDFEERLKAVVGELEAYEGAVLFI 291

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ SG S+DASNLLKPAL+ G +RC+GSTTY E+R  FEKD+ALVRRFQKI
Sbjct: 292 DEIHTVIGAGATSGGSMDASNLLKPALAQGLLRCVGSTTYKEFRNHFEKDRALVRRFQKI 351

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPS+ED ++I++GIK Y+E+HH++RY+ +A+RAAV+LS ++   RKLPDKAIDVIDE
Sbjct: 352 DVNEPSVEDTVKILRGIKSYYEDHHKVRYTNDAVRAAVELSNKYINDRKLPDKAIDVIDE 411

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
            GA+++L P S+RRK +T +DI++ +A + R I   S SRDD +VL +LE++L T+V+GQ
Sbjct: 412 VGAARMLLPESRRRKTVTVRDIEEIVAKIAR-IPPKSVSRDDQAVLKSLERDLKTMVFGQ 470

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ L+S+IK+ARAGL +P KPIG Y+FSGPTGVGKTE+++QLA  LG++L+RFDMSE
Sbjct: 471 DQAIEALASAIKLARAGLREPTKPIGNYLFSGPTGVGKTEVARQLARILGIELVRFDMSE 530

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH+VSRLIGAPPGYVGF QGG+L D+VDQ P+ V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 531 YMERHSVSRLIGAPPGYVGFDQGGLLTDAVDQQPHCVLLLDEIEKAHPDLFNILLQVMDH 590

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +GK + FRNVILIMTTNAGA  ++K  +GFG       D E +    SPEF NR
Sbjct: 591 GKLTDHNGKHVDFRNVILIMTTNAGAQMLAKNAMGFGRETRSGDDTEEIERSFSPEFRNR 650

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+IIPF  L+++ +  VV KF+M+LE QL ++ ++   +++  +WL   GYD +MGARP
Sbjct: 651 LDAIIPFANLAAETVGMVVDKFVMELEAQLADRNVTIELTDKARSWLAEKGYDRRMGARP 710

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           L RII+E +K PLA+E+LFGKL KGG V
Sbjct: 711 LARIIQETIKKPLAEELLFGKLTKGGRV 738


>gi|162149244|ref|YP_001603705.1| ATP-dependent Clp protease ATP-binding subunit clpA
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787821|emb|CAP57419.1| ATP-dependent Clp protease ATP-binding subunit clpA
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 778

 Score =  916 bits (2367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/754 (58%), Positives = 584/754 (77%), Gaps = 9/754 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL LA ER HEYATLEHLLLAL+DDSDA  V  +C VDL  L+++L  
Sbjct: 1   MLSRNLEQTLHRALTLAGERRHEYATLEHLLLALVDDSDAVTVFRACGVDLDKLRSDLTE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D D +  L +   V+ KPT++FQRV+QRA +HVQSTGR  VTG+N+LVALF+E +SHA
Sbjct: 61  FLDKDLAG-LASDRTVDPKPTAAFQRVIQRAAIHVQSTGRDEVTGSNVLVALFAERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSA-GSDGEGFVNDYQAKTDL 181
            YFLQ Q+MT  DAVNFISHGI+K  + +   ++  + GS+  GS+ E    +   K   
Sbjct: 120 VYFLQLQDMTRLDAVNFISHGIAKAPDRS---TRRPITGSAQDGSESE--REERGGKGSQ 174

Query: 182 NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
               AL+AYC +L  K + GK+D L+GR  EI RTIQILCRR+KNNPLYVGDPGVGKTAI
Sbjct: 175 KNQDALTAYCTNLNRKAEDGKIDPLIGRDPEIERTIQILCRRTKNNPLYVGDPGVGKTAI 234

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG AK+IV+G VP++LL + I+SLDMG L+AGTRYRGDFEER+K +V E+++   +IL+
Sbjct: 235 AEGLAKRIVEGDVPEVLLKSTIYSLDMGALLAGTRYRGDFEERLKAVVTELDNNPGSILF 294

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHT++GAG+ SG ++DASNLLKPAL++G +RCIGSTTY EYRQ FEKD+ALVRRFQK
Sbjct: 295 IDEIHTVIGAGATSGGAMDASNLLKPALAAGTLRCIGSTTYKEYRQHFEKDRALVRRFQK 354

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           IDV+EP++EDA++I++G+K  +E+HH++RY++EAIR AV+L+ ++   RKLPDKAIDVID
Sbjct: 355 IDVAEPTLEDAVKILRGLKGNYEKHHKVRYTEEAIRGAVELAAKYIHDRKLPDKAIDVID 414

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           E GAS++L P ++RRK +T KD++  +A + R I   S S DD   L  LE++L  +VYG
Sbjct: 415 EVGASRMLVPENRRRKTVTLKDVEDIVAKIAR-IPPKSVSSDDKETLRTLERDLKGMVYG 473

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q+ AI+ L+++IK++RAGL DP KPIG Y+FSGPTGVGKTE++KQLA  LG++L+RFDMS
Sbjct: 474 QDRAIEALTAAIKLSRAGLRDPEKPIGNYLFSGPTGVGKTEVAKQLAKTLGIELIRFDMS 533

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERH++SRLIGAPPGYVGF QGG+L D++DQ+P++V+LLDEIEK+H D+ N+LLQ+MD
Sbjct: 534 EYMERHSISRLIGAPPGYVGFDQGGLLTDAIDQHPHAVLLLDEIEKAHQDLYNVLLQVMD 593

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
           +G LTD +GK + FRNV+LIMTTNAGA ++SK  IGF        D+EA++   +PEF N
Sbjct: 594 HGRLTDHNGKTVDFRNVVLIMTTNAGAADLSKEAIGFARDVRSGEDEEAIKRIFTPEFRN 653

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD++IPF  L+ +I+ +VV KF+ +LE QL ++ ++   S     WL   GYD   GAR
Sbjct: 654 RLDAVIPFANLTPEIVGRVVEKFVFQLEAQLADRNVTIEISSAAKEWLAERGYDRLYGAR 713

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           PL R+I+EH+K PLA+E+LFG+L K GG VK++L
Sbjct: 714 PLGRVIQEHIKKPLAEELLFGRLVK-GGAVKITL 746


>gi|209545020|ref|YP_002277249.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532697|gb|ACI52634.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 778

 Score =  916 bits (2367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/754 (58%), Positives = 584/754 (77%), Gaps = 9/754 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL LA ER HEYATLEHLLLAL+DDSDA  V  +C VDL  L+++L  
Sbjct: 1   MLSRNLEQTLHRALTLAGERRHEYATLEHLLLALVDDSDAVTVFRACGVDLDKLRSDLTE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D D +  L +   V+ KPT++FQRV+QRA +HVQSTGR  VTG+N+LVALF+E +SHA
Sbjct: 61  FLDKDLAG-LASDRTVDPKPTAAFQRVIQRAAIHVQSTGRDEVTGSNVLVALFAERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSA-GSDGEGFVNDYQAKTDL 181
            YFLQ Q+MT  DAVNFISHGI+K  + +   ++  + GS+  GS+ E    +   K   
Sbjct: 120 VYFLQLQDMTRLDAVNFISHGIAKAPDRS---TRRPITGSAQDGSESE--REERGGKGSQ 174

Query: 182 NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
               AL+AYC +L  K + GK+D L+GR  EI RTIQILCRR+KNNPLYVGDPGVGKTAI
Sbjct: 175 KNQDALTAYCTNLNRKAEDGKIDPLIGRDPEIERTIQILCRRTKNNPLYVGDPGVGKTAI 234

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG AK+IV+G VP++LL + I+SLDMG L+AGTRYRGDFEER+K +V E+++   +IL+
Sbjct: 235 AEGLAKRIVEGDVPEVLLKSTIYSLDMGALLAGTRYRGDFEERLKAVVTELDNNPGSILF 294

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHT++GAG+ SG ++DASNLLKPAL++G +RCIGSTTY EYRQ FEKD+ALVRRFQK
Sbjct: 295 IDEIHTVIGAGATSGGAMDASNLLKPALAAGTLRCIGSTTYKEYRQHFEKDRALVRRFQK 354

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           IDV+EP++EDA++I++G+K  +E+HH++RY++EAIR AV+L+ ++   RKLPDKAIDVID
Sbjct: 355 IDVAEPTLEDAVKILRGLKGNYEKHHKVRYTEEAIRGAVELAAKYIHDRKLPDKAIDVID 414

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           E GAS++L P ++RRK +T KD++  +A + R I   S S DD   L  LE++L  +VYG
Sbjct: 415 EVGASRMLVPENRRRKTVTLKDVEDIVAKIAR-IPPKSVSSDDKETLRTLERDLKGMVYG 473

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q+ AI+ L+++IK++RAGL DP KPIG Y+FSGPTGVGKTE++KQLA  LG++L+RFDMS
Sbjct: 474 QDRAIEALTAAIKLSRAGLRDPEKPIGNYLFSGPTGVGKTEVAKQLAKTLGIELIRFDMS 533

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERH++SRLIGAPPGYVGF QGG+L D++DQ+P++V+LLDEIEK+H D+ N+LLQ+MD
Sbjct: 534 EYMERHSISRLIGAPPGYVGFDQGGLLTDAIDQHPHAVLLLDEIEKAHQDLYNVLLQVMD 593

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
           +G LTD +GK + FRNV+LIMTTNAGA ++SK  IGF        D+EA++   +PEF N
Sbjct: 594 HGRLTDHNGKTVDFRNVVLIMTTNAGAADLSKEAIGFARDVRSGEDEEAIKRIFTPEFRN 653

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD++IPF  L+ +I+ +VV KF+ +LE QL ++ ++   S     WL   GYD   GAR
Sbjct: 654 RLDAVIPFANLTPEIVGRVVEKFVFQLEAQLADRNVTIEISSAAKEWLAERGYDRVYGAR 713

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           PL R+I+EH+K PLA+E+LFG+L K GG VK++L
Sbjct: 714 PLGRVIQEHIKKPLAEELLFGRLVK-GGAVKITL 746


>gi|296116797|ref|ZP_06835403.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295976598|gb|EFG83370.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 779

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/758 (58%), Positives = 587/758 (77%), Gaps = 10/758 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S NLE+ LH+AL LA+ER HEYATLEHLLL+LIDD DA  V  +C VDL  L+++L  
Sbjct: 1   MLSRNLEQTLHRALTLASERRHEYATLEHLLLSLIDDPDAVTVFRACGVDLDKLRHDLTE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D D +  L +   V+ KPT++FQRV+QRA +HVQSTGR  VTGAN+LVALF+E +SHA
Sbjct: 61  FLDKDLAG-LASDRTVDPKPTAAFQRVIQRAAIHVQSTGRDEVTGANVLVALFAERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGS-SAGSDGEGFVNDYQAKTDL 181
            YFLQ Q+MT  DAVNFISHGI+K  E +   ++  V G+ S G D E    +   K+  
Sbjct: 120 VYFLQLQDMTRLDAVNFISHGIAKAPERS---TRRPVAGTPSEGPDPE---REETGKSRQ 173

Query: 182 NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
               ALS YC +L +K  +GK+D L+GR  EI RTIQILCRR+KNNPLYVGDPGVGKTAI
Sbjct: 174 KNQDALSTYCTNLNDKASEGKIDPLIGRDSEIERTIQILCRRTKNNPLYVGDPGVGKTAI 233

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG AK+IV+G VP++LL + I+SLDMG L+AGTRYRGDFEER+K +V E+++   +IL+
Sbjct: 234 AEGLAKRIVEGDVPEVLLHSTIYSLDMGALLAGTRYRGDFEERLKAVVTELDNNPGSILF 293

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHT++GAG+ SG ++DASNLLKPAL++G +RCIGSTTY EYRQ FEKD+ALVRRFQK
Sbjct: 294 IDEIHTVIGAGATSGGAMDASNLLKPALAAGTLRCIGSTTYKEYRQHFEKDRALVRRFQK 353

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           IDV+EPSI+DA++I++G+K  +E+HH++RY+ +AIR AV+L+ ++   RKLPDKAIDVID
Sbjct: 354 IDVAEPSIDDAVKILRGLKVNYEKHHKVRYTDDAIRGAVELAAKYIHDRKLPDKAIDVID 413

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           E GAS++L P ++RRK +T KD++  +A + R I   S S DD   L +LE++L  +VYG
Sbjct: 414 EVGASRMLVPENRRRKTVTLKDVEDIVAKIAR-IPPKSVSSDDKETLRSLERDLKGMVYG 472

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q++AI+ L+++IK++RAGL D  KPIG Y+FSGPTGVGKTE++KQLA  LG++L+RFDMS
Sbjct: 473 QDKAIEALTAAIKLSRAGLRDAEKPIGNYLFSGPTGVGKTEVAKQLASTLGIELIRFDMS 532

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERH++SRLIGAPPGYVGF QGG+L D++DQ+P++V+LLDEIEK+HPD+ N+LLQ+MD
Sbjct: 533 EYMERHSISRLIGAPPGYVGFDQGGLLTDAIDQHPHAVLLLDEIEKAHPDLYNVLLQVMD 592

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
           +G LTD +GK + FRNV+LIMTTNAGA ++SK  IGF  +  +  D+EA++   +PEF N
Sbjct: 593 HGRLTDHNGKTVDFRNVMLIMTTNAGAADLSKESIGFARNGREGEDEEAIKRIFTPEFRN 652

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD+IIPF  L  +++ +VV KFI +LE QL ++ +    S     WL   GYD   GAR
Sbjct: 653 RLDAIIPFAHLPPEVVDRVVEKFIFQLEAQLADRNVMIEISSAAKEWLAERGYDRLYGAR 712

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           PL R+I+E++K PLA+E+LFG+L K GGVVK+SL   K
Sbjct: 713 PLGRVIQENIKKPLAEELLFGRLVK-GGVVKISLKDGK 749


>gi|149913689|ref|ZP_01902222.1| ATP-dependent Clp protease ATP-binding subunit clpA [Roseobacter
           sp. AzwK-3b]
 gi|149812809|gb|EDM72638.1| ATP-dependent Clp protease ATP-binding subunit clpA [Roseobacter
           sp. AzwK-3b]
          Length = 777

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/759 (58%), Positives = 582/759 (76%), Gaps = 6/759 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE+ATLEHLLLALID+ DAA V+ +C+VD + L+  L
Sbjct: 1   MPSFSNTLEQAIHAALALANARQHEFATLEHLLLALIDEPDAARVLKACSVDTEDLRGTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + +ID+D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFIDDDLSNLVTDIEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +    + G+S  ++ E    + + +  
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPAYGESR---RITGASE-AESENTRREQEPEAV 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL EK ++G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 177 EAGESALAKYCVDLNEKSRRGDIDPLIGRDSEVERCIQVLCRRRKNNPLLVGDPGVGKTA 236

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +IV G  P++L    IFSLDMG L+AGTRYRGDFEER+K +V E+ES+ +A+L
Sbjct: 237 IAEGLALKIVRGQTPEVLSNTTIFSLDMGALLAGTRYRGDFEERLKAVVNELESHPDAVL 296

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTT+ E+RQ FEKD+AL RRFQ
Sbjct: 297 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTFKEFRQHFEKDRALSRRFQ 356

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP+ +DAI+I+KG+KPYFEEHH ++Y+ +AI++AV LS R+ T RKLPDKAIDVI
Sbjct: 357 KIDVVEPTTDDAIKILKGLKPYFEEHHSVKYTNDAIKSAVDLSARYITDRKLPDKAIDVI 416

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I+  +A + R I   S S+DD  VL +LE++L  VV+
Sbjct: 417 DEAGAAQHLVAASKRRKSIGAKEIEAVVAKIAR-IPPKSVSKDDAEVLKDLERSLKRVVF 475

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L+SSIK+ARAGL +P+KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 476 GQDPAIEALASSIKLARAGLREPDKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 535

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 536 SEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNILLQVM 595

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNV+LIMT+NAGA E +KA IGFG  R +  D  A+    +PEF 
Sbjct: 596 DHGTLTDHNGRSVDFRNVVLIMTSNAGAAEQAKAAIGFGRDRREGEDTAAIERTFTPEFR 655

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  ++I QVV KF+++LE QL ++ +S   ++    WL   GYD KMGA
Sbjct: 656 NRLDAVISFGPLPKEVILQVVEKFVLQLEAQLMDRNVSIELTQPAAEWLADKGYDDKMGA 715

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           RPL R+I+EH+K PLA+E+LFGKL K GG+V+V +  +K
Sbjct: 716 RPLARVIQEHIKKPLAEELLFGKLAK-GGLVQVGIKDNK 753


>gi|254441332|ref|ZP_05054825.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Octadecabacter
           antarcticus 307]
 gi|198251410|gb|EDY75725.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Octadecabacter
           antarcticus 307]
          Length = 773

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/750 (58%), Positives = 569/750 (75%), Gaps = 9/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE ATLEHLLLALID+ DAA VM +C+VDL  L+  L
Sbjct: 1   MPSFSTTLEQSIHSALALANARKHELATLEHLLLALIDEPDAARVMKACSVDLGELRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            ++I++D S  + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  EDFIEDDLSTLVTDVEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+MT YDAVNFI+HG++K   F   +    V G+    D E    +  +K +
Sbjct: 121 NAAYFLQDQDMTRYDAVNFIAHGVAKNPAFGESRP---VTGAPT-LDDEAESAEESSKDE 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL  K +KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 177 ----SALAKYCVDLNVKAQKGDVDPLIGRDHEVERCIQVLCRRRKNNPLLVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++I++  VP++L G  I+SLDMG L+AGTRYRGDFEER+K ++ E+E + +A+L
Sbjct: 233 IAEGLARKIIESKVPEVLAGTTIYSLDMGALLAGTRYRGDFEERLKAVMTELEDHDDAVL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+ G +RC+GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 293 FIDEIHTIIGAGATSGGAMDASNLLKPALAGGKLRCMGSTTYKEFRQHFEKDRALARRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ED+I+I+KGIK YFE+HHQ++Y+ +AI++AV+LS R+   RKLPDKAIDVI
Sbjct: 353 KIDVNEPSVEDSIKILKGIKTYFEDHHQIKYTADAIKSAVELSARYINDRKLPDKAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LE +L  VV+
Sbjct: 413 DEAGAAQHLVAESKRRKTIGTKEIEAVVAKIAR-IPPKNVSKDDAEVLKDLESSLKRVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 472 GQDDAIVALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+H++SRLIGAPPGYVGF QGG+L D VDQNP+ V+LLDE+EK+HPDV NILLQ+M
Sbjct: 532 SEYMEKHSISRLIGAPPGYVGFDQGGMLTDGVDQNPHCVLLLDEMEKAHPDVYNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+   FRNVI+IMTTNAGA EM+K  IGFG  R    D  A+    +PEF 
Sbjct: 592 DNGKLTDHNGRTTDFRNVIIIMTTNAGASEMAKEAIGFGRERRTGEDTAAIERTFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+++ F PL  +II QVV KF+++LE QL ++ +S   +     WL   GYD KMGA
Sbjct: 652 NRLDAVVSFAPLGKEIILQVVEKFVLQLEAQLMDRNVSIELTRPAAEWLADKGYDDKMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RPL R I+EH+K PLA+E+LFG L KGG V
Sbjct: 712 RPLGRTIQEHIKKPLAEELLFGTLAKGGHV 741


>gi|259416112|ref|ZP_05740032.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Silicibacter
           sp. TrichCH4B]
 gi|259347551|gb|EEW59328.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Silicibacter
           sp. TrichCH4B]
          Length = 778

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/759 (58%), Positives = 574/759 (75%), Gaps = 5/759 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LANER HE+ATLEHLLLALI++ DAA VM +C+V+L  L++ L
Sbjct: 1   MPSFSSTLEQAIHAALALANERRHEFATLEHLLLALIEEPDAARVMQACSVNLDELRSTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           L ++D D +N + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  LEFVDEDLANLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
            A +FLQ+Q+MT YDAVNFI+HG++K   +   +    V G++   D  G          
Sbjct: 121 DAAFFLQDQDMTRYDAVNFIAHGVAKDPAYGENRP---VTGATDAEDEIGGGPTVGGAEG 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALS YCVDL  K ++G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 178 EQKESALSKYCVDLNAKSREGDIDPLIGRDSEVERCIQVLCRRRKNNPLLVGDPGVGKTA 237

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A+++V   VP++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 238 IAEGLARKVVQSEVPEVLSETTIYSLDMGALLAGTRYRGDFEERLKAVVTELEEHPDAVL 297

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 298 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALSRRFQ 357

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDVSEPS+ED+IEI+KG+KPYFEEHH ++++ +AI++AV+LS R+   RKLPDKAIDVI
Sbjct: 358 KIDVSEPSVEDSIEILKGLKPYFEEHHSIKFTSDAIKSAVELSARYINDRKLPDKAIDVI 417

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LE +L  VV+
Sbjct: 418 DEAGAAQHLVVESKRRKTIGVKEIEAVVAKIAR-IPPKNVSKDDAEVLKDLEASLKRVVF 476

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 477 GQDAAIDALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 536

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 537 SEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNILLQVM 596

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+ ++FRNV+LIMT+NAGA E++K+ IGFG  R +  D  A+    SPEF 
Sbjct: 597 DNGQLTDHNGRTVNFRNVVLIMTSNAGASELAKSAIGFGRDRREGEDTAAIERTFSPEFR 656

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F PL  ++I QVV KF+++LE QL ++ +S   + +   WL   GYD KMGA
Sbjct: 657 NRLDATISFGPLPKEVILQVVEKFVLQLEAQLMDRNVSIELTRKAAEWLADKGYDDKMGA 716

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           RPL R+I+EH+K PLA+E+LFGKL K GGVV+V +   K
Sbjct: 717 RPLGRVIQEHIKKPLAEELLFGKLSK-GGVVQVGIKDGK 754


>gi|83945503|ref|ZP_00957850.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Oceanicaulis
           alexandrii HTCC2633]
 gi|83851079|gb|EAP88937.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Oceanicaulis
           alexandrii HTCC2633]
          Length = 777

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/769 (58%), Positives = 589/769 (76%), Gaps = 15/769 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ LH+AL  A ER HEYATLEHLLL+L +D DA+ VM +C+VD+  L++ L
Sbjct: 1   MPSFSPTLERSLHRALTAATERKHEYATLEHLLLSLCEDVDASAVMRACDVDVDELRDTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D + ++ + +    + KPT+ FQRV+QRAV+HVQ++GR  VTGAN+LVALF+E +S
Sbjct: 61  NEYVDEELASLMVDDGE-DAKPTAGFQRVIQRAVIHVQNSGRDEVTGANVLVALFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFL E++MT YDAVN+ISHGISK+   ++ +     D   A   GEG     + K D
Sbjct: 120 HAAYFLAERDMTRYDAVNYISHGISKKPGESDSRPPRGAD-EDAVEPGEG----AEEKDD 174

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYCVDL EK ++G VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 175 -----ALSAYCVDLNEKAREGGVDPLIGREHEVERCIQVLCRRRKNNPLLVGDPGVGKTA 229

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+  VP++L  A I+SLDMG L+AGTRYRGDFEER+K++VK +E+  NA+L
Sbjct: 230 IAEGLARKIVEKEVPEVLAEATIYSLDMGALLAGTRYRGDFEERVKQVVKALEARPNAVL 289

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY EYRQ FEKD+AL RRFQ
Sbjct: 290 FIDEIHTVIGAGATSGGAMDASNLLKPALQQGGLRCMGSTTYKEYRQHFEKDRALARRFQ 349

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ DAI+I+ G+KPYFEE H +R++ +A+++AV+LS R+   RKLPDKAIDVI
Sbjct: 350 KIDVTEPSVPDAIKILNGLKPYFEEFHDIRFTADALKSAVELSDRYIGDRKLPDKAIDVI 409

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGAS  L P SKR+K I  K+I+  +A + R I   S S+ D++VL +LE +L  VV+
Sbjct: 410 DEAGASMRLVPASKRKKTIGVKEIEAVVAKIAR-IPPKSVSKSDEAVLRDLENSLKRVVF 468

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+KL+S+IK+ARAGL +PNKPIG Y+FSGPTGVGKTE+++QLA  LGV+LLRFDM
Sbjct: 469 GQDDAIEKLASAIKLARAGLREPNKPIGSYLFSGPTGVGKTEVARQLADTLGVELLRFDM 528

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRL+GAPPGYVG+ QGG L D++DQ+P+SV+LLDEIEK+HPD+ NILLQ+M
Sbjct: 529 SEYMERHTVSRLLGAPPGYVGYDQGGQLTDAIDQHPHSVLLLDEIEKAHPDIFNILLQVM 588

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +GK +  RNVILIMT+NAGA + +K  IGFG  + D  D+ A+    +PEF 
Sbjct: 589 DNGQLTDANGKSVDCRNVILIMTSNAGAADAAKEAIGFGRGKRDGEDQAAIERLFTPEFR 648

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+IIPF  L  ++I +VV KF+++LE QL ++G++F  +E    WL   GYD K GA
Sbjct: 649 NRLDAIIPFSGLKIEVIGRVVEKFVLQLEAQLADRGVTFELTEAATRWLGERGYDEKFGA 708

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEI 769
           RPL R+I++H+K PLA+EILFG+LKK GGVVKV +  D +    + FEI
Sbjct: 709 RPLSRVIQDHIKKPLAEEILFGQLKK-GGVVKVDV--DAADPERLDFEI 754


>gi|49475406|ref|YP_033447.1| endopeptidase Clp ATP-binding chain a [Bartonella henselae str.
           Houston-1]
 gi|49238212|emb|CAF27422.1| Endopeptidase clp ATP-binding chain a [Bartonella henselae str.
           Houston-1]
          Length = 783

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/759 (59%), Positives = 587/759 (77%), Gaps = 16/759 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+ +LE+VLH+AL +AN+  HEYATLEHLLLAL+DD+DA+ V+ +C VD++ L+  L
Sbjct: 1   MPSFTPSLEEVLHRALTIANQARHEYATLEHLLLALLDDADASSVIRACQVDVEELRERL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            NYI ++   +++N    + KPT+ FQRV+QRAV+H QS G+  V+GAN+LVA+FSE +S
Sbjct: 61  TNYIQSELDAQMRND--EDTKPTTFFQRVIQRAVIHAQSAGKDEVSGANVLVAIFSERES 118

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDG-SSAGSDGEGFVNDYQAKT 179
           +A YFLQE  MT YD V FISHGI++             DG S    D E  ++   +  
Sbjct: 119 YAAYFLQEMGMTRYDVVRFISHGITRD------------DGLSMLLEDLEDQLDQQISDN 166

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
            + +  AL+AYC+DL  K + GKVD+L+GR  EI+R IQ+LCRRSKNNPL VGDPGVGKT
Sbjct: 167 SIKVTSALTAYCIDLNCKARNGKVDLLIGREVEISRMIQVLCRRSKNNPLLVGDPGVGKT 226

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AI EG AK+IVDG VP++L  A IFSLDMG L+AGTRYRGDFEER+K+++KE E Y+NA+
Sbjct: 227 AIIEGLAKRIVDGEVPEVLSNATIFSLDMGGLVAGTRYRGDFEERLKQLIKEFEQYSNAV 286

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHTL+GAG+  G ++DA+NLLKPALSSG +RCIGSTTY EYR+ FE+D+AL RRF
Sbjct: 287 LFIDEIHTLIGAGATLGGNMDAANLLKPALSSGTIRCIGSTTYKEYRKIFEQDRALERRF 346

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV+EPS+ DAI+I++G+KPYFE+ HQ++Y+ EA++A+V+LS R+   R+LPDKAIDV
Sbjct: 347 QKIDVNEPSVADAIKILQGLKPYFEDFHQIKYTDEAMKASVELSSRYMIDRRLPDKAIDV 406

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDE+GA+Q L P  +R+K I  K+I+ T+A+M R I   + S DD  +LS LE+ L  VV
Sbjct: 407 IDESGAAQRLLPKKQRKKSIGVKEIEATVATMAR-IPPKTVSGDDQKMLSKLERELKHVV 465

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           YGQ++AI  L SSIK+ARAGL D +KPIG Y+FSGPTGVGKTE++KQLA +LG++LLRFD
Sbjct: 466 YGQDQAISVLVSSIKLARAGLRDADKPIGSYLFSGPTGVGKTEVTKQLASSLGIELLRFD 525

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERH V+RLIGAPPGY+GF QGG+L D+VDQ P++V+LLDEIEK+H ++ NILLQ+
Sbjct: 526 MSEYMERHTVARLIGAPPGYIGFDQGGLLTDAVDQKPHAVLLLDEIEKAHSELFNILLQV 585

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MDYG LTD +GKKI FRN+ILIMTTNAGA +M+K+ IGFG    D  D EA+    +PEF
Sbjct: 586 MDYGKLTDHNGKKIDFRNIILIMTTNAGASDMAKSAIGFGKVHRDGDDIEAINRLFTPEF 645

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+IIPF PLS  II Q+V KFI +LE QL ++GI F  S   + WL + GYD +MG
Sbjct: 646 RNRLDAIIPFSPLSQLIINQIVQKFIFQLEAQLADRGICFELSPSAMVWLANKGYDFQMG 705

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           ARPL RII+E++K PLADEILFG+L+ GG V  ++  P+
Sbjct: 706 ARPLGRIIQEYIKKPLADEILFGQLRNGGMVRVLTHRPN 744


>gi|294678496|ref|YP_003579111.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Rhodobacter
           capsulatus SB 1003]
 gi|294477316|gb|ADE86704.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Rhodobacter
           capsulatus SB 1003]
          Length = 773

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/773 (57%), Positives = 578/773 (74%), Gaps = 15/773 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE ATLEHLLLALID+ DA+ VM +C VDL  L+  L
Sbjct: 1   MPSFSTTLEQAIHAALALANTRKHELATLEHLLLALIDEPDASRVMRACGVDLGELRTTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             +ID+D S  +      E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  TEFIDDDLSTLITEVEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A +FLQEQ+MT YDAVNFI+HG++K   F   +    V G+   +         +AK  
Sbjct: 121 NAAFFLQEQDMTRYDAVNFIAHGVAKDPAFGESRP---VIGAEEETAKAEAAQPGEAKES 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L +K +KG +D L+GR EE+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 178 -----ALGKYCVNLNQKSQKGDIDPLIGRAEEVERCIQVLCRRRKNNPLLVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G  PDIL  + I+SLDMG L+AGTRYRGDFEER+K ++KE+E + +AIL
Sbjct: 233 IAEGLALKITRGETPDILARSTIYSLDMGALLAGTRYRGDFEERLKAVMKELEDHPDAIL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALSRRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ D+I+I+ G+KPYFEEHH +RY+ +AI++AV+L+ R+   RKLPDKAIDVI
Sbjct: 353 KIDVNEPSVGDSIKILMGLKPYFEEHHDVRYTNDAIKSAVELAARYIHDRKLPDKAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L P SK+RK +  K+I+  +A + R I   S S+DD ++L +LEK L  VV+
Sbjct: 413 DEAGAAQHLLPDSKKRKTLGAKEIEAVVAKIAR-IPPKSVSKDDAAILRDLEKTLKRVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L+S+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 472 GQDKAIETLASAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLANTLGVELLRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+H DV NILLQ+M
Sbjct: 532 SEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHSDVFNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+++ FRNVILIMT+NAGA E +K+ IGFG  R +  D  A+    +PEF 
Sbjct: 592 DHGKLTDHNGRQVDFRNVILIMTSNAGAAEQAKSAIGFGRERREGEDTAAIERTFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+++ F PL  D I QVV KF+++LE QL ++ +    + E   WL   GYD KMGA
Sbjct: 652 NRLDAVVSFAPLPRDTILQVVDKFVLQLEAQLIDRNVHIELTPEAAEWLAVKGYDDKMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSG 773
           RPL R+I+EH+K PLA+E+LFG+L K GGVV+V++  D      I  ++E  G
Sbjct: 712 RPLGRVIQEHIKKPLAEELLFGRLIK-GGVVRVTVRDDA-----IALDVEEPG 758


>gi|114328415|ref|YP_745572.1| ATP-dependent Clp protease ATP-binding subunit clpA [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316589|gb|ABI62649.1| ATP-dependent clp protease ATP-binding subunit clpA [Granulibacter
           bethesdensis CGDNIH1]
          Length = 851

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/790 (56%), Positives = 598/790 (75%), Gaps = 16/790 (2%)

Query: 2   SFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLL 61
           S  S NLE+ LH+AL LA+ER+HEYATLEHLLL L +D+DA  V+ +C VD+  L+ +L 
Sbjct: 65  SMLSRNLEQTLHRALSLASERHHEYATLEHLLLGLAEDADAVAVLRACGVDIDKLRTDLT 124

Query: 62  NYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSH 121
            ++D D S  L +    + KPT+ FQRVVQRA +HVQS+GR  VTGAN+LVALFSE +SH
Sbjct: 125 EFLDKDLSG-LASERASDPKPTAGFQRVVQRAAIHVQSSGRDEVTGANVLVALFSERESH 183

Query: 122 ATYFLQEQEMTLYDAVNFISHGISK---RKEFANFQSKLNVDGSSAGSDGEGFVNDYQAK 178
           A YFLQ Q+MT  DAVNFISHGI+K   R +    Q   +   S+ G +  G  ++ + K
Sbjct: 184 AVYFLQLQDMTRLDAVNFISHGIAKAPGRSQTRPVQGSASG--SNGGGEPSGPESEREEK 241

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
           +      ALS YCVDL +K + GK+D L+GR  EI RTIQILCRR+KNNPLYVGDPGVGK
Sbjct: 242 SSRRKEDALSTYCVDLNKKARAGKIDPLIGRDTEIERTIQILCRRTKNNPLYVGDPGVGK 301

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG AK+IV+  VP++LL + I++LDMG L+AGTRYRGDFEER+K +V E+E++  A
Sbjct: 302 TAIAEGLAKRIVESDVPEVLLNSTIYALDMGALLAGTRYRGDFEERLKAVVTELENHPGA 361

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           +L+IDEIHT++GAG+ SG ++DASNLLKPAL+SGA+RCIGSTTY E+R +FEKD+ALVRR
Sbjct: 362 VLFIDEIHTVIGAGATSGGAMDASNLLKPALASGALRCIGSTTYKEFRNYFEKDRALVRR 421

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV+EPS+EDA++I++G+K  +E HH++ Y++EAIR AV+L+ ++   RKLPDKAID
Sbjct: 422 FQKIDVNEPSVEDAVKILRGLKTNYETHHKVTYTEEAIRGAVELAAKYIHDRKLPDKAID 481

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDE GAS++L P  KRRK +T +D++  +A + R I   S S DD   L  LE++L  +
Sbjct: 482 VIDEVGASRMLLPEHKRRKTVTLQDVEDIVARIAR-IPPKSVSADDKETLRTLERDLKAM 540

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ++AI+ LS++IK++RAGL D  KPIG Y+FSGPTGVGKTE+++QLA  LG++L+RF
Sbjct: 541 VFGQDKAIEALSAAIKLSRAGLRDAEKPIGNYLFSGPTGVGKTEVARQLATTLGIELIRF 600

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH++SRLIGAPPGYVGF QGG+L D++DQ+P++V+LLDE+EK+HPD+ NILLQ
Sbjct: 601 DMSEYMERHSISRLIGAPPGYVGFDQGGLLTDAIDQHPHAVLLLDEVEKAHPDLYNILLQ 660

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +GK + FRNVILIMTTNAGA +M+K  IGFG       D++A++   +PE
Sbjct: 661 VMDHGKLTDHNGKIVDFRNVILIMTTNAGASDMAKEAIGFGREARVGEDEDAVKRLFTPE 720

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD++IPF  L+++I+ +VV KF+M+LE QL ++ ++   +     WL   GYD   
Sbjct: 721 FRNRLDAVIPFGNLTAEIVGRVVEKFVMQLEAQLADRNVTIELNSAAKEWLAERGYDRLY 780

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK------SASSPIF--FEIE 770
           GARPL R+I+E++K PLA+E+LFGKL KGG  VKV+L  D        AS+P     +  
Sbjct: 781 GARPLARVIQEYIKKPLAEELLFGKLVKGGS-VKVTLKDDALEFDIVEASAPALPRPDAN 839

Query: 771 NSGSNISLET 780
           + G  ++ ET
Sbjct: 840 DGGEELAAET 849


>gi|296284801|ref|ZP_06862799.1| ATPase [Citromicrobium bathyomarinum JL354]
          Length = 787

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/750 (59%), Positives = 575/750 (76%), Gaps = 10/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F++NLEK LH AL  A ER HEYATLEHLLLALI D DAA VM +C VDL  L + +
Sbjct: 1   MPSFAQNLEKTLHAALDGARERRHEYATLEHLLLALIADEDAAEVMGACGVDLAELADVV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D +  + LK     E +PT+ FQRVVQRA+LHVQS+G+  VTGAN+LVALFSE DS
Sbjct: 61  RTYLDQEYQS-LKAEESGEPQPTAGFQRVVQRAILHVQSSGKDTVTGANVLVALFSERDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+M+  DAV+FISHGI K  +    +S    D + A    E   N  +    
Sbjct: 120 YAVYFLQQQDMSRLDAVSFISHGIGKGGQAIEPRSPRGADEAEAEEKEEAKGNKKET--- 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  + V+L  K + GK+D L+GR  E++RT+QILCRRSKNNPLYVGDPGVGKTA
Sbjct: 177 -----ALDQFTVNLNAKAQGGKIDPLIGRGPEVDRTVQILCRRSKNNPLYVGDPGVGKTA 231

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G VP++L  A I+SLDMG L+AGTRYRGDFEER+K++V E+E   +AIL
Sbjct: 232 IAEGLARKIVEGDVPEVLEEAVIYSLDMGALLAGTRYRGDFEERLKQVVSELEKMPHAIL 291

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY E+R  FEKD+AL+RRFQ
Sbjct: 292 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEFRNHFEKDRALLRRFQ 351

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+IED ++I+KG+K  FE+HH++ Y+ +A++ AV+LS R+   RKLPDKAIDV+
Sbjct: 352 KIDVNEPTIEDTVKILKGLKSAFEKHHKVTYTADALKTAVELSARYINDRKLPDKAIDVV 411

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA Q+L P SKRRK IT ++I++ IA+M R I   S S+DD + L NLE++L  VV+
Sbjct: 412 DEVGAMQMLVPPSKRRKKITAREIEQVIATMAR-IPPKSVSKDDKAALENLERDLKQVVF 470

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ A+KKLS+++K++RAGL DP+KPIG ++FSGPTGVGKTE+++QLA  +G++L RFDM
Sbjct: 471 GQDAAVKKLSTAMKLSRAGLRDPDKPIGSFLFSGPTGVGKTEVARQLASIMGIELKRFDM 530

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH+VSRLIGAPPGYVG+ QGG+L D+VDQNP+SV+LLDEIEK+HPD+ NILLQ+M
Sbjct: 531 SEYMERHSVSRLIGAPPGYVGYDQGGLLTDAVDQNPHSVLLLDEIEKAHPDLFNILLQVM 590

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GK + FRNV+LIMTTNAGA +M+++ IGFG    +DA +EA++   +PEF 
Sbjct: 591 DNGRLTDHHGKTVDFRNVVLIMTTNAGAADMARSGIGFGDVSKEDASEEAVKQMFTPEFR 650

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF  L  D I +VV KFI++LELQL E+ +   F +    WL   GYD   GA
Sbjct: 651 NRLDAIVPFGYLGKDTIARVVDKFIIQLELQLAEQNVDIQFDDAAKKWLGDKGYDRLYGA 710

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RP+ R+I+E +K PLA+E+LFGKL  GG V
Sbjct: 711 RPMGRLIQEKIKQPLAEELLFGKLADGGEV 740


>gi|87198092|ref|YP_495349.1| ATP dependent Clp protease [Novosphingobium aromaticivorans DSM
           12444]
 gi|87133773|gb|ABD24515.1| ATP dependent Clp protease [Novosphingobium aromaticivorans DSM
           12444]
          Length = 792

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/779 (57%), Positives = 583/779 (74%), Gaps = 14/779 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+++LEK LH AL  A+ER+HEYATLEHLLLALIDD DAA VM +C VDL  L + +
Sbjct: 1   MPSFAQSLEKTLHTALANASERSHEYATLEHLLLALIDDPDAAQVMQACGVDLGDLGDVV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D +  + LK   + + +PT+ FQRV+QRA+LHVQS+G+  VTGAN+LVALFSE DS
Sbjct: 61  RQYLDQEYQS-LKTQEKADPQPTAGFQRVIQRAILHVQSSGKDTVTGANVLVALFSERDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+M+  DAV+FISHGI K            VDG +     E      + K D
Sbjct: 120 YAVYFLQQQDMSRLDAVSFISHGIGK--------GGRQVDGRTPKGAEEDVPKQQEEKAD 171

Query: 181 LN---LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG 237
                   AL  +CV+L EK   GKVD L+GR  E++RTIQILCRRSKNNPLYVGDPGVG
Sbjct: 172 AKGQKKETALDQFCVNLNEKALAGKVDPLIGRGPEVDRTIQILCRRSKNNPLYVGDPGVG 231

Query: 238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN 297
           KTAIAEG A++IV+G VP++L  A I+SLDMG+L+AGTRYRGDFEER+K++V E+E   +
Sbjct: 232 KTAIAEGLARKIVEGEVPEVLSEAVIYSLDMGSLLAGTRYRGDFEERLKQVVSELEKMPH 291

Query: 298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR 357
           AIL+IDEIHT++GAG+ SG ++DASNLLKPALS G +RCIGSTTY E+R  FEKD+AL+R
Sbjct: 292 AILFIDEIHTVIGAGATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFRNHFEKDRALLR 351

Query: 358 RFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI 417
           RFQKIDV+EP++ED I+I+KG++  FEEHH+++Y+ +AI+ AV+LS R+   RKLPDKAI
Sbjct: 352 RFQKIDVNEPTVEDTIKILKGLRTAFEEHHKVKYTPDAIKTAVELSARYINDRKLPDKAI 411

Query: 418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGT 477
           DVIDE GA Q+L P SKR+K IT ++I++ IA+M R I   S S DD  VL +LE++L  
Sbjct: 412 DVIDEVGAMQMLVPPSKRKKTITAREIEQVIATMAR-IPPKSVSSDDKKVLEHLERDLKR 470

Query: 478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLR 537
           +V+GQ++AI+ LSS++K++RAGL DP+KPIG ++FSGPTGVGKTE+++ LA  +G+ L R
Sbjct: 471 LVFGQDKAIEVLSSAMKLSRAGLRDPDKPIGSFLFSGPTGVGKTEVARSLAQIMGIPLQR 530

Query: 538 FDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL 597
           FDMSEYMERH+VSRLIGAPPGYVGF QGG+L D++DQ P+ V+LLDEIEK+HPD+ NILL
Sbjct: 531 FDMSEYMERHSVSRLIGAPPGYVGFDQGGLLTDAIDQQPHCVLLLDEIEKAHPDLFNILL 590

Query: 598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP 657
           Q+MD G LTD  GK + FRNV+LIMTTNAGA +M++  IGFG     DA  EA++   +P
Sbjct: 591 QVMDNGRLTDHHGKTVDFRNVVLIMTTNAGASDMARQGIGFGDVSKADAGDEAVKKMFTP 650

Query: 658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVK 717
           EF NRLD+I+PF  L  +++ +VV KF+++LELQL ++ +   F  +   WL   GYD  
Sbjct: 651 EFRNRLDAIVPFAYLPPEVVSRVVDKFVLQLELQLADQNVHIQFDADARAWLAKKGYDRL 710

Query: 718 MGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNI 776
            GARP+ R+I+E VK PLA+E+LFGKL  GG  V VSL  ++     + FE+  +   +
Sbjct: 711 YGARPMARVIQEKVKKPLAEELLFGKLANGGE-VHVSLKQEEGQEGALSFELTPAAPKL 768


>gi|260429034|ref|ZP_05783011.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Citreicella
           sp. SE45]
 gi|260419657|gb|EEX12910.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Citreicella
           sp. SE45]
          Length = 776

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/759 (59%), Positives = 579/759 (76%), Gaps = 7/759 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R+HE+ATLEHLLLALID+ DAA VM +C+VD + L+  L
Sbjct: 1   MPSFSNTLEQAIHAALALANSRSHEFATLEHLLLALIDEPDAARVMKACSVDTEELRTTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + +ID D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFIDEDLSNLVTDIEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +    V G+    + E      +A  D
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKNPAYGESRP---VTGAQEAEE-ETKATQAEAPQD 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            N   AL  YCVDL  K +KG +D L+GR +E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 177 -NKESALGKYCVDLNSKSRKGDIDPLIGREQEVERCIQVLCRRRKNNPLLVGDPGVGKTA 235

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G  P++L    IFSLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 236 IAEGLARKIVNGDTPEVLSKTTIFSLDMGALLAGTRYRGDFEERLKAVVTELEEHPDAVL 295

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 296 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALSRRFQ 355

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ED ++I+KG+KPYFEEHH ++Y+ +AI++AV+LS R+   RKLPDKAIDVI
Sbjct: 356 KIDVNEPSVEDTVKILKGLKPYFEEHHSIKYTADAIKSAVELSARYINDRKLPDKAIDVI 415

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I++ +A + R I   + S+DD  VL +LEK+L  VV+
Sbjct: 416 DEAGAAQHLVAESKRRKTIGAKEIEEVVAKIAR-IPPKNVSKDDAEVLKDLEKSLKRVVF 474

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 475 GQDPAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLASTLGVELLRFDM 534

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 535 SEYMEKHAVSRLIGAPPGYVGFDQGGQLTDGVDQHPHCVLLLDEIEKAHPDVYNILLQVM 594

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNVILIMT+NAGA E +KA IGFG  R +  D  A+    +PEF 
Sbjct: 595 DHGSLTDHNGRTVDFRNVILIMTSNAGAAEQAKAAIGFGRDRREGEDTAAIERTFTPEFR 654

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  +II  VV KF+++LE QL ++ ++   ++    WL   GYD +MGA
Sbjct: 655 NRLDAVISFQPLPKEIILSVVEKFVLQLEAQLMDRNVTIELTKPAAEWLADKGYDDRMGA 714

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           RPL R+I+E++K PLA+E+LFGKL+K GGVVKV +   K
Sbjct: 715 RPLGRVIQENLKKPLAEELLFGKLQK-GGVVKVGIKDGK 752


>gi|319408391|emb|CBI82046.1| Clp protease subunit [Bartonella schoenbuchensis R1]
          Length = 786

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/753 (60%), Positives = 578/753 (76%), Gaps = 15/753 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+ +LE+VLH+AL +A +  HEYATLEHLLLAL+DD+DA+ V+ +C VDL+ L+  L
Sbjct: 1   MPSFTPSLEEVLHRALTIATQAQHEYATLEHLLLALLDDADASSVIHACQVDLEELRERL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            NYI ++   ++K     + KPT+ FQRV+QRAV+H QS G+  V+GAN+LVA+FSE +S
Sbjct: 61  TNYIQSELDAQIKTD--KDTKPTAFFQRVIQRAVIHAQSAGKDEVSGANVLVAIFSERES 118

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQE  MT YDAV FISHGI +    +     L         +     ND  A   
Sbjct: 119 HAAYFLQEMGMTRYDAVRFISHGIVRDDGLSLLLEDLEEQLDQHVLEN----NDKVAS-- 172

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCV+L  K + GK+D+L+GR  EI+R +Q+LCRRSKNNPL VG+PGVGKTA
Sbjct: 173 -----ALATYCVNLNCKARSGKIDLLIGRDVEISRMMQVLCRRSKNNPLLVGEPGVGKTA 227

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           I EG AK+IVD  VP++LL A IFSLDMG L+AGTRYRGDFEER+K++VKE+E Y  AIL
Sbjct: 228 IVEGLAKRIVDEKVPEVLLNATIFSLDMGGLVAGTRYRGDFEERLKQVVKELEQYPGAIL 287

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ SG  +DA+NLLKPALSSG +RCIGSTTY EYR+ FE D+AL RRFQ
Sbjct: 288 FIDEIHTLIGAGATSGGHMDAANLLKPALSSGMIRCIGSTTYKEYRKIFELDRALTRRFQ 347

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KI+V+EPS+ DAI+I++G+KPYFEE HQ++Y+  A+ A+V+LS R+   R+LPDKAIDVI
Sbjct: 348 KINVNEPSVADAIKILQGLKPYFEEFHQIKYTDAAMIASVELSSRYMADRRLPDKAIDVI 407

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L P  +RRK +  K+I+ TIA+M R I   + S +D  VL NLEK L  VVY
Sbjct: 408 DESGAAQMLLPKKQRRKSVGVKEIESTIAAMAR-IPPKTVSNNDRKVLENLEKELKHVVY 466

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  L SSIK+ARAGL +  KPIG Y+FSGPTGVGKTE++KQLA +LG++LLRFDM
Sbjct: 467 GQDQAIGVLVSSIKLARAGLRESEKPIGSYLFSGPTGVGKTEVAKQLASSLGIELLRFDM 526

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH V+RLIGAPPGYVGF QGG+L D+VDQNP++VVLLDEIEK+HP++ NILLQ+M
Sbjct: 527 SEYMERHTVARLIGAPPGYVGFDQGGLLTDAVDQNPHAVVLLDEIEKAHPELFNILLQVM 586

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           DYG LTD +G+KI FRN+ILIMTTNAGA +M+K+ +GFG    D  D EA+    +PEF 
Sbjct: 587 DYGKLTDHNGRKIDFRNIILIMTTNAGASDMAKSAVGFGKIHRDGDDIEAINKLFTPEFR 646

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF PLS  +I Q+V KFI +LE QL ++GISF  SE  + WL   GYD +MGA
Sbjct: 647 NRLDAIVPFAPLSQLVINQIVQKFIFQLEAQLIDRGISFELSESAMVWLARKGYDAQMGA 706

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKV 753
           RPL R+I+EH+K PLADEILFGKL+  GG+V+V
Sbjct: 707 RPLSRVIQEHIKKPLADEILFGKLRT-GGIVRV 738


>gi|83854838|ref|ZP_00948368.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Sulfitobacter
           sp. NAS-14.1]
 gi|83941361|ref|ZP_00953823.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Sulfitobacter
           sp. EE-36]
 gi|83842681|gb|EAP81848.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Sulfitobacter
           sp. NAS-14.1]
 gi|83847181|gb|EAP85056.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Sulfitobacter
           sp. EE-36]
          Length = 773

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/755 (57%), Positives = 572/755 (75%), Gaps = 10/755 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE+ATLEHLLLALID+ DA  VM +C+VD+  L+  L
Sbjct: 1   MPSFSSTLEQAIHAALALANARKHEFATLEHLLLALIDEPDAVQVMKACSVDMTELRETL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + ++D D +N + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFVDEDLNNLVTDVDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVN+I+HG++K   F   +    V G+    +    V D   K  
Sbjct: 121 NAAYFLQEQDMTRYDAVNYIAHGVAKDPAFGEPRP---VSGAPDHEEEAQGVTDGDKKES 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ Y VDL  K ++G VD L+GR +E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 178 -----ALAKYTVDLNAKSREGDVDPLIGRSDEVERCIQVLCRRRKNNPLLVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G  P++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + NA+L
Sbjct: 233 IAEGLARKIVAGETPEVLAETTIYSLDMGALLAGTRYRGDFEERLKAVVTELEEHDNAVL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+ G +R +GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALAGGKLRTMGSTTYKEFRQHFEKDRALARRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDA++I++GIKPYFE+HH ++Y+ +AIR +V+L+ R+   RKLPD AIDVI
Sbjct: 353 KIDVNEPSVEDAVKILRGIKPYFEDHHSVKYTSDAIRTSVELAHRYINDRKLPDSAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+++  +A + R I   + S+DD  VL +LE +L  VV+
Sbjct: 413 DEAGAAQHLLAASKRRKTIGTKEVEAVVAKIAR-IPPKNVSKDDVIVLKDLEASLKRVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 472 GQDKAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPDV NILLQ+M
Sbjct: 532 SEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEMEKAHPDVYNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNV+LIMT+NAGA E +K  IGFG  R    D  A+    +PEF 
Sbjct: 592 DHGKLTDHNGRTVDFRNVVLIMTSNAGASEQAKEAIGFGRDRRTGEDTAAIERTFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  D+I +VV KF+++LE QL ++ ++   S +   WL   GYD +MGA
Sbjct: 652 NRLDAVISFAPLPKDVILRVVEKFVLQLEAQLMDRNVTIELSTKAAEWLGDKGYDARMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           RPL R+I+EH+K PLA+E+LFGKL K GGVVKV++
Sbjct: 712 RPLGRVIQEHIKKPLAEELLFGKLAK-GGVVKVNV 745


>gi|85704172|ref|ZP_01035275.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Roseovarius
           sp. 217]
 gi|85671492|gb|EAQ26350.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Roseovarius
           sp. 217]
          Length = 778

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/741 (58%), Positives = 561/741 (75%), Gaps = 5/741 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE+ATLEHLLLAL+D+ DAA VM +C+V+ + L+  L
Sbjct: 1   MPSFSNTLEQAIHAALALANARQHEFATLEHLLLALVDEPDAARVMKACSVNTEDLRTTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + +ID+D +N + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFIDDDLANLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +           S  +    D     D
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPAYGEARPVTGATSHDEDSGTKSTETDAVEAGD 180

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL EK +KG +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 181 ----SALAKYCVDLNEKARKGDIDPLIGRDAEVERCIQVLCRRRKNNPLLVGDPGVGKTA 236

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +IV G  P +L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 237 IAEGLAHKIVMGETPRVLSRTTIYSLDMGALLAGTRYRGDFEERLKAVVTELEKHPDAVL 296

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 297 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALARRFQ 356

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++EDA++I+KG+KPYFE+HH ++Y+ +AIR+AV LS R+   RKLPDKAIDVI
Sbjct: 357 KIDVAEPTVEDAVKILKGLKPYFEDHHSVKYTNDAIRSAVDLSARYINDRKLPDKAIDVI 416

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I++ +A + R I   + S++D  VL +LE +L  VV+
Sbjct: 417 DEAGAAQHLLAASKRRKSIGVKEIEEVVAKIAR-IPPKNVSKNDAEVLKDLEASLKRVVF 475

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 476 GQDAAIETLSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 535

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 536 SEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNILLQVM 595

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K+ FRNV+LIMT+NAGA E +K+ IGFG  R +  D  A+    +PEF 
Sbjct: 596 DHGTLTDHNGRKVDFRNVVLIMTSNAGAAEQAKSAIGFGRDRREGEDTAAIERTFTPEFR 655

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL   +I +VV KF+++LE QL ++ ++   +E    WL   GYD KMGA
Sbjct: 656 NRLDAVISFGPLPKSVILKVVEKFVLQLEAQLMDRDVTIELTEPAAEWLAERGYDEKMGA 715

Query: 721 RPLERIIKEHVKVPLADEILF 741
           RPL R+I+EH+K PLA+E+LF
Sbjct: 716 RPLGRVIQEHIKKPLAEELLF 736


>gi|58039079|ref|YP_191043.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Gluconobacter
           oxydans 621H]
 gi|58001493|gb|AAW60387.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Gluconobacter
           oxydans 621H]
          Length = 771

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/748 (57%), Positives = 578/748 (77%), Gaps = 11/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S  LE+ LH+AL  A +R HEYATLEHLLLAL +D DA  V  +C +DL  L+++L +
Sbjct: 1   MLSRTLEQTLHRALTFAGDRRHEYATLEHLLLALTEDDDALTVFRACGIDLDKLRSDLTD 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D D +  L      E KPT++FQRV+QRA +HVQSTGR  VTGAN+LVALF+E +SHA
Sbjct: 61  FLDKDLAG-LAAERPTEPKPTAAFQRVIQRAAIHVQSTGRDEVTGANVLVALFAERESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQ Q+MT  DAVNFISHGI+K  +    +       ++A  D     ++ + + +  
Sbjct: 120 VYFLQLQDMTRLDAVNFISHGIAKAPDRGAGRRP-----AAASKD----TSEREERKESA 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ YCVDL E+ ++G++D L+GR +EI RTIQILCRR+KNNPLYVGDPGVGKTAIA
Sbjct: 171 KEGALATYCVDLNERAREGRIDPLIGRDQEIERTIQILCRRTKNNPLYVGDPGVGKTAIA 230

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IV+G VP++LL + I+SLDMG+L+AGTRYRGDFEER+K +V E++    AIL+I
Sbjct: 231 EGLAKRIVEGDVPEVLLNSTIYSLDMGSLLAGTRYRGDFEERLKAVVTEMDQTPGAILFI 290

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ SG ++DASNLLKPAL++G +RCIGSTTY E+RQ FEKD+ALVRRFQKI
Sbjct: 291 DEIHTVIGAGATSGGAMDASNLLKPALAAGTLRCIGSTTYKEFRQHFEKDRALVRRFQKI 350

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPSIEDA++I++G+K  +E+HH++RY+ EA+R AV+L+ ++   RKLPDKAIDVIDE
Sbjct: 351 DVPEPSIEDAVKILRGLKGSYEKHHKVRYTDEALRGAVELAAKYVHDRKLPDKAIDVIDE 410

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
            GA+++L P +KRRK +T KD+++ IA + R I   S S DD   L +LE++L  +V+GQ
Sbjct: 411 VGAARMLVPENKRRKTVTLKDVEEAIAKIAR-IPPKSVSADDRETLRHLERDLRNMVFGQ 469

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI  L+++IK++RAGL D  KPIG Y+FSGPTGVGKTE++KQLA +LG++L+RFDMSE
Sbjct: 470 DKAIDALAAAIKLSRAGLRDAEKPIGNYLFSGPTGVGKTEVAKQLANSLGIELIRFDMSE 529

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH++SRLIGAPPGYVGF QGG+L D++DQ+P++V+LLDEIEK+HPD+ N+LLQ+MD+
Sbjct: 530 YMERHSISRLIGAPPGYVGFDQGGLLTDAIDQHPHAVLLLDEIEKAHPDLFNVLLQVMDH 589

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +GK + FRNVILIMTTNAGA ++SK  IGFG +     D+EA++   +PEF NR
Sbjct: 590 GRLTDHNGKVVDFRNVILIMTTNAGAADLSKETIGFGRTVRSGEDEEAIKRLFTPEFRNR 649

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+IIPF  L+ + + +VV KF+++LE QL ++ ++   S     WL   GYD   GARP
Sbjct: 650 LDAIIPFANLTPETVGRVVEKFVLQLEAQLADRHVTIEISSSAKEWLAERGYDRLYGARP 709

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           L R+I+EH+K PLA+E+LFG+L +GG V
Sbjct: 710 LGRVIQEHIKKPLAEELLFGRLAQGGAV 737


>gi|148553054|ref|YP_001260636.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Sphingomonas
           wittichii RW1]
 gi|148498244|gb|ABQ66498.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Sphingomonas
           wittichii RW1]
          Length = 771

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/758 (58%), Positives = 575/758 (75%), Gaps = 13/758 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+  LE+ LH AL  A+ R HEYATLEHLLLALI D  A+ VM +C VDL  L+N +
Sbjct: 1   MPSFARELEQTLHNALSAASSRRHEYATLEHLLLALIADEHASKVMTACGVDLSELRNAV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            NY+D +  + LK     +  PTS FQRVVQRA+LHVQS+GR  VTGAN+LVALFSE +S
Sbjct: 61  TNYLDTEL-DALKVEGETDPSPTSGFQRVVQRAILHVQSSGREEVTGANVLVALFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A +FLQ+Q+M+  DAV++ISHG+ K  +    +     +   A +  +G   +      
Sbjct: 120 YAVFFLQQQDMSRLDAVSYISHGVGKAGQPTEQREVKGAEEEKAQAKADGKKGES----- 174

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  +CV+L EK K GKVD L+GR  E++RT+QILCRRSKNNPLYVGDPGVGKTA
Sbjct: 175 -----ALKQFCVNLNEKAKNGKVDPLIGRGPEVDRTVQILCRRSKNNPLYVGDPGVGKTA 229

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G VP++LL A I+SLDMG L+AGTRYRGDFEER+K++V E+E   +A+L
Sbjct: 230 IAEGLARKIVEGDVPEVLLPAVIYSLDMGALLAGTRYRGDFEERLKQVVTELEKLPHAVL 289

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALS G +RCIGSTTY E+R  FEKD+AL+RRFQ
Sbjct: 290 FIDEIHTVIGAGATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFRNHFEKDRALLRRFQ 349

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+IED I+I+ G++  FEEHH ++Y+ +AI+AAV+LS R+ + RK PDKAIDVI
Sbjct: 350 KIDVNEPTIEDTIKIITGLRSAFEEHHNVKYTPDAIKAAVELSSRYISDRKQPDKAIDVI 409

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K IT K+I+  IA+M R I   S S DD  VL  LE +L  VV+
Sbjct: 410 DEVGASQMLVPPNKRKKVITPKEIEAVIATMAR-IPPKSVSTDDKKVLGTLETDLKRVVF 468

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ LSS+IK++RAGL DP+KPIG Y+FSGPTGVGKTE+++QLA  LG+ L RFDM
Sbjct: 469 GQDKAIEVLSSAIKLSRAGLRDPDKPIGNYLFSGPTGVGKTEVARQLASILGIPLQRFDM 528

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH+VSRLIGAPPGYVG+ QGG+L D+VDQ+P+SV+LLDEIEK+HPD+ NILLQ+M
Sbjct: 529 SEYMERHSVSRLIGAPPGYVGYDQGGLLTDAVDQHPHSVLLLDEIEKAHPDLFNILLQVM 588

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GK + FRN ILIMTTNAGA +M++  +GFG+   +  D+EA++   +PEF 
Sbjct: 589 DNGKLTDHHGKTVDFRNTILIMTTNAGASDMARETLGFGNLTREGEDEEAVKKMFTPEFR 648

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF  L ++++ +VV KFI++LELQL ++ +     EE  NWL + GYD   GA
Sbjct: 649 NRLDAIVPFSYLPAEVVARVVEKFILQLELQLADRDVHISLDEEARNWLTAKGYDKLYGA 708

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           RP+ R+I+E +K PLA+E+LFGKL  GG  VKV L  D
Sbjct: 709 RPMGRLIQEKIKQPLAEELLFGKLVHGGE-VKVKLKDD 745


>gi|260576490|ref|ZP_05844480.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhodobacter
           sp. SW2]
 gi|259021373|gb|EEW24679.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhodobacter
           sp. SW2]
          Length = 772

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/759 (59%), Positives = 572/759 (75%), Gaps = 13/759 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE ATLEHLLLALI++ DAA VM +C+VDL VLK  L
Sbjct: 1   MPSFSTTLEQAIHGALALANARRHELATLEHLLLALIEEPDAARVMKACSVDLDVLKKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           +++ID+D S  + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VDFIDDDLSTLVTDVEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGE-GFVNDYQAKT 179
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +     D        E G   D     
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPSYGEPRPVSGADEHMETPKAEAGDAKDS---- 176

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                 ALS YCVDL  K  KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKT
Sbjct: 177 ------ALSKYCVDLNVKAIKGDVDPLIGREAEVERCIQVLCRRRKNNPLLVGDPGVGKT 230

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A +I  G  P+IL  A I+SLDMG L+AGTRYRGDFEER+K +VKE+E + +AI
Sbjct: 231 AIAEGLALKITRGETPEILAHATIYSLDMGALLAGTRYRGDFEERLKAVVKEMEDHPDAI 290

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ F+KD+AL RRF
Sbjct: 291 LFIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFDKDRALSRRF 350

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV+EPS+ED ++I+ G+KPYFEEHH LRY+ +AIR AV+LS R+   RKLPDKAIDV
Sbjct: 351 QKIDVNEPSVEDTVKILMGLKPYFEEHHDLRYTHDAIRTAVELSARYIHDRKLPDKAIDV 410

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA+Q L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LEK+L  VV
Sbjct: 411 IDEAGAAQHLLADSKRRKTIGPKEIEAVVAKIAR-IPPKNVSKDDSEVLRDLEKSLKRVV 469

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ++AI+ L+S+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFD
Sbjct: 470 FGQDKAIEALASAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLASTLGVELLRFD 529

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPDV NILLQ+
Sbjct: 530 MSEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEMEKAHPDVYNILLQV 589

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G+ + FRNV+LIMT+NAGA +++KA IGFG  R    +  A+    +PEF
Sbjct: 590 MDHGKLTDHNGRSVDFRNVVLIMTSNAGAADLAKAAIGFGRDRRQGDNVAAIERTFTPEF 649

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD++I F PL  ++I QVV KF+M+LE QL ++G+    S E   WL   GYD KMG
Sbjct: 650 RNRLDAVINFAPLGREVILQVVEKFVMQLEAQLLDRGVHIELSPEAAAWLGEKGYDDKMG 709

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           ARPL R+I+EH+K PLA+E+LFGKL K GGVV+V +  D
Sbjct: 710 ARPLGRVIQEHIKKPLAEELLFGKLTK-GGVVRVEVVDD 747


>gi|99081932|ref|YP_614086.1| ATP-dependent Clp protease ATP-binding subunit clpA [Ruegeria sp.
           TM1040]
 gi|99038212|gb|ABF64824.1| ATP-dependent Clp protease ATP-binding subunit clpA [Ruegeria sp.
           TM1040]
          Length = 792

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/756 (57%), Positives = 573/756 (75%), Gaps = 5/756 (0%)

Query: 4   FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNY 63
           FS  LE+ +H AL LANER HE+ATLEHLLLAL ++ DAA VM +C+V+L  L++ LL +
Sbjct: 18  FSSTLEQAIHAALALANERRHEFATLEHLLLALTEEPDAARVMRACSVNLDELRSTLLEF 77

Query: 64  IDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHAT 123
           +D D +N + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S A 
Sbjct: 78  VDEDLANLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERESDAA 137

Query: 124 YFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNL 183
           +FLQ+Q+MT YDAVNFI+HG++K   +   +    V G+S   +  G      +      
Sbjct: 138 FFLQDQDMTRYDAVNFIAHGVAKDPAYGENRP---VTGASESEEEIGGGPSMGSPEGEQK 194

Query: 184 FPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAE 243
             AL+ YCVDL  K ++G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTAIAE
Sbjct: 195 ESALAKYCVDLNAKSREGDIDPLIGRDSEVERCIQVLCRRRKNNPLLVGDPGVGKTAIAE 254

Query: 244 GFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYID 303
           G A+++V G VP++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L+ID
Sbjct: 255 GLARKVVQGEVPEVLSETTIYSLDMGALLAGTRYRGDFEERLKAVVTELEEHPDAVLFID 314

Query: 304 EIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKID 363
           EIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL RRFQKID
Sbjct: 315 EIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALSRRFQKID 374

Query: 364 VSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEA 423
           V+EPS+ED+I I+KG+KPYFE+HH ++++ +AI++AV+LS R+   RKLPDKAIDVIDEA
Sbjct: 375 VNEPSVEDSIAILKGLKPYFEDHHSIKFTSDAIKSAVELSARYINDRKLPDKAIDVIDEA 434

Query: 424 GASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQE 483
           GA+Q L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LE +L  VV+GQ+
Sbjct: 435 GAAQHLVAESKRRKTIGVKEIEAVVAKIAR-IPPKNVSKDDAEVLKDLEASLKRVVFGQD 493

Query: 484 EAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEY 543
            AI  LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDMSEY
Sbjct: 494 AAIDALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDMSEY 553

Query: 544 MERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYG 603
           ME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+MD G
Sbjct: 554 MEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNILLQVMDNG 613

Query: 604 ILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRL 663
            LTD +G+ ++FRNV+LIMT+NAGA E++K+ IGFG  R +  D  A+    SPEF NRL
Sbjct: 614 QLTDHNGRTVNFRNVVLIMTSNAGASELAKSAIGFGRDRREGEDTAAIERTFSPEFRNRL 673

Query: 664 DSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPL 723
           D+ I F PL  ++I QVV KF+++LE QL ++ +S   + +   WL   GYD KMGARPL
Sbjct: 674 DATISFGPLPKEVILQVVEKFVLQLEAQLMDRNVSIELTRKAAEWLADKGYDDKMGARPL 733

Query: 724 ERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
            R+I+EH+K PLA+E+LFGKL K GGVV+V +   K
Sbjct: 734 GRVIQEHIKKPLAEELLFGKLSK-GGVVQVGIKDGK 768


>gi|159045479|ref|YP_001534273.1| ATP-dependent Clp protease ATP-binding subunit [Dinoroseobacter
           shibae DFL 12]
 gi|157913239|gb|ABV94672.1| ATP-dependent Clp protease ATP-binding subunit [Dinoroseobacter
           shibae DFL 12]
          Length = 775

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/762 (59%), Positives = 571/762 (74%), Gaps = 14/762 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL  AN R HE ATLEHLLLALID+ DAA VM +CNVDL  L+  L
Sbjct: 1   MPSFSNTLEQAIHTALAQANARRHELATLEHLLLALIDEPDAAKVMKACNVDLDALRQTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             +I+ D +    +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  EAFIEEDLATLATDVEGSEAVPTAAFQRVIQRAAIHVQSSGRQEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   F   +        S  SD E    +  A TD
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKNPSFGESRP------VSGASDME---EEASASTD 171

Query: 181 LN---LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG 237
                   AL+ YCVDL  K +KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVG
Sbjct: 172 QGGDEKESALAKYCVDLNAKSRKGDVDPLIGRDSEVERCIQVLCRRRKNNPLLVGDPGVG 231

Query: 238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN 297
           KTAIAEG A++IV G  P++L GA I+SLDMG L+AGTRYRGDFEER+K +V E+E + +
Sbjct: 232 KTAIAEGLARKIVQGETPEVLRGATIYSLDMGALLAGTRYRGDFEERLKAVVTELEDHPD 291

Query: 298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR 357
           A+L+IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL R
Sbjct: 292 AVLFIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALSR 351

Query: 358 RFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI 417
           RFQKIDV+EPS+ED ++I+KG+KPYFE+HH ++Y+ +AI+ AV+LS R+   RKLPDKAI
Sbjct: 352 RFQKIDVTEPSVEDTVKILKGLKPYFEDHHAIKYTSDAIKTAVELSARYINDRKLPDKAI 411

Query: 418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGT 477
           DVIDEAGA+Q L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LE +L  
Sbjct: 412 DVIDEAGAAQHLVAESKRRKTIGAKEIEAVVAKIAR-IPPKNVSKDDAEVLKDLEVSLKR 470

Query: 478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLR 537
           VV+GQ+ AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQL+  LGV+LLR
Sbjct: 471 VVFGQDNAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLSSTLGVELLR 530

Query: 538 FDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL 597
           FDMSEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILL
Sbjct: 531 FDMSEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVYNILL 590

Query: 598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP 657
           Q+MD+G LTD +G+ + FRNVILIMT+NAGA E +KA IGFG  R +  D  A+    +P
Sbjct: 591 QVMDHGTLTDHNGRTVDFRNVILIMTSNAGAAEQAKAAIGFGRDRREGEDTAAIERTFTP 650

Query: 658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVK 717
           EF NRLD++I F PL  +II QVV KF+++LE QL ++ ++   SEE    L   GYD K
Sbjct: 651 EFRNRLDAVISFAPLGKEIIMQVVEKFVLQLEAQLLDRNVTIELSEEAATLLGDMGYDDK 710

Query: 718 MGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           MGARPL R+I+E +K PLA+E+LFGKL K GG+VKV +   K
Sbjct: 711 MGARPLGRVIQEQIKKPLAEELLFGKLAK-GGIVKVGVKDGK 751


>gi|149202407|ref|ZP_01879380.1| ATP-dependent Clp protease ATP-binding subunit clpA [Roseovarius
           sp. TM1035]
 gi|149144505|gb|EDM32536.1| ATP-dependent Clp protease ATP-binding subunit clpA [Roseovarius
           sp. TM1035]
          Length = 763

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/744 (58%), Positives = 568/744 (76%), Gaps = 6/744 (0%)

Query: 16  LVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNG 75
           + LAN R HE+ATLEHLLLAL+D+ DAA V+ +C+V+ + L+  L+ +ID+D +N + + 
Sbjct: 1   MALANARQHEFATLEHLLLALVDEPDAARVLKACSVNTEELRTTLVEFIDDDLANLVTDI 60

Query: 76  FRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYD 135
              E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S+A YFLQEQ+MT YD
Sbjct: 61  EGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERESNAAYFLQEQDMTRYD 120

Query: 136 AVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLT 195
           AVNFI+HG++K   +   +    V G+S+  +G+G     +         AL+ YCVDL 
Sbjct: 121 AVNFIAHGVAKDPAYGESRP---VTGASS-QEGDGAAKSTETDAVEAGDSALAKYCVDLN 176

Query: 196 EKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVP 255
           EK +KG +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTAIAEG A +IV G  P
Sbjct: 177 EKARKGDIDPLIGRDAEVERCIQVLCRRRKNNPLLVGDPGVGKTAIAEGLAHKIVQGETP 236

Query: 256 DILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSAS 315
            +L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L+IDEIHT++GAG+ S
Sbjct: 237 RVLSRTTIYSLDMGALLAGTRYRGDFEERLKAVVTELEKHPDAVLFIDEIHTVIGAGATS 296

Query: 316 GISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEI 375
           G ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL RRFQKIDV+EP++EDA++I
Sbjct: 297 GGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALARRFQKIDVAEPTVEDAVKI 356

Query: 376 VKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKR 435
           +KG+KPYFE+HH ++Y+ EAIR+AV LS R+   RKLPDKAIDVIDEAGA+Q L   SKR
Sbjct: 357 LKGLKPYFEDHHSVKYTNEAIRSAVDLSARYINDRKLPDKAIDVIDEAGAAQHLLAASKR 416

Query: 436 RKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKI 495
           RK I  K+I++ +A + R I   + S++D  VL +LE  L  VV+GQ+ AI+ LSS+IK+
Sbjct: 417 RKSIGVKEIEEVVAKIAR-IPPKNVSKNDAEVLKDLEGTLKRVVFGQDAAIEALSSAIKL 475

Query: 496 ARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGA 555
           ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDMSEYME+HAVSRLIGA
Sbjct: 476 ARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDMSEYMEKHAVSRLIGA 535

Query: 556 PPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISF 615
           PPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+MD+G LTD +G+K+ F
Sbjct: 536 PPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNILLQVMDHGTLTDHNGRKVDF 595

Query: 616 RNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSD 675
           RNV+LIMT+NAGA E +K+ IGFG  R +  D  A+    +PEF NRLD++I F  L   
Sbjct: 596 RNVVLIMTSNAGAAEQAKSAIGFGRDRREGEDTAAIERTFTPEFRNRLDAVISFGALPKS 655

Query: 676 IIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPL 735
           +I +VV KF+++LE QL ++ ++   ++    WL   GYD KMGARPL R+I+EH+K PL
Sbjct: 656 VILKVVEKFVLQLEAQLMDRDVTIELTQAAAEWLADKGYDDKMGARPLARVIQEHIKKPL 715

Query: 736 ADEILFGKLKKGGGVVKVSLNPDK 759
           A+E+LFGKL K GGVV V +  +K
Sbjct: 716 AEELLFGKLLK-GGVVTVGVKDNK 738


>gi|254294359|ref|YP_003060382.1| ATP-dependent Clp protease ATP-binding subunit clpA [Hirschia
           baltica ATCC 49814]
 gi|254042890|gb|ACT59685.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Hirschia
           baltica ATCC 49814]
          Length = 769

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/787 (56%), Positives = 587/787 (74%), Gaps = 18/787 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M   + +LE+ L +AL LA++R HEYATLEHLL AL +D DA+ VM +C +D+  L+ +L
Sbjct: 1   MPSMTPSLERALEKALHLASDRKHEYATLEHLLFALTEDEDASEVMRACKLDIDKLRGDL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +Y+D + ++ + +       PT++FQRVVQRAVLHV+S+GR  VTGAN+LV++F+E +S
Sbjct: 61  NDYMDEELNSIVVDDDE-HVHPTAAFQRVVQRAVLHVESSGRDEVTGANVLVSIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQ Q+MT YDAVN+ISHG++K+   +  +    VDG  AG D +  V        
Sbjct: 120 HAAYFLQAQDMTRYDAVNYISHGVAKKPGMSRSRP---VDG--AGEDKDETVK------- 167

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            +   AL AYCVDL EK + GK D L+GR  E++R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 168 -SGGEALQAYCVDLNEKARSGKTDPLIGRQLEVDRCIQVLCRRRKNNPLLVGDPGVGKTA 226

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVDG  P+IL  + I+SLDMG L+AGTRYRGDFEER+K++VKE+E    ++L
Sbjct: 227 IAEGLAKRIVDGEAPEILGESIIYSLDMGALLAGTRYRGDFEERLKQVVKELEEQPRSVL 286

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL SG +RC+GSTTY EYRQ  EKD+AL RRFQ
Sbjct: 287 FIDEIHTVIGAGATSGGAMDASNLLKPALQSGELRCMGSTTYKEYRQHIEKDRALARRFQ 346

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP++ D+I+I++G+K  FE+ H LRY+ +AI+ AV+L+ RH T RKLPDKAIDVI
Sbjct: 347 KIDVVEPTVADSIKILQGLKSRFEDFHGLRYTNDAIKTAVELAARHITDRKLPDKAIDVI 406

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGASQ LQP SKRRK I  K+I++ IA M R I +   ++ D+  L ++  +L  VVY
Sbjct: 407 DEAGASQWLQPESKRRKQIGTKEIEQVIAKMAR-IPSKQVNKTDEQALKSISADLKRVVY 465

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  +S +IK+ARAGL + NKPIG Y+FSGPTGVGKTE+++QLA  LGV+LLRFDM
Sbjct: 466 GQDDAIAAVSDAIKLARAGLREANKPIGSYLFSGPTGVGKTEVARQLASILGVELLRFDM 525

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVG+ QGG+L D VDQ+P+ V+LLDEIEK+HP++ NILLQ+M
Sbjct: 526 SEYMERHTVSRLIGAPPGYVGYDQGGLLTDGVDQHPHCVLLLDEIEKAHPELFNILLQVM 585

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +GKKI FRNVILIMTTNAGA + +K  IGFG  + +  D+EA++   +PEF 
Sbjct: 586 DNGSLTDSNGKKIDFRNVILIMTTNAGASDAAKEAIGFGRGKREGEDEEAIKKLFTPEFR 645

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF PL  ++I +VV KFI++LE QL ++ +    +++   WL   GYD   GA
Sbjct: 646 NRLDAIVPFSPLGEEVISRVVDKFILQLEGQLSDRNVDIVLTDKARAWLAERGYDKDYGA 705

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RPL R+I+EHVK P+A+E+LFGKLKKGG    V+++ D   +  + F  E      S ++
Sbjct: 706 RPLSRVIQEHVKKPMAEELLFGKLKKGG---VVTIDVDIKDTKKLAFIYEEDTPKSSKKS 762

Query: 781 EEKEVED 787
           EE E+ D
Sbjct: 763 EEPELTD 769


>gi|163868097|ref|YP_001609301.1| Clp protease subunit [Bartonella tribocorum CIP 105476]
 gi|161017748|emb|CAK01306.1| Clp protease subunit [Bartonella tribocorum CIP 105476]
          Length = 783

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/788 (57%), Positives = 603/788 (76%), Gaps = 19/788 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+ +LE+VLH+AL +A +  HEYATLEHLLLAL+DD+DA  V+ +C VD++ L+  L
Sbjct: 1   MPSFTPSLEEVLHRALTIATQARHEYATLEHLLLALLDDADANSVIQACQVDVEELRERL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            NY+ ++   ++  G   + KPT+ FQRV+QRAV+H QS G+  V+GAN+LVA+FSE +S
Sbjct: 61  TNYLRSELDEQI--GADEDTKPTAFFQRVIQRAVIHAQSAGKDEVSGANVLVAIFSERES 118

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDG-EGFVNDYQAKT 179
           HA YFLQE  MT YDAV FISH I++             DG S   +G E  ++   +  
Sbjct: 119 HAAYFLQEMGMTRYDAVRFISHSITRD------------DGLSMLLEGLEEQLDQQISDN 166

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
              +  AL++YCVDL  K + GK+D+L+GR  EI+R IQILCRRSKNNPL VGDPGVGKT
Sbjct: 167 GERITSALTSYCVDLNCKARNGKIDLLIGREREISRMIQILCRRSKNNPLLVGDPGVGKT 226

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AI EG AK+IVDG VP++L  A IFSLDMG L+AGTRYRGDFEER+K+++KE E Y +AI
Sbjct: 227 AIIEGLAKRIVDGQVPEVLSNATIFSLDMGGLVAGTRYRGDFEERLKQVIKEFELYPDAI 286

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHTL+GAG+  G ++DA+NLLKPALSSGA+RCIG+TTY EYR+FFE+D+AL RRF
Sbjct: 287 LFIDEIHTLIGAGATLGGNMDAANLLKPALSSGAMRCIGATTYREYRKFFEQDRALERRF 346

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKID++EPS+ DAI+I++G+KPYFE+ HQ++Y+ +A++A+V+LS R+   R+LPDKAID+
Sbjct: 347 QKIDINEPSVSDAIKILQGMKPYFEDFHQIKYTDQAMKASVELSSRYMVDRRLPDKAIDI 406

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDE+GA+Q + P  +R+K I  K+I+ TIA++ R I + + SR+D  +LS LE+ L  VV
Sbjct: 407 IDESGAAQKILPQKQRKKTIGVKEIEATIATIAR-IPSKTVSRNDQKILSKLERELKHVV 465

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           YGQ++AI  L SSIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LG++LLRFD
Sbjct: 466 YGQDQAISVLVSSIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGIELLRFD 525

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERH V+RLIGAPPGY+GF QGG+L D+VDQ P++V+LLDEIEK+HP++ NILLQ+
Sbjct: 526 MSEYMERHTVARLIGAPPGYIGFDQGGLLTDAVDQKPHAVLLLDEIEKAHPELFNILLQV 585

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MDYG LTD +GKKI FRN+ILI+TTNAGA +M+K+ IGFG    D  D EA+    +PEF
Sbjct: 586 MDYGRLTDHNGKKIDFRNIILILTTNAGASDMAKSAIGFGKVHRDGEDIEAINRLFTPEF 645

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+IIPF PLS   I Q+V KFI +LE QL ++ I F  S     WL + GYD +MG
Sbjct: 646 RNRLDAIIPFAPLSHLSINQIVQKFIFQLEAQLADREICFELSPSATLWLSNKGYDSQMG 705

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLE 779
           ARPL R+I+E++K PLADEILFGKL + GG+V+V     KS       ++E S S++S+ 
Sbjct: 706 ARPLGRVIQEYIKKPLADEILFGKL-RNGGIVRVLTQ--KSNGEKERLQLEISSSDLSVG 762

Query: 780 TEEKEVED 787
           +++ ++++
Sbjct: 763 SKKSKIKN 770


>gi|114769424|ref|ZP_01447050.1| Chaperonin clpA/B [alpha proteobacterium HTCC2255]
 gi|114550341|gb|EAU53222.1| Chaperonin clpA/B [alpha proteobacterium HTCC2255]
          Length = 771

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/759 (57%), Positives = 568/759 (74%), Gaps = 12/759 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE  +H +L  A +RNHE ATLEHLLLALID+ +A+ VM +C V L  L+  L
Sbjct: 1   MPTFSSSLENAIHASLAYATQRNHELATLEHLLLALIDEPNASRVMRACAVSLDELRAKL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            ++++N+  + + N   V+  PT++FQRV+QR+V+HVQS+ +  VTGAN+LVA+F+E +S
Sbjct: 61  THFLENELDSLVTNLEGVDATPTTAFQRVIQRSVIHVQSSSKQEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQEMT YDAVNFI+HG++K     +      V GS   +D +  ++D      
Sbjct: 121 HAAYFLQEQEMTRYDAVNFIAHGVAKD---PSMNEPREVTGSEEFNDQDEEISDADET-- 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL  +  +G +D L+GR  E+ R IQILCRR KNNP+ VGDPGVGKTA
Sbjct: 176 -----ALAKYCVDLNHQASEGNIDPLIGRSHEVERCIQILCRRRKNNPILVGDPGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I+ G  P+IL    I+SLDMG+L+AGT+YRGDFEER+K +++E+E + +A+L
Sbjct: 231 IAEGLAVKIISGETPEILSETTIYSLDMGSLLAGTKYRGDFEERLKSVMRELEDHPDAVL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY EYRQ FEKD+AL RRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEYRQHFEKDRALARRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP+IED I I+KG+K  FE+HH ++YS +AI+ AV+LS R+   RKLPDKAIDVI
Sbjct: 351 KIDVIEPNIEDTINILKGLKSRFEQHHDVKYSMDAIKTAVELSARYINDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGASQ L   SKRRK +  K+I+  IA + R I   + SRDD  +L  L+ +L  VV+
Sbjct: 411 DEAGASQRLVVASKRRKSLGVKEIEDVIAKLAR-IPAKNISRDDAELLRELDASLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L+S+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+L+RFDM
Sbjct: 470 GQDPAIDALASAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELIRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HA+SRLIGAPPGYVGF QGG+L D VDQNP+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 530 SEYMEKHAISRLIGAPPGYVGFDQGGLLTDGVDQNPHCVLLLDEIEKAHPDVFNILLQVM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+   FRNVILIMT+NAGA E +K  IGFG  R +  D  A+    SPEF 
Sbjct: 590 DHGKLTDHNGRSTDFRNVILIMTSNAGATEQAKEAIGFGRDRREGEDTAAIERTFSPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F PLS ++I +VV KF+++LE QL ++ ++F  S E  +WL   GYD KMGA
Sbjct: 650 NRLDATISFAPLSKEVIIKVVDKFVLQLEAQLMDRNVTFELSSEAASWLADKGYDDKMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           RPL R+I+EH+K PLA+E+LFGKL K GG+VKV L  DK
Sbjct: 710 RPLARVIQEHLKKPLAEELLFGKLSK-GGLVKVHLKDDK 747


>gi|85375462|ref|YP_459524.1| ATPase [Erythrobacter litoralis HTCC2594]
 gi|84788545|gb|ABC64727.1| ATPase [Erythrobacter litoralis HTCC2594]
          Length = 792

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/750 (58%), Positives = 575/750 (76%), Gaps = 10/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F++NLEK LH A+  A ER HEYATLEHLLLAL+ D DA  VM +C VDL+ L + +
Sbjct: 1   MPSFAQNLEKTLHAAIDSARERRHEYATLEHLLLALVADEDATEVMTACGVDLEELSSVV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D +  + L+     E +PT+ FQRV+QRA+LHVQS+G+  VTGAN+LVALFSE DS
Sbjct: 61  KAYLDQEYQS-LQTEEGSEPQPTAGFQRVIQRAILHVQSSGKDTVTGANVLVALFSERDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+M+  DAV+FISHGI K  +    +S+     +  GSD EG   D ++   
Sbjct: 120 YAVYFLQQQDMSRLDAVSFISHGIGKGGK--QLESR-----APQGSD-EGQAEDSKSDGG 171

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  + V+L +K + G++D L+GR  E++RT+QILCRRSKNNPLYVGDPGVGKTA
Sbjct: 172 NKKETALDQFTVNLNKKAEDGRIDPLIGRGPEVDRTVQILCRRSKNNPLYVGDPGVGKTA 231

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G VP++L  A I+SLDMG L+AGTRYRGDFEER+K++V E+E    AIL
Sbjct: 232 IAEGLARKIVEGDVPEVLEDAVIYSLDMGALLAGTRYRGDFEERLKQVVSELEKMPEAIL 291

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALS G +RCIGSTTY E+R  FEKD+AL+RRFQ
Sbjct: 292 FIDEIHTVIGAGATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFRNHFEKDRALLRRFQ 351

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+IED ++I+KG+K  FE+HH+++Y+ +A++ AV+LS R+   RKLPDKAIDV+
Sbjct: 352 KIDVNEPTIEDTVKILKGLKSAFEDHHKVKYTLDALKTAVELSARYINDRKLPDKAIDVV 411

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA Q+L P S+R+K IT K+I++ IA+M R I   S S+DD   L NLE++L  VV+
Sbjct: 412 DEVGAMQMLVPPSRRKKKITAKEIEQVIATMAR-IPPKSVSKDDKKALENLERDLKHVVF 470

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ A+KKLS+++K++RAGL DP+KPIG ++FSGPTGVGKTE+++QLA  +G++L RFDM
Sbjct: 471 GQDPAVKKLSTAMKLSRAGLRDPDKPIGSFLFSGPTGVGKTEVARQLASIMGIELKRFDM 530

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH+VSRLIGAPPGYVG+ QGG+L D+VDQNP+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 531 SEYMERHSVSRLIGAPPGYVGYDQGGLLTDAVDQNPHCVLLLDEIEKAHPDLFNILLQVM 590

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GK + FRNV+LIMTTNAGA +M++  IGFG    +DA +EA++   +PEF 
Sbjct: 591 DNGRLTDHHGKTVDFRNVVLIMTTNAGAADMARQGIGFGDVSKEDASEEAVKRMFTPEFR 650

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF  L  D + +VV KFI++LELQL E+ +   F  +   WL   GYD   GA
Sbjct: 651 NRLDAIVPFGYLGKDTVARVVDKFILQLELQLAEQNVDIQFDADARAWLADKGYDRLYGA 710

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RP+ R+++E +K PLA+E+LFGKL  GG V
Sbjct: 711 RPMGRLLQEKIKQPLAEELLFGKLADGGEV 740


>gi|119386519|ref|YP_917574.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Paracoccus
           denitrificans PD1222]
 gi|119377114|gb|ABL71878.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Paracoccus
           denitrificans PD1222]
          Length = 772

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/766 (58%), Positives = 576/766 (75%), Gaps = 15/766 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ +H AL LANE  HE ATLEHLLLAL ++ DA  VM +CNVDL  L+  L
Sbjct: 1   MPSFSTSLEQAIHAALALANEHRHELATLEHLLLALTEEPDAVKVMRACNVDLDELRRML 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + +I++D S  + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFIEDDLSTLITDVEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A +FLQE +MT YDAVNFI+HG++K   F+      N     A    +      QAK +
Sbjct: 121 NAAFFLQELDMTRYDAVNFIAHGVAKNPSFSE-----NRPVQGAEQQDQAQAETAQAKDE 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL +K  KG VD L+GR +E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 176 ----SALAKYCVDLNKKAAKGDVDPLIGRADEVERCIQVLCRRRKNNPLLVGDPGVGKTA 231

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G  PD+L G+ IFSLDMG L+AGTRYRGDFEER+K +VKE+E + +AIL
Sbjct: 232 IAEGLALKITRGETPDVLAGSTIFSLDMGALLAGTRYRGDFEERLKAVVKELEDHPDAIL 291

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+ G +RC+GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 292 FIDEIHTVIGAGATSGGAMDASNLLKPALAGGKLRCMGSTTYKEFRQHFEKDRALSRRFQ 351

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ D I+I+ G+KP FE+HH LRY+ +AI+ AV+LS R+   RKLPDKAIDVI
Sbjct: 352 KIDVNEPTVPDTIKILMGLKPSFEKHHDLRYTNDAIKMAVELSARYIHDRKLPDKAIDVI 411

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I+  +A + R I   S S+DD +VL +L+  L  +V+
Sbjct: 412 DEAGAAQHLVAESKRRKTIGPKEIEAVVAKIAR-IPPKSVSKDDAAVLKDLDATLKRLVF 470

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 471 GQDAAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLASTLGVELLRFDM 530

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 531 SEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVYNILLQVM 590

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+++ FRNVILIMT+NAGA + +KA  GFG  R +  D  A+    +PEF 
Sbjct: 591 DHGKLTDHNGRQVDFRNVILIMTSNAGAADQAKAAFGFGRERREGEDTAAIERTFTPEFR 650

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PLS +II QVV KF+++LE QL ++G+    + E  +WL   GYD KMGA
Sbjct: 651 NRLDAVISFAPLSREIIVQVVEKFVLQLEAQLIDRGVHIELTAEAADWLAERGYDEKMGA 710

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIF 766
           RPL R+I+E +K PLA+E+LFG+L K GGVV+V +  DK    P+F
Sbjct: 711 RPLGRVIQETIKKPLAEELLFGRLTK-GGVVRVRIEDDK----PVF 751


>gi|89069066|ref|ZP_01156447.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Oceanicola
           granulosus HTCC2516]
 gi|89045435|gb|EAR51500.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Oceanicola
           granulosus HTCC2516]
          Length = 776

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/756 (58%), Positives = 578/756 (76%), Gaps = 7/756 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE ATLEHLLLALID+ DAA VM +C+VDL  L+  L
Sbjct: 1   MPSFSTTLEQSIHAALALANARRHELATLEHLLLALIDEPDAARVMKACSVDLDELRRAL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             +I++D +  +      E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  DEFIEDDLATLVTEVEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ Q+MT YDAVNFI+HG++K   +   +    V G+++  + E  VN   +  D
Sbjct: 121 NAAYFLQAQDMTRYDAVNFIAHGVAKDPAYGESRP---VQGAASDPEEE-TVNASSSDGD 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCVDL  K KKG VD L+GR  E+ R +Q+LCRR KNNPL VGDPGVGKTA
Sbjct: 177 -EKESALGKYCVDLNSKAKKGDVDPLIGRELEVERCVQVLCRRRKNNPLLVGDPGVGKTA 235

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+  VP++L GA IFSLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 236 IAEGLARKIVNDEVPEVLSGATIFSLDMGALLAGTRYRGDFEERLKAVVTELEDHPDAVL 295

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 296 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALSRRFQ 355

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ED+I+I+KG+KPYFEEHH ++Y+ +AI+ AV+LS R+   RKLPDKAIDVI
Sbjct: 356 KIDVTEPTVEDSIKILKGLKPYFEEHHAIKYTSDAIKTAVELSARYINDRKLPDKAIDVI 415

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  ++I+  +A + R I   + S+DD  VL +LE +L  VV+
Sbjct: 416 DEAGAAQHLVAESKRRKTIGPREIEAVVAKIAR-IPPKNVSKDDAEVLKDLEGSLKRVVF 474

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQL+  LGV++LRFDM
Sbjct: 475 GQDPAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLSQILGVEMLRFDM 534

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 535 SEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVYNILLQVM 594

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNVILIMT+NAGA E +KA IGFG  R +  D  A+    +PEF 
Sbjct: 595 DHGKLTDHNGRTVDFRNVILIMTSNAGASEQAKAAIGFGRDRREGEDTAAIERTFTPEFR 654

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  D I QVV KF+++LE QL ++G+S   ++E   WL   GYD +MGA
Sbjct: 655 NRLDAVISFAPLPKDTILQVVEKFVLQLEAQLMDRGVSIELTDEAAVWLADKGYDDRMGA 714

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLN 756
           RPL R+I+E++K PLA+E+LFGKL K GG+V+V++ 
Sbjct: 715 RPLGRVIQEYIKKPLAEELLFGKLAK-GGLVRVAVK 749


>gi|254454634|ref|ZP_05068071.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Octadecabacter
           antarcticus 238]
 gi|198269040|gb|EDY93310.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Octadecabacter
           antarcticus 238]
          Length = 773

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/750 (58%), Positives = 562/750 (74%), Gaps = 9/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE ATLEHLLLALID+ DAA VM +C+VDL  L+  L
Sbjct: 1   MPSFSTTLEQSIHSALALANARKHELATLEHLLLALIDEPDAARVMKACSVDLAELRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            ++I++D S  + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  EDFIEDDLSTLVTDVEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+MT YDAVNFI+HG++K   F   +    V G+    D      +      
Sbjct: 121 NAAYFLQDQDMTRYDAVNFIAHGVAKDPAFGESRP---VTGAPTLDDDADTAEETSKDES 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL  K +KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 178 -----ALAKYCVDLNVKAQKGDVDPLIGRDHEVERCIQVLCRRRKNNPLLVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+  VP++L    I+SLDMG L+AGTRYRGDFEER+K ++ E+E + +A+L
Sbjct: 233 IAEGLARKIVESQVPEVLANTTIYSLDMGALLAGTRYRGDFEERLKAVMTELEDHDDAVL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+ G +RC+GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 293 FIDEIHTIIGAGATSGGAMDASNLLKPALAGGKLRCMGSTTYKEFRQHFEKDRALARRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ED+I+I+KGIK YFE+HHQ++Y+ +AI++AV+LS R+   RKLPDKAIDVI
Sbjct: 353 KIDVNEPSVEDSIKILKGIKVYFEDHHQIKYTADAIKSAVELSARYINDRKLPDKAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I+  +A + R I   + S+ D  VL +LE  L  VV+
Sbjct: 413 DEAGAAQHLVAESKRRKTIGIKEIEAVVAKIAR-IPPKNVSKGDAEVLKDLESALKRVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 472 GQDDAIVALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+H++SRLIGAPPGYVGF QGG+L D VDQNP+ V+LLDE+EK+HPDV NILLQ+M
Sbjct: 532 SEYMEKHSISRLIGAPPGYVGFDQGGMLTDGVDQNPHCVLLLDEMEKAHPDVYNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+   FRNVI+IMTTNAGA EM+K  IGFG  R    D  A+    +PEF 
Sbjct: 592 DNGKLTDHNGRTTDFRNVIIIMTTNAGASEMAKEAIGFGRERRTGEDTAAIERTFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+++ F PL  ++I QVV KF+++LE QL ++ +S   +     WL   GYD KMGA
Sbjct: 652 NRLDAVVSFAPLGKEVILQVVEKFVLQLEAQLMDRNVSIELTRPAAEWLADKGYDDKMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RPL R I+E++K PLA+E+LFG L KGG V
Sbjct: 712 RPLGRTIQEYIKKPLAEELLFGALAKGGHV 741


>gi|240850300|ref|YP_002971693.1| endopeptidase Clp ATP-binding chain A [Bartonella grahamii as4aup]
 gi|240267423|gb|ACS51011.1| endopeptidase Clp ATP-binding chain A [Bartonella grahamii as4aup]
          Length = 783

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/757 (59%), Positives = 581/757 (76%), Gaps = 23/757 (3%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+ +LE+VLH+AL +A +  HEYATLEHLLLAL+DD+DA  V+ +C VD++ L+  L
Sbjct: 1   MPSFTPSLEEVLHRALTIATQARHEYATLEHLLLALLDDADANSVIQACQVDVEELRERL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            NY+ ++   +++     + KPT+ FQRV+QRAV+H QS G+  V+GAN+LVA+FSE +S
Sbjct: 61  TNYLRSELDEQIRAD--EDTKPTAFFQRVIQRAVIHAQSAGKDEVSGANVLVAIFSERES 118

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFA----NFQSKLNVDGSSAGSDGEGFVNDYQ 176
           HA YFLQE  MT YDAV FISHGI++    +      + +L+   S  G  G        
Sbjct: 119 HAAYFLQEMGMTRYDAVRFISHGITRDDGLSMLLEGLEEQLDQQISDNGERGTS------ 172

Query: 177 AKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGV 236
                    AL+ YCVDL  K   GK+D+L+GR  EI+R IQILCRRSKNNPL VGDPGV
Sbjct: 173 ---------ALTNYCVDLNCKALNGKIDLLIGREIEISRMIQILCRRSKNNPLLVGDPGV 223

Query: 237 GKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYA 296
           GKTAI EG AK+IVDG VP++L  A IFSLDMG L+AGTRYRGDFEER+K+++KE E Y 
Sbjct: 224 GKTAIIEGLAKRIVDGQVPEVLSNATIFSLDMGGLVAGTRYRGDFEERLKQVIKEFELYP 283

Query: 297 NAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALV 356
           +AIL+IDEIHTL+GAG+  G ++DA+NLLKP LSSG +RCIGSTTY EYR+FFE+D+AL 
Sbjct: 284 DAILFIDEIHTLIGAGATLGGNMDAANLLKPVLSSGTMRCIGSTTYREYRKFFEQDRALE 343

Query: 357 RRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKA 416
           RRFQKID++EPS+ DAI+I++G+KPYFE+ HQ++Y+ +A++A+V+LS R+   R+LPDKA
Sbjct: 344 RRFQKIDINEPSVTDAIKILQGMKPYFEDFHQIKYTDQAMKASVELSSRYIIDRRLPDKA 403

Query: 417 IDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLG 476
           ID+IDE+GA+Q L P  +R+K I  K+I+ T+A++ R I   + SR+D  +LS LE+ L 
Sbjct: 404 IDIIDESGAAQKLLPQKQRKKSIGVKEIEATVATIAR-IPPKTVSRNDQKILSKLERELK 462

Query: 477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLL 536
            VVYGQ++AI  L SSIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LG++LL
Sbjct: 463 HVVYGQDQAISVLVSSIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGIELL 522

Query: 537 RFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNIL 596
           RFDMSEYMERH V+RLIGAPPGY+GF QGG+L D+VDQ P++V+LLDEIEK+HP++ NIL
Sbjct: 523 RFDMSEYMERHTVARLIGAPPGYIGFDQGGLLTDAVDQKPHAVLLLDEIEKAHPELFNIL 582

Query: 597 LQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLS 656
           LQ+MDYG LTD +GKKI FRNVILIMTTNAGA +M+K+ IGFG    D  D EA+    +
Sbjct: 583 LQVMDYGRLTDHNGKKIDFRNVILIMTTNAGASDMAKSAIGFGKVHRDGEDIEAINRLFT 642

Query: 657 PEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDV 716
           PEF NRLD+IIPF PLS  II Q+V KFI +LE QL ++GI F  S     WL + GYD 
Sbjct: 643 PEFRNRLDAIIPFAPLSHLIINQIVQKFIFQLEAQLADRGICFELSPSATLWLSNKGYDS 702

Query: 717 KMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKV 753
           +MGARPL R+I+E++K PLADEILFGKL+  GG+V+V
Sbjct: 703 QMGARPLGRVIQEYIKKPLADEILFGKLRN-GGIVRV 738


>gi|126725796|ref|ZP_01741638.1| ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Rhodobacterales bacterium HTCC2150]
 gi|126705000|gb|EBA04091.1| ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Rhodobacterales bacterium HTCC2150]
          Length = 775

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/759 (58%), Positives = 579/759 (76%), Gaps = 8/759 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS+ LE  +H AL  ANER HEYATLEHLLLAL+D++DA  VM +C V+L+ L+  L
Sbjct: 1   MPSFSKTLENAIHMALSEANERQHEYATLEHLLLALLDETDAIRVMQACGVNLEQLRGTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + +ID D +  + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  IEFIDEDLATLIADQDGSEAVPTAAFQRVIQRAAIHVQSSGRNEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A +FLQEQEMT YDAVNFI+HG++K  ++   +S    D      + +G     + ++ 
Sbjct: 121 NAAFFLQEQEMTRYDAVNFIAHGVAKDPQYGEQRSISGSDDPLEEHEMQGSGGKEEKES- 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL EK  KG VD L+GR+ E+ R +Q+LCRR KNNPL VGDPGVGKTA
Sbjct: 180 -----ALAKYCVDLNEKATKGDVDPLIGRNHEVERCVQVLCRRRKNNPLLVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I+ G  P++L  A I+SLDMG L+AGTRYRGDFEER+K ++ E+E + +A+L
Sbjct: 235 IAEGLAFKIIKGETPEVLQNATIYSLDMGALLAGTRYRGDFEERLKAVMDEMEEHPDAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALSRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ED I+I++GIK YFE+HH ++Y+ +AI+ AV+LS R+ T RKLPDKAIDVI
Sbjct: 355 KIDVNEPSVEDTIKILRGIKTYFEQHHSIKYTADAIKVAVELSARYITDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L P S+RRK I  K+I++ +A + R I   + S+DD  VL +LE +L  VV+
Sbjct: 415 DEAGAAQHLIPESRRRKTIGVKEIEEVVAKIAR-IPPKTVSKDDAEVLRDLEGSLKRVVF 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 474 GQDDAIDALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPDV NILLQ+M
Sbjct: 534 SEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEMEKAHPDVYNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNV+LIMT+NAGA EM+KA IGFG  R +  D  A+    +PEF 
Sbjct: 594 DHGKLTDHNGRTVDFRNVVLIMTSNAGASEMAKAAIGFGRERREGEDTAAIEKTFTPEFR 653

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PLS ++I QVV KF+++LE QL ++ ++   S +   WL   GYD KMGA
Sbjct: 654 NRLDAVISFDPLSKEVILQVVEKFVLQLEAQLLDRNVAIELSRDAAIWLADRGYDDKMGA 713

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           RPL R+I+EH+K PLA+E+LFG L K GG+VKV +   K
Sbjct: 714 RPLSRVIQEHIKKPLAEELLFGTLAK-GGLVKVGVKDKK 751


>gi|49474300|ref|YP_032342.1| endopeptidase Clp ATP-binding chain a [Bartonella quintana str.
           Toulouse]
 gi|49239804|emb|CAF26194.1| Endopeptidase clp ATP-binding chain a [Bartonella quintana str.
           Toulouse]
          Length = 783

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/781 (58%), Positives = 587/781 (75%), Gaps = 24/781 (3%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+ +LE+VLH+AL +A +  HEYATLEHLLLAL+DD+DA  V+ +C VD++ L+  L
Sbjct: 1   MPSFTPSLEEVLHRALTIATQARHEYATLEHLLLALLDDADANSVIRACQVDVEELRERL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YI ++   +++     + KPT+ FQRV+QRAV+H QS G+  V+GAN+LVA+FSE +S
Sbjct: 61  TSYIQSELDAQIRAN--EDTKPTTFFQRVIQRAVIHAQSAGKDEVSGANVLVAIFSERES 118

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSD-GEGFVNDYQAKT 179
           HA YFLQE  MT YD V FISH +++    +     L        SD GE          
Sbjct: 119 HAAYFLQEMGMTRYDVVRFISHSVTRDDGLSMLLEDLEEQLDQQISDNGE---------- 168

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
             N+  AL+AYCVDL  K + GKVD+L+GR  EI+R IQ+LCRRSKNNPL VGDPGVGKT
Sbjct: 169 --NVTSALTAYCVDLNCKARNGKVDLLIGREAEISRMIQVLCRRSKNNPLLVGDPGVGKT 226

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AI EG AK+IVD  VP+IL  A IFSLDMG L+AGTRYRGDFEER+K+I+KE E Y + +
Sbjct: 227 AIVEGLAKRIVDRQVPEILSNATIFSLDMGGLVAGTRYRGDFEERLKQIIKEFEQYPDGV 286

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHTL+GAG+  G ++DA+NLLKPALSSG +RCIGST Y EYR+ FE+D+AL RRF
Sbjct: 287 LFIDEIHTLIGAGATLGGNMDAANLLKPALSSGTIRCIGSTIYREYRRIFEQDRALERRF 346

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDVSEPS+ DAI+I++G+KPYFE+ HQ++Y+ EA++A+V+LS R+   R+LPDKAIDV
Sbjct: 347 QKIDVSEPSVVDAIKILQGLKPYFEDFHQIKYTDEAMKASVELSSRYMIDRRLPDKAIDV 406

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           +DE+GA+Q L P  +R+K I  K+I+ T+A+M R I   + S +D  +LS LE+ L  VV
Sbjct: 407 VDESGAAQKLLPKKQRKKSIGVKEIEATVAAMAR-IPPKTVSSNDQKMLSKLERELKHVV 465

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           YGQ++AI  L SSIK+ARAGL + +KPIG Y+FSGPTGVGKTE++KQLA +LG++LLRFD
Sbjct: 466 YGQDQAISALVSSIKLARAGLRESDKPIGSYLFSGPTGVGKTEVAKQLASSLGIELLRFD 525

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERH V+RLIGAPPGY+GF QGG+L D+VDQ P++V+LLDEIEK+HP++ NILLQ+
Sbjct: 526 MSEYMERHTVARLIGAPPGYIGFDQGGLLTDAVDQRPHAVLLLDEIEKAHPELFNILLQV 585

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MDYG LTD +GKKI FRN+ILIMTTNAGA +M+K+ IGFG+++ D  D E +    +PEF
Sbjct: 586 MDYGKLTDHNGKKIDFRNIILIMTTNAGASDMAKSAIGFGNAQRDGDDIETINRLFTPEF 645

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+IIPF PLS  II Q+V KFI +LE QL ++ I F  S   + WL + GYD +MG
Sbjct: 646 RNRLDAIIPFAPLSQLIINQIVQKFIFQLEAQLADRRICFELSPSAMVWLANKGYDSQMG 705

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD--------KSASSPIFFEIEN 771
           ARPL RII+EH+K PLADEILFGKL+ GG V  ++  P         K +SS +   ++N
Sbjct: 706 ARPLGRIIQEHIKKPLADEILFGKLRNGGMVRVLTHKPSGEKEKLQLKISSSDVSVNLKN 765

Query: 772 S 772
           S
Sbjct: 766 S 766


>gi|85709773|ref|ZP_01040838.1| ATPase [Erythrobacter sp. NAP1]
 gi|85688483|gb|EAQ28487.1| ATPase [Erythrobacter sp. NAP1]
          Length = 801

 Score =  903 bits (2334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/750 (58%), Positives = 570/750 (76%), Gaps = 9/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F++NLE+ LH AL  A+ER HEYATLEHLLLALIDD D A VM +C VDL  L   +
Sbjct: 1   MPSFAQNLERTLHNALAHASERRHEYATLEHLLLALIDDEDGAQVMAACGVDLAELGEVV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D +  + LK     + +PT+ FQRV+QRA+LHVQS+G+  VTGAN+LVALFSE DS
Sbjct: 61  KQYLDQEYQS-LKTEEDADPQPTAGFQRVIQRAILHVQSSGKDTVTGANVLVALFSERDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+M+  DAV++ISHGI K       +SK    GS   +       D  +K +
Sbjct: 120 YAVYFLQQQDMSRLDAVSYISHGIGKGGR--QLESKAP-QGSEEAAAETEQAKDAGSKKE 176

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  + V+L +K + G++D L+GR  E++RT+QILCRRSKNNPLYVGDPGVGKTA
Sbjct: 177 T----ALDQFTVNLNKKAEDGRIDPLIGRGPEVDRTVQILCRRSKNNPLYVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G VP++L  A I+SLDMG L+AGTRYRGDFEER+K++V E+E   +AIL
Sbjct: 233 IAEGLARKIVEGDVPEVLAEAVIYSLDMGALLAGTRYRGDFEERLKQVVSELEGMPHAIL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY E+R  FEKD+AL+RRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEFRNHFEKDRALLRRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+IED ++I+KG++  FE+HH ++Y+ +A++ AV+LS R+   RKLPDKAIDVI
Sbjct: 353 KIDVNEPTIEDTVKILKGLRSAFEDHHNVKYTPDALKTAVELSARYINDRKLPDKAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA Q+L P S+R+K IT K+I+  IA+M R I   S S+DD   L NL ++L  VV+
Sbjct: 413 DEVGAMQMLVPPSRRKKKITAKEIEAVIATMAR-IPPKSVSKDDKKALENLSRDLKHVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+EAI +LS+++K++RAGL DP+KPIG ++FSGPTGVGKTE+++QLA  +G++L RFDM
Sbjct: 472 GQDEAITRLSTAMKLSRAGLRDPDKPIGSFLFSGPTGVGKTEVARQLASIMGIELKRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH+VSRLIGAPPGYVG+ QGG+L D+VDQNP+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 532 SEYMERHSVSRLIGAPPGYVGYDQGGLLTDAVDQNPHCVLLLDEIEKAHPDLFNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GK + FRNV+LIMTTNAGA +M+K+ IGFG    +DA  EA+    +PEF 
Sbjct: 592 DNGRLTDHHGKTVDFRNVVLIMTTNAGAADMAKSGIGFGDVSKEDAGTEAVNKMFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF  L    + +VV KFI++LELQL E+ +   F  +   WL   GYD   GA
Sbjct: 652 NRLDAIVPFAYLGKSTVARVVDKFILELELQLAEQNVHIQFDSDARAWLADKGYDRLYGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RP+ R+I++ +K PLA+E+LFGKL  GG V
Sbjct: 712 RPMGRLIQDKIKQPLAEELLFGKLADGGEV 741


>gi|254485980|ref|ZP_05099185.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Roseobacter
           sp. GAI101]
 gi|214042849|gb|EEB83487.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Roseobacter
           sp. GAI101]
          Length = 773

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/744 (57%), Positives = 559/744 (75%), Gaps = 9/744 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE+ATLEHLLLALID+ DA  VM +C+VD+  L+  L
Sbjct: 1   MPSFSSTLEQAIHSALALANARRHEFATLEHLLLALIDEPDAVQVMKACSVDMTELRETL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + ++D D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFVDEDLSNLVTDVDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   F   +    + G+    +    V +   K  
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPAFGEPRP---ISGAPEHEEEAQGVTEGDKKES 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCVDL  K ++G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 178 -----ALEKYCVDLNAKSREGDIDPLIGRDAEVERCIQVLCRRRKNNPLLVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G  P++L    IFSLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 233 IAEGLARKIVAGETPEVLSKTTIFSLDMGALLAGTRYRGDFEERLKAVVTELEEHKDAVL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+ G +R +GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALAGGKLRTMGSTTYKEFRQHFEKDRALARRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDA++I++GIKPYFEEHH ++Y+ +AIR +V+L+ R+   RKLPD AIDVI
Sbjct: 353 KIDVNEPSVEDAVKILRGIKPYFEEHHSVKYTADAIRTSVELAHRYINDRKLPDSAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+++  +A + R I   + S+DD  VL +LE +L  VV+
Sbjct: 413 DEAGAAQHLIAASKRRKTIGTKEVEAVVAKIAR-IPPKNVSKDDVVVLKDLEASLKRVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 472 GQDAAIDALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPDV NILLQ+M
Sbjct: 532 SEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEMEKAHPDVYNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNV+LIMT+NAGA E +K  IGFG  R    D  A+    +PEF 
Sbjct: 592 DHGKLTDHNGRTVDFRNVVLIMTSNAGASEQAKEAIGFGRDRRTGEDTAAIERTFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL   +I +VV KF+++LE QL ++ ++   S +   WL   GYD KMGA
Sbjct: 652 NRLDAVISFAPLPKAVIMRVVEKFVLQLEAQLMDRNVTIELSTKAAEWLADKGYDEKMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKL 744
           RPL R+I+EH+K PLA+E+LFGKL
Sbjct: 712 RPLGRVIQEHIKKPLAEELLFGKL 735


>gi|326386213|ref|ZP_08207837.1| ATP dependent Clp protease [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209438|gb|EGD60231.1| ATP dependent Clp protease [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 784

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/760 (58%), Positives = 575/760 (75%), Gaps = 13/760 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+++LEK LH AL  A+ER+HEYATLEHLLLALIDD DA+ VM +C VDL  L + +
Sbjct: 1   MPSFAQSLEKTLHAALANASERSHEYATLEHLLLALIDDPDASQVMQACGVDLGDLGDVV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D +  + LK   + + +PT+ FQRV+QRA+LHVQS+G+  VTGAN+LVALFSE DS
Sbjct: 61  RQYLDQEYQS-LKTQEKADPQPTAGFQRVIQRAILHVQSSGKDTVTGANVLVALFSERDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSS--AGSDGEGFVNDYQAK 178
           +A YFLQ+Q+M+  DAV++ISHGI K            VDG +     +      + Q  
Sbjct: 120 YAVYFLQQQDMSRLDAVSYISHGIGK--------GGRQVDGRTPKGAEEEAPKPEEKQET 171

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                  AL  +CV+L EK   GKVD L+GR  E++RTIQILCRRSKNNPLYVGDPGVGK
Sbjct: 172 KGAKKDSALDQFCVNLNEKALVGKVDPLIGRGPEVDRTIQILCRRSKNNPLYVGDPGVGK 231

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A++IV+G VP++L  A I+SLDMG+L+AGTRYRGDFEER+K++V E+E   +A
Sbjct: 232 TAIAEGLARKIVEGEVPEVLSNAVIYSLDMGSLLAGTRYRGDFEERLKQVVSELEKMPHA 291

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHT++GAG+ SG ++DASNLLKPALS G +RCIGSTTY E+R  FEKD+AL+RR
Sbjct: 292 ILFIDEIHTVIGAGATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFRNHFEKDRALLRR 351

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV+EPS+ED I+I+KG++  FEEHH+++Y+ EAI+ AV+LS R+   RKLPDKAID
Sbjct: 352 FQKIDVNEPSVEDTIKILKGLRTAFEEHHKVKYTPEAIKTAVELSARYINDRKLPDKAID 411

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDE GA Q+L P SKR+K IT ++I+  IA+M R I   S S DD  VL +LE++L  +
Sbjct: 412 VIDEVGAMQMLVPPSKRKKTITAREIEAVIATMAR-IPPKSVSSDDKKVLEHLERDLKRM 470

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ++AI+ L+S++K++RAGL DP+KPIG ++FSGPTGVGKTE+++ LA  +G+ L RF
Sbjct: 471 VFGQDKAIEVLASAMKLSRAGLRDPDKPIGSFLFSGPTGVGKTEVARSLANIMGIPLQRF 530

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH+VSRLIGAPPGYVGF QGG+L D++DQ P+ V+LLDEIEK+HPD+ NILLQ
Sbjct: 531 DMSEYMERHSVSRLIGAPPGYVGFDQGGLLTDAIDQQPHCVLLLDEIEKAHPDLYNILLQ 590

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD G LTD  GK + FRNV+LIMTTNAGA +M+K  IGFG    +DA  +A++   +PE
Sbjct: 591 VMDNGRLTDHHGKTVDFRNVVLIMTTNAGASDMAKQGIGFGDVSKEDAGDDAVKRLFTPE 650

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+I+PF  L ++++ +VV KFI++LELQL ++ +   F  +   WL   GYD   
Sbjct: 651 FRNRLDAIVPFAYLPAEVVSRVVDKFILQLELQLADQNVHIQFDSDARAWLAKKGYDRLY 710

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           GARP+ R+I+E VK PLA+E+LFG L  GG  V VSL  D
Sbjct: 711 GARPMARVIQEKVKKPLAEELLFGTLANGGE-VHVSLKDD 749


>gi|116519|sp|P05444|CLPA_RHOBL RecName: Full=ClpA homolog protein
 gi|45972|emb|CAA77308.1| URF 2 [Rhodobacter blasticus]
          Length = 793

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/755 (59%), Positives = 570/755 (75%), Gaps = 11/755 (1%)

Query: 4   FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNY 63
           FS  LE+ +H AL LAN R HE ATLEHLLLALID+ DAA VM +C+VDL+ LK  L ++
Sbjct: 25  FSSTLEQAIHAALALANARRHELATLEHLLLALIDEPDAARVMKACSVDLEDLKKTLTDF 84

Query: 64  IDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHAT 123
           ID+D S  + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S+A 
Sbjct: 85  IDDDLSTLVTSVEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERESNAA 144

Query: 124 YFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNL 183
           YFLQEQ+MT YDAVNFI+HG++K   +   +     D        E      +AK     
Sbjct: 145 YFLQEQDMTRYDAVNFIAHGVAKDPSYGESRPVQGADEPQETPKAEA----GEAKES--- 197

Query: 184 FPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAE 243
             ALS YCVDL  K +KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTAIAE
Sbjct: 198 --ALSKYCVDLNIKARKGDVDPLIGREAEVERAIQVLCRRRKNNPLLVGDPGVGKTAIAE 255

Query: 244 GFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYID 303
           G A +I+   VP++L GA IFSLDMG L+AGTRYRGDFEER+K +VKE+E + +AIL+ID
Sbjct: 256 GLAWKIIKKEVPEVLSGATIFSLDMGALLAGTRYRGDFEERLKAVVKELEDHPDAILFID 315

Query: 304 EIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKID 363
           EIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL RRFQKID
Sbjct: 316 EIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALSRRFQKID 375

Query: 364 VSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEA 423
           V+EPS+ DAI+I+ G+KP+FEEHH+LRY+ +AI++AV+L+ R+   RKLPD AIDVIDEA
Sbjct: 376 VNEPSVPDAIKILMGLKPHFEEHHELRYTADAIKSAVELASRYINDRKLPDSAIDVIDEA 435

Query: 424 GASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQE 483
           GA+Q L   SKR+K +  K+I+  +A + R I   + S+DD   L +LE+ L  +V+GQ+
Sbjct: 436 GAAQHLVSDSKRKKVLGTKEIEAVVAKIAR-IPPRNVSKDDAETLRDLERTLKRLVFGQD 494

Query: 484 EAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEY 543
           +AI+ LS+SIK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDMSEY
Sbjct: 495 KAIEALSASIKLARAGLREPEKPIGNYLFTGPTGVGKTEVAKQLAATLGVELLRFDMSEY 554

Query: 544 MERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYG 603
           ME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+MD+G
Sbjct: 555 MEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEIEKAHPDVYNILLQVMDHG 614

Query: 604 ILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRL 663
            LTD +G+ + FRNVILIMT+N GA +M+K  IGFG  R    D  A+    +PEF NRL
Sbjct: 615 KLTDHNGRAVDFRNVILIMTSNVGAADMAKEAIGFGRERRTGEDTAAVERTFTPEFRNRL 674

Query: 664 DSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPL 723
           D++I F PL  +II QVV KF+++LE QL ++ +    + E   WL   GYD KMGARPL
Sbjct: 675 DAVISFAPLGREIILQVVEKFVLQLEAQLIDRNVHIELTPEAAAWLGEKGYDDKMGARPL 734

Query: 724 ERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
            R+I+EH+K PLA+E+LFGKL K GG+VKV +  D
Sbjct: 735 GRVIQEHIKKPLAEELLFGKLTK-GGLVKVGVKDD 768


>gi|163737811|ref|ZP_02145228.1| ATP-dependent Clp protease ATP-binding subunit clpA [Phaeobacter
           gallaeciensis BS107]
 gi|161389337|gb|EDQ13689.1| ATP-dependent Clp protease ATP-binding subunit clpA [Phaeobacter
           gallaeciensis BS107]
          Length = 773

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/759 (58%), Positives = 575/759 (75%), Gaps = 10/759 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LANER HE+ATLEHLLLAL+D+ +AA VM +C+VDL  L+  L
Sbjct: 1   MPSFSSTLEQAIHAALALANERRHEFATLEHLLLALLDEPEAARVMRACSVDLTELRATL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + ++D D +N + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFVDEDLANLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
            A YFLQ+Q+MT YDAVNFI+HG++K   F   +    V GS    D      +   K  
Sbjct: 121 DAAYFLQDQDMTRYDAVNFIAHGVAKDPAFGESRP---VSGSPEVEDEPQPTTEGDKKES 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL EK ++G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 178 -----ALAKYCVDLNEKSREGDIDPLIGRSHEVERCIQVLCRRRKNNPLLVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G  P++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 233 IAEGLARKIVAGETPEVLSETTIYSLDMGALLAGTRYRGDFEERLKAVVTELEDHPDAVL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALSRRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ED+IEI+KG+KPYFE+HH +R++ +AI++AV+LS R+   RKLPDKAIDVI
Sbjct: 353 KIDVNEPSVEDSIEILKGLKPYFEDHHGIRFTSDAIKSAVELSARYINDRKLPDKAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LE++L  VV+
Sbjct: 413 DEAGAAQHLVVESKRRKTIGVKEIEAVVAKIAR-IPPKNVSKDDAEVLKDLERSLKRVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 472 GQDAAIDALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 532 SEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+ ++FRNV+LIMT+NAGA E +KA IGFG  R +  D  A+    +PEF 
Sbjct: 592 DNGQLTDHNGRTVNFRNVVLIMTSNAGASEQAKAAIGFGRDRREGEDTAAIERTFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  D+I QVV KF+++LE QL ++ +S   + +   WL   GYD +MGA
Sbjct: 652 NRLDAVISFAPLPKDVILQVVEKFVLQLEAQLMDRNVSIELTRKAAEWLADKGYDDRMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           RPL R+I+EH+K PLA+E+LFGKL K GG+VKV +   K
Sbjct: 712 RPLGRVIQEHIKKPLAEELLFGKLAK-GGLVKVGIKDGK 749


>gi|121602591|ref|YP_988888.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Bartonella
           bacilliformis KC583]
 gi|120614768|gb|ABM45369.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Bartonella
           bacilliformis KC583]
          Length = 788

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/750 (58%), Positives = 579/750 (77%), Gaps = 14/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+ +LE+VLH+AL +A +  HEYATLEHLLLAL+DD+DA+ V+ +C V+++ L+  L
Sbjct: 1   MPSFTPSLEEVLHRALTIATQAQHEYATLEHLLLALLDDADASSVICACQVNVEELRERL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           ++YI ++   +++     + KPT  FQRV+QRAV+H QS G+  V+GAN+LVA+FSE +S
Sbjct: 61  ISYIQSELDAQIRAD--QDTKPTVFFQRVIQRAVIHAQSAGKDEVSGANVLVAIFSERES 118

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQE  MT YDAV FISHGI +    +     L           +   N+ +  + 
Sbjct: 119 HAAYFLQEIGMTRYDAVRFISHGIVRDDGLSLLLEDLEEHLDQ-----QDLENNEKVPS- 172

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 LS YCV+L  K + G +D L+GR  E++R IQILCRRSKNNPL VGDPGVGKTA
Sbjct: 173 -----VLSTYCVNLNCKARSGNIDSLIGRDTEVSRMIQILCRRSKNNPLLVGDPGVGKTA 227

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           I EG AK+IVDG VP++L  A IFSLD+G L++GTRYRGDFEER+K++V+E+E Y +A+L
Sbjct: 228 IVEGLAKRIVDGQVPEVLSNATIFSLDIGGLLSGTRYRGDFEERLKQVVRELEQYPDAVL 287

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ SG ++DA+NLLKP LSSG +RCIGSTTY EYR+ FE+D+AL RRFQ
Sbjct: 288 FIDEIHTLIGAGATSGGNMDAANLLKPGLSSGNIRCIGSTTYREYRKIFEQDRALERRFQ 347

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ DAI+I++G+KPYFE+ HQ++Y+ EA+RA+V+LS R+   R+LPDKAIDV+
Sbjct: 348 KIDVNEPSVADAIKILQGLKPYFEDFHQIKYTDEAMRASVELSSRYIADRRLPDKAIDVV 407

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE+GA+Q+L P  +R+K I  K+I+  IA++ R + + + SRD+  +LSNLEK L  V+Y
Sbjct: 408 DESGAAQMLLPKKQRKKSIGVKEIESIIAAIAR-VPSKTVSRDERKLLSNLEKELKHVIY 466

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  L SSIK+ARAGL +P KPIG Y+FSGPTGVGKTE++KQLA +LG++LLRFDM
Sbjct: 467 GQDQAITALVSSIKLARAGLREPEKPIGNYLFSGPTGVGKTEVAKQLASSLGIELLRFDM 526

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH V+RLIGAPPGYVGF QGG+L D+VDQ P++VVLLDEIEK+HP++ +ILLQ+M
Sbjct: 527 SEYMERHTVARLIGAPPGYVGFDQGGLLTDAVDQKPHAVVLLDEIEKAHPELFSILLQVM 586

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           DYG LTD +GKKI FRN+ILIMTTNAGA +M K+ IGFGS   D  D EA+    +PEF 
Sbjct: 587 DYGKLTDNNGKKIDFRNIILIMTTNAGAADMEKSAIGFGSVHRDGDDIEAINRLFTPEFR 646

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++IPF PLS  +I Q+V KFI +LE QL ++G++F  S   + WL + GY+ +MGA
Sbjct: 647 NRLDAVIPFTPLSQLVINQIVQKFIFQLEAQLVDRGVTFELSTSAMMWLANKGYNAQMGA 706

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RPL R+I+EH+K PLADEILFGKL+ GG V
Sbjct: 707 RPLSRVIQEHIKKPLADEILFGKLRNGGMV 736


>gi|110680700|ref|YP_683707.1| ATP-dependent Clp protease, ATP-binding subunit ClpA, putative
           [Roseobacter denitrificans OCh 114]
 gi|109456816|gb|ABG33021.1| ATP-dependent Clp protease, ATP-binding subunit ClpA, putative
           [Roseobacter denitrificans OCh 114]
          Length = 773

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/744 (57%), Positives = 562/744 (75%), Gaps = 9/744 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE+ATLEHLLLALID+ DA+ VM +C+VD   L+  L
Sbjct: 1   MPSFSTTLEQAIHSALALANARRHEFATLEHLLLALIDEPDASRVMKACSVDTDDLRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + ++D D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFVDEDLSNLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +    V G+    +    V D + K  
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPAYGEPRP---VSGAPEAEEETQGVTDGEKKES 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCVDL  K ++G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 178 -----ALEKYCVDLNAKSREGDIDPLIGRDSEVERCIQVLCRRRKNNPLLVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G  P++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 233 IAEGLARKIVAGETPEVLAKTTIYSLDMGALLAGTRYRGDFEERLKAVVSELEDHKDAVL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+ G +R +GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALAGGKLRTMGSTTYKEFRQHFEKDRALSRRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDA++I++G+KPYFE+HH ++Y+ +AI+ +V+L+ R+   RKLPD AIDVI
Sbjct: 353 KIDVNEPSVEDAVKILRGLKPYFEDHHAVKYTADAIKTSVELASRYINDRKLPDSAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   +KRRK I  K+I+  +A + R I   + S+DD  VL +LE +L  VV+
Sbjct: 413 DEAGAAQHLIVAAKRRKTIGTKEIENVVAKIAR-IPPKNVSKDDAEVLKDLEGSLKRVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ  AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 472 GQNAAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPDV NILLQ+M
Sbjct: 532 SEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEMEKAHPDVYNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNV+LIMT+NAGA E +K  IGFG  R +  D  A+    +PEF 
Sbjct: 592 DHGKLTDHNGRTVDFRNVVLIMTSNAGAAEQAKEAIGFGRDRREGEDTAAIERTFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  ++I +VV KF+++LE QL ++ ++   ++    WL   GYD KMGA
Sbjct: 652 NRLDAVISFAPLPKEVILRVVEKFVLQLEAQLMDRNVTIELTKPAAEWLADKGYDAKMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKL 744
           RPL R+I+EH+K PLA+++LFGKL
Sbjct: 712 RPLGRVIQEHIKKPLAEDLLFGKL 735


>gi|114797928|ref|YP_759752.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Hyphomonas
           neptunium ATCC 15444]
 gi|114738102|gb|ABI76227.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Hyphomonas
           neptunium ATCC 15444]
          Length = 771

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/756 (57%), Positives = 573/756 (75%), Gaps = 15/756 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M   S +LE  L +AL+LA+ER+HEYATLEHLLLAL +D  A  VM +C VD++ L+ +L
Sbjct: 1   MPRLSPSLETALEKALMLASERDHEYATLEHLLLALTEDEHAREVMGACKVDIEALRGDL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             YID + S+ + +      +PT++FQRVVQRA+LHV+S+GR  VTGAN+LV++FSE +S
Sbjct: 61  TRYIDEELSSLIVDDSEGRVQPTAAFQRVVQRAILHVESSGREEVTGANVLVSIFSERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVNFISHG++K+   +   +    + S      +G          
Sbjct: 121 HAAYFLQEQDMTRYDAVNFISHGVAKQPGMSRPSTPRGAEASEEEPVKQGH--------- 171

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCV+L  K + GK+D L+GR  E+NR I++LCRR+KNNP+ VGDPGVGKTA
Sbjct: 172 ----EALDTYCVNLNAKARAGKIDPLIGRDMEVNRCIEVLCRRNKNNPILVGDPGVGKTA 227

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IVDG  P+IL  A I+SLDMG L+AGTRYRGDFEER+K ++KE+E    AIL
Sbjct: 228 IAEGLAKRIVDGEAPEILDDAIIWSLDMGALLAGTRYRGDFEERLKSVMKELEQQEKAIL 287

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL SG +RC+GSTT+ EY+Q FEKD+AL RRF+
Sbjct: 288 FIDEIHTIIGAGATSGGAMDASNLLKPALQSGGLRCMGSTTFKEYKQHFEKDRALSRRFR 347

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP++ D I+I+ G+K  FE+ H L+Y+ +AI+AAV+LS R+ T RKLPDKAIDV+
Sbjct: 348 KIDVVEPTVPDTIKILTGLKSKFEDFHGLKYTNDAIKAAVELSDRYITDRKLPDKAIDVV 407

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L P SKR+K +  +DI+  +A + R I     + DD + L +L+ +L  VV+
Sbjct: 408 DEAGAAQWLLPASKRKKTVGIRDIEAVVAKIAR-IPPKQVTSDDAAALKSLDADLKRVVF 466

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+EAI+ L++SIK+ARAGL +PNKPIG Y+F+GPTGVGKTE++KQLA  +GV++LRFDM
Sbjct: 467 GQDEAIEALAASIKLARAGLREPNKPIGSYLFTGPTGVGKTEVAKQLASIMGVEMLRFDM 526

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVG+ +GG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 527 SEYMERHTVSRLIGAPPGYVGYDEGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 586

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+K+ FRNVI+IMTTNAGA + +K  IGFG  + D+  +EAL+   +PEF 
Sbjct: 587 DNGALTDANGRKVDFRNVIVIMTTNAGASDAAKNSIGFGRGKKDEEQEEALKRMFTPEFR 646

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L+  II +VV KFI++LE+QL+++ +S   S+    WL   G+D +MGA
Sbjct: 647 NRLDAIVTFGGLTPQIIDRVVEKFILQLEVQLEDRNVSIEVSKPAREWLAKRGFDAEMGA 706

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLN 756
           RPL R I+E VK P+A+E+LFG+L+K GGVVK+ LN
Sbjct: 707 RPLSRTIQEFVKKPMAEELLFGQLQK-GGVVKIDLN 741


>gi|254474645|ref|ZP_05088031.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Ruegeria sp.
           R11]
 gi|214028888|gb|EEB69723.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Ruegeria sp.
           R11]
          Length = 773

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/759 (58%), Positives = 576/759 (75%), Gaps = 10/759 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LANER HE+ATLEHLLLAL+D+ +AA VM +C+VDL  L+  L
Sbjct: 1   MPSFSSTLEQAIHAALALANERRHEFATLEHLLLALLDEPEAARVMRACSVDLSELRATL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + +ID D +N + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFIDEDLANLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
            A YFLQ+Q+MT YDAVNFI+HG++K   F   +   +V GS    + +    D   K  
Sbjct: 121 DAAYFLQDQDMTRYDAVNFIAHGVAKDPAFGETR---HVSGSPEIEEEQQATTDGDKKES 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL  K ++G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 178 -----ALAKYCVDLNAKSREGDIDPLIGRSHEVERCIQVLCRRRKNNPLLVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G  P++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 233 IAEGLARKIVAGETPEVLANTTIYSLDMGALLAGTRYRGDFEERLKAVVTELEEHPDAVL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALSRRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+ED+I+I+KG+KPYFE+HH ++++ +AI++AV+LS R+   RKLPDKAIDVI
Sbjct: 353 KIDVNEPSVEDSIQILKGLKPYFEDHHGIKFTSDAIKSAVELSARYINDRKLPDKAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LE++L  VV+
Sbjct: 413 DEAGAAQHLVAESKRRKTIGVKEIEAVVAKIAR-IPPKNVSKDDAEVLKDLERSLKRVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 472 GQDAAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 532 SEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+ ++FRNV+LIMT+NAGA E +KA IGFG  R +  D  A+    SPEF 
Sbjct: 592 DNGQLTDHNGRTVNFRNVVLIMTSNAGASEQAKAAIGFGRDRREGEDTAAIERTFSPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F  L  ++I QVV KF+++LE QL ++ +S   + +   WL   GYD +MGA
Sbjct: 652 NRLDAVISFGALPKEVILQVVEKFVLQLEAQLMDRNVSIELTRKAAEWLADKGYDDRMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           RPL R+I+EH+K PLA+E+LFGKL K GG+VKV +   K
Sbjct: 712 RPLGRVIQEHIKKPLAEELLFGKLSK-GGLVKVGIKDGK 749


>gi|126734140|ref|ZP_01749887.1| ATP-dependent Clp protease, ATP-binding subunit ClpA, putative
           [Roseobacter sp. CCS2]
 gi|126717006|gb|EBA13870.1| ATP-dependent Clp protease, ATP-binding subunit ClpA, putative
           [Roseobacter sp. CCS2]
          Length = 759

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/740 (58%), Positives = 560/740 (75%), Gaps = 11/740 (1%)

Query: 16  LVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNG 75
           + LANER HE ATLEHLLLALID+ DAA VM +C+V+L  L+ +L  +I++D S  + + 
Sbjct: 1   MALANERKHELATLEHLLLALIDEPDAARVMRACSVNLDDLRKDLEGFIEDDLSTLITDV 60

Query: 76  FRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYD 135
              E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S+A YFLQEQ+MT YD
Sbjct: 61  EGSEAVPTAAFQRVIQRAAIHVQSSGRSEVTGANVLVAIFAERESNAAYFLQEQDMTRYD 120

Query: 136 AVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLT 195
           AVNFI+HG++K   F   +    V GS+   +GE        + +     AL+ YCVDL 
Sbjct: 121 AVNFIAHGVAKDPAFGEARP---VTGST--EEGETIAPGEADEKE----SALAKYCVDLN 171

Query: 196 EKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVP 255
            K  KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTAIAEG A +IV+G  P
Sbjct: 172 AKATKGDVDPLIGRAHEVERCIQVLCRRRKNNPLLVGDPGVGKTAIAEGLAFKIVNGETP 231

Query: 256 DILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSAS 315
           ++L  A I+SLDMG L+AGTRYRGDFEER+K ++ E+E + +A+L+IDEIHT++GAG+ S
Sbjct: 232 EVLSKATIYSLDMGALLAGTRYRGDFEERLKAVMTEMEEHPDAVLFIDEIHTVIGAGATS 291

Query: 316 GISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEI 375
           G ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL RRFQKIDV+EPS+ D+I+I
Sbjct: 292 GGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALSRRFQKIDVTEPSVPDSIKI 351

Query: 376 VKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKR 435
           ++G+KPYFEEHH ++Y+ +AI+ AV+LS R+   RKLPDKAIDVIDEAGA+Q L   SKR
Sbjct: 352 LQGLKPYFEEHHSIKYTADAIKTAVELSARYINDRKLPDKAIDVIDEAGAAQHLVAESKR 411

Query: 436 RKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKI 495
           RK I  K+I+  +A + R I   + S+DD  VL +LEK+L  VV+GQ+ AI+ LSS+IK+
Sbjct: 412 RKTIGAKEIENVVAKIAR-IPPKNVSKDDAEVLKDLEKSLKRVVFGQDTAIEALSSAIKL 470

Query: 496 ARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGA 555
           ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+L+RFDMSEYME+HAVSRLIGA
Sbjct: 471 ARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELMRFDMSEYMEKHAVSRLIGA 530

Query: 556 PPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISF 615
           PPGYVGF QGG+L D VDQNP+ V+LLDE+EK+HPDV NILLQ+MD+G LTD +G+   F
Sbjct: 531 PPGYVGFDQGGMLTDGVDQNPHCVLLLDEMEKAHPDVYNILLQVMDHGKLTDHNGRTTDF 590

Query: 616 RNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSD 675
           RNVI+IMT+NAGA EMSK  +GFG       D  A+    +PEF NRLD+II F  L   
Sbjct: 591 RNVIIIMTSNAGAAEMSKNAMGFGREARTGEDTAAIERTFTPEFRNRLDAIISFGALPKP 650

Query: 676 IIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPL 735
           +I QVV KF+++LE QL ++ +    +     WL   GYD KMGARPL R+I+EH+K PL
Sbjct: 651 VIMQVVEKFVLQLEAQLMDRNVHIELTNAAAEWLADKGYDAKMGARPLGRVIQEHIKKPL 710

Query: 736 ADEILFGKLKKGGGVVKVSL 755
           A+E+LFGKL K GG+VKV +
Sbjct: 711 AEELLFGKLVK-GGIVKVGV 729


>gi|254701911|ref|ZP_05163739.1| ATP-dependent Clp protease ATP-binding subunit clpA [Brucella suis
           bv. 5 str. 513]
 gi|261752475|ref|ZP_05996184.1| ATP-dependent Clp protease [Brucella suis bv. 5 str. 513]
 gi|261742228|gb|EEY30154.1| ATP-dependent Clp protease [Brucella suis bv. 5 str. 513]
          Length = 651

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/658 (66%), Positives = 535/658 (81%), Gaps = 7/658 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS +LE+ LHQAL +ANER+HEYATLEHLLLALIDD DA  VM +CNVDL  LK+ +
Sbjct: 1   MPSFSPSLERALHQALTIANERHHEYATLEHLLLALIDDQDAGAVMRACNVDLDYLKHIV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID +  N L  G+  + KPT++FQRV+QRAV+HVQS+ R  VTGAN+LVA+F+E +S
Sbjct: 61  TDYIDRELDN-LITGYDEDSKPTAAFQRVIQRAVIHVQSSNRDEVTGANVLVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVN+ISHGISKR + +  ++   V+ +S    G       + K D
Sbjct: 120 HAAYFLQEQQMTRYDAVNYISHGISKRPQGSEPRTPRGVESASEERTGIEQEEAPKKKQD 179

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                ALSAYC++L EK K G++D L+GR  EINRTIQ+LCRRSKNNPLYVGDPGVGKTA
Sbjct: 180 -----ALSAYCINLNEKAKAGRIDPLIGRDSEINRTIQVLCRRSKNNPLYVGDPGVGKTA 234

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+IV+G VPD L  A IFSLDMG L+AGTRYRGDFEER+K++VKE+E +  A+L
Sbjct: 235 IAEGLAKRIVEGQVPDALADATIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEFPGAVL 294

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY EYRQFFEKD+ALVRRFQ
Sbjct: 295 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQ 354

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI+KG+KPYFE+ H+++Y+ +AI++AV+LS R+ + RKLPDKAIDVI
Sbjct: 355 KIDVNEPSIPDTIEIMKGLKPYFEDFHKVKYTVDAIKSAVELSARYISDRKLPDKAIDVI 414

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GASQ+L P +KR+K I  K+I+ TIA+M R I   S S+DD+ VLS+LE  L  VVY
Sbjct: 415 DETGASQMLLPENKRKKTIGVKEIEATIATMAR-IPPKSVSKDDEEVLSHLEAELKRVVY 473

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS+SIK+ARAGL +P+KPIG Y+FSGPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 474 GQDLAIDALSASIKLARAGLREPDKPIGSYLFSGPTGVGKTEVAKQLASSLGVELLRFDM 533

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 534 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVM 593

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           D+G LTD +GKKI FRNVILIMTTNAGA +M+KA IGFGS+R +  D EA+    +PE
Sbjct: 594 DHGALTDHNGKKIDFRNVILIMTTNAGASDMAKAAIGFGSTRREGDDMEAINRLFTPE 651


>gi|254460098|ref|ZP_05073514.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Rhodobacterales bacterium HTCC2083]
 gi|206676687|gb|EDZ41174.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 775

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/749 (58%), Positives = 568/749 (75%), Gaps = 17/749 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE+ATLEHLLLAL+D+ DA  VM +C+VD + L+  L
Sbjct: 1   MPSFSTTLEQAIHAALALANARRHEFATLEHLLLALVDEPDAERVMKACSVDTEELRQTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             +ID+D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  AGFIDDDLSNLITDIEGSEAVPTAAFQRVIQRAAIHVQSSGRSEVTGANVLVAMFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQ-----SKLNVDGSSAGSDGEGFVNDY 175
           +A YFLQEQ+MT YDAVN+I+HG++K   F + +      +++ DG++A  +GE      
Sbjct: 121 NAAYFLQEQDMTRYDAVNYIAHGVAKDPAFGDTRPVTGSGEMDEDGAAAAMEGE------ 174

Query: 176 QAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPG 235
           + K       AL+ YCVDL  K  KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPG
Sbjct: 175 EKKES-----ALAKYCVDLNVKAAKGDVDPLIGRDSEVERCIQVLCRRRKNNPLLVGDPG 229

Query: 236 VGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY 295
           VGKTAIAEG A++IV G  P++L    IFSLDMG L+AGTRYRGDFEER+K +V EIE +
Sbjct: 230 VGKTAIAEGLARKIVQGETPEVLSQTTIFSLDMGALLAGTRYRGDFEERLKAVVSEIEEH 289

Query: 296 ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKAL 355
            +++L+IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL
Sbjct: 290 PDSVLFIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRAL 349

Query: 356 VRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK 415
            RRFQKIDV+EPS+ED+I+I+KG+KPYFE+HH ++Y+ +AI+ AV+L+ R+   RKLPDK
Sbjct: 350 SRRFQKIDVNEPSVEDSIKILKGLKPYFEDHHSVKYTADAIKTAVELAARYINDRKLPDK 409

Query: 416 AIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNL 475
           AIDVIDEAGA+Q L   SKRRK +  K+I+  +A + R I   S S+ D  VL +LE +L
Sbjct: 410 AIDVIDEAGAAQRLVVESKRRKTLGAKEIEAVVAKIAR-IPPKSVSKSDAEVLKDLEASL 468

Query: 476 GTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQL 535
             VV+GQ++AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV++
Sbjct: 469 KRVVFGQDDAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVEM 528

Query: 536 LRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNI 595
           LRFDMSEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NI
Sbjct: 529 LRFDMSEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNI 588

Query: 596 LLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFL 655
           LLQ+MD+G LTD +G+ + FRNV+LIMT+NAGA E +K  +GFG S  +  D  A+    
Sbjct: 589 LLQVMDHGKLTDHNGRAVDFRNVVLIMTSNAGAAEQAKEALGFGRSAREGEDTAAVERTF 648

Query: 656 SPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYD 715
           +PEF NRLDSII F  L   +I QVV KF+++LE QL ++ ++F  S+    W+   GYD
Sbjct: 649 TPEFRNRLDSIISFGALPKKVIMQVVEKFVLQLEAQLMDRNVTFELSKAATEWIADKGYD 708

Query: 716 VKMGARPLERIIKEHVKVPLADEILFGKL 744
            KMGARPL R+I+EH+K PLA+E+LFGKL
Sbjct: 709 SKMGARPLGRVIQEHIKKPLAEELLFGKL 737


>gi|149185295|ref|ZP_01863612.1| ATPase [Erythrobacter sp. SD-21]
 gi|148831406|gb|EDL49840.1| ATPase [Erythrobacter sp. SD-21]
          Length = 795

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/750 (57%), Positives = 564/750 (75%), Gaps = 8/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+ NLEK LH AL  A ER HEYATLEHLLLALI D DA  VM +C VD   L   +
Sbjct: 1   MPSFAANLEKTLHAALTDAGERRHEYATLEHLLLALIGDEDAVAVMTACGVDSGELSAVV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y++ +  + LK     + +PT+ FQRV+QRA+LHVQS+G+  VTGAN+LVALFSE DS
Sbjct: 61  KQYLEQEYQS-LKTEEGADPQPTAGFQRVIQRAILHVQSSGKDTVTGANVLVALFSERDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+M+  DAV++ISHGI K  +    +     + +      E      + +T 
Sbjct: 120 YAVYFLQQQDMSRLDAVSYISHGIGKGGKQVEGKPPQGAEETQGEPGAEAGKPSDKKET- 178

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  + V+L +K + G++D L+GR  E++RT+QILCRRSKNNPLYVGDPGVGKTA
Sbjct: 179 -----ALDQFTVNLNQKAEDGRIDPLIGRGPEVDRTVQILCRRSKNNPLYVGDPGVGKTA 233

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G VP++L  A I+SLDMG L+AGTRYRGDFEER+K++V E+E    AIL
Sbjct: 234 IAEGLARKIVEGDVPEVLEEAVIYSLDMGALLAGTRYRGDFEERLKQVVNELEDMPEAIL 293

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSGA+RCIGSTTY E+R  FEKD+AL+RRFQ
Sbjct: 294 FIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEFRNHFEKDRALLRRFQ 353

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+IED + I+KG++  FEEHH+++Y+ +A++ AV+LS R+   RKLPDKAIDVI
Sbjct: 354 KIDVNEPTIEDTVAILKGLRSAFEEHHKVKYTPDALKTAVELSARYINDRKLPDKAIDVI 413

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA Q+L P S+R+K IT K+I+  IA+M R I   S S DD   L NL+++L  VV+
Sbjct: 414 DEVGAMQMLVPPSRRKKKITAKEIEAVIATMAR-IPPKSVSSDDKKALQNLDRDLKHVVF 472

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ A+ KLS+++K++RAGL DP+KPIG ++FSGPTGVGKTE+++QLA  +G++L RFDM
Sbjct: 473 GQDAAVDKLSTAMKLSRAGLRDPDKPIGSFLFSGPTGVGKTEVARQLASIMGIELKRFDM 532

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH+VSRLIGAPPGYVG+ QGG+L D++DQNP+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 533 SEYMERHSVSRLIGAPPGYVGYDQGGLLTDAIDQNPHCVLLLDEIEKAHPDLFNILLQVM 592

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GK + FRNV+LIMTTNAGA +M+K  IGFG    +DA +EA++   +PEF 
Sbjct: 593 DNGRLTDHHGKTVDFRNVVLIMTTNAGASDMAKQGIGFGDVSKEDASEEAVKRMFTPEFR 652

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF  L    + +VV KFI++LELQL E+ +   F +E   WL   GYD   GA
Sbjct: 653 NRLDAIVPFGYLGKSTVARVVDKFILQLELQLAEQNVDIQFDKESRAWLADKGYDKLYGA 712

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RP+ R+I+E +K PLA+E+LFGKL  GG V
Sbjct: 713 RPMGRLIQEKIKQPLAEELLFGKLADGGEV 742


>gi|114762057|ref|ZP_01441525.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Pelagibaca
           bermudensis HTCC2601]
 gi|114545081|gb|EAU48084.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Roseovarius
           sp. HTCC2601]
          Length = 776

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/744 (58%), Positives = 564/744 (75%), Gaps = 6/744 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R+HE+ATLEHLLLALID+ DAA VM +C+VD + L+  L
Sbjct: 1   MPSFSNTLEQAIHAALALANSRSHEFATLEHLLLALIDEPDAARVMKACSVDTEELRTTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + +ID D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFIDEDLSNLVTDIEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +    V G++     E      Q    
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKNPAYGESRP---VQGATEAE--EEAKAQTQEPAG 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            N   AL  YCVDL  K +KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 176 DNKESALGKYCVDLNAKSRKGDVDPLIGREHEVERAIQVLCRRRKNNPLLVGDPGVGKTA 235

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G  P++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 236 IAEGLARKIVNGDTPEVLSNTTIYSLDMGALLAGTRYRGDFEERLKAVVTELEEHPDAVL 295

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 296 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALSRRFQ 355

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDVSEPS++D ++I+KG+KPYFEEHH ++Y+ +AI++AV+LS R+   RKLPDKAIDVI
Sbjct: 356 KIDVSEPSVDDTVKILKGLKPYFEEHHSIKYTADAIKSAVELSARYINDRKLPDKAIDVI 415

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LEK L  VV+
Sbjct: 416 DEAGAAQHLVAESKRRKTIGAKEIEAVVAKIAR-IPPKNVSKDDAEVLKDLEKTLKRVVF 474

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 475 GQDTAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLASTLGVELLRFDM 534

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 535 SEYMEKHAVSRLIGAPPGYVGFDQGGQLTDGVDQHPHCVLLLDEIEKAHPDVYNILLQVM 594

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNVILIMT+NAGA E +KA IGFG  R +  D  A+    +PEF 
Sbjct: 595 DHGSLTDHNGRTVDFRNVILIMTSNAGAAEQAKAAIGFGRDRREGEDTAAIERTFTPEFR 654

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  ++I  VV KF+++LE QL ++ ++   ++    WL   GYD +MGA
Sbjct: 655 NRLDAVISFQPLPKEVILSVVEKFVLQLEAQLMDRNVTIELTKPAAEWLADKGYDDRMGA 714

Query: 721 RPLERIIKEHVKVPLADEILFGKL 744
           RPL R+I+E++K PLA+E+LFGKL
Sbjct: 715 RPLGRVIQENLKKPLAEELLFGKL 738


>gi|163742883|ref|ZP_02150267.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Phaeobacter
           gallaeciensis 2.10]
 gi|161383847|gb|EDQ08232.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Phaeobacter
           gallaeciensis 2.10]
          Length = 766

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/752 (58%), Positives = 572/752 (76%), Gaps = 10/752 (1%)

Query: 8   LEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDND 67
           +E+ +H AL LANER HE+ATLEHLLLAL+D+ +AA VM +C+VDL  L+  L+ ++D D
Sbjct: 1   MEQAIHAALALANERRHEFATLEHLLLALLDEPEAARVMRACSVDLTELRATLVEFVDED 60

Query: 68  SSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQ 127
            +N + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S A YFLQ
Sbjct: 61  LANLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERESDAAYFLQ 120

Query: 128 EQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPAL 187
           +Q+MT YDAVNFI+HG++K   F   +    V GS    D      +   K       AL
Sbjct: 121 DQDMTRYDAVNFIAHGVAKDPAFGESRP---VSGSPEVEDEPQPTTEGDKKES-----AL 172

Query: 188 SAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAK 247
           + YCVDL EK ++G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTAIAEG A+
Sbjct: 173 AKYCVDLNEKSREGDIDPLIGRSHEVERCIQVLCRRRKNNPLLVGDPGVGKTAIAEGLAR 232

Query: 248 QIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHT 307
           +IV G  P++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L+IDEIHT
Sbjct: 233 KIVAGETPEVLSETTIYSLDMGALLAGTRYRGDFEERLKAVVTELEDHPDAVLFIDEIHT 292

Query: 308 LVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEP 367
           ++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL RRFQKIDV+EP
Sbjct: 293 VIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALSRRFQKIDVNEP 352

Query: 368 SIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQ 427
           S+ED+IEI+KG+KPYFE+HH +R++ +AI++AV+LS R+   RKLPDKAIDVIDEAGA+Q
Sbjct: 353 SVEDSIEILKGLKPYFEDHHGIRFTSDAIKSAVELSARYINDRKLPDKAIDVIDEAGAAQ 412

Query: 428 ILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIK 487
            L   SKRRK I  K+I+  +A + R I   + S+DD  VL +LE++L  VV+GQ+ AI 
Sbjct: 413 HLVVESKRRKTIGVKEIEAVVAKIAR-IPPKNVSKDDAEVLKDLERSLKRVVFGQDAAID 471

Query: 488 KLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERH 547
            LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDMSEYME+H
Sbjct: 472 ALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDMSEYMEKH 531

Query: 548 AVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTD 607
           AVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+MD G LTD
Sbjct: 532 AVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNILLQVMDNGQLTD 591

Query: 608 QSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSII 667
            +G+ ++FRNV+LIMT+NAGA E +KA IGFG  R +  D  A+    +PEF NRLD++I
Sbjct: 592 HNGRTVNFRNVVLIMTSNAGASEQAKAAIGFGRDRREGEDTAAIERTFTPEFRNRLDAVI 651

Query: 668 PFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERII 727
            F PL  D+I QVV KF+++LE QL ++ +S   + +   WL   GYD +MGARPL R+I
Sbjct: 652 SFAPLPKDVILQVVEKFVLQLEAQLMDRNVSIELTRKAAEWLADKGYDDRMGARPLGRVI 711

Query: 728 KEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           +EH+K PLA+E+LFGKL K GG+VKV +   K
Sbjct: 712 QEHIKKPLAEELLFGKLAK-GGLVKVGIKDGK 742


>gi|294011232|ref|YP_003544692.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Sphingobium
           japonicum UT26S]
 gi|292674562|dbj|BAI96080.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Sphingobium
           japonicum UT26S]
          Length = 773

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/750 (58%), Positives = 564/750 (75%), Gaps = 11/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+  LE  LH AL  A+ER HEYATLEHLLLALIDD  A+ VM +C V+L  L + +
Sbjct: 1   MPSFAPALETTLHNALTHASERRHEYATLEHLLLALIDDEHASKVMQACGVELGELSDAV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D +  + LK     +  PTS FQRVVQRA+LHVQS+G+  VTGAN+LVALFSE +S
Sbjct: 61  TQYLDTEL-DSLKVEGASDPSPTSGFQRVVQRAILHVQSSGKDEVTGANVLVALFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+M+  DAV++ISHG+ K       Q +     +   ++ E    D + K D
Sbjct: 120 YAVYFLQQQDMSRLDAVSYISHGVGKGTAVPEQQRE-----TKGAAEEEKKTQDSKGKKD 174

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  + V+L EK  +GKVD L+GR  E++RTIQILCRRSKNNPLYVGDPGVGKTA
Sbjct: 175 ----SALEQFTVNLNEKAARGKVDPLIGRASEVDRTIQILCRRSKNNPLYVGDPGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G VPD+L  A I+SLDMG L+AGTRYRGDFEER+K +V E+E   +A+L
Sbjct: 231 IAEGLARKIVEGEVPDVLKEAVIYSLDMGALLAGTRYRGDFEERLKAVVTELEKMPHAVL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALS G +RCIGSTTY E+R  FEKD+AL+RRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFRNHFEKDRALLRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ED I+I+ G++  FEEHH ++Y+ +AI+AAV+LS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPTVEDTIKILAGLRSAFEEHHHVKYTPDAIKAAVELSARYINDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA Q+L   SKR+K IT ++I++ IA+M R I   + S DD SVL  L+ +L  VV+
Sbjct: 411 DEVGAMQMLVVPSKRKKTITPREIEQVIATMAR-IPPKTVSADDKSVLETLDTDLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ  AI+ LSS+IK++RAGL DP+KPIG Y+FSGPTGVGKTE+++QLA  LG+ L RFDM
Sbjct: 470 GQNRAIEVLSSAIKLSRAGLRDPDKPIGNYLFSGPTGVGKTEVARQLAHLLGIPLQRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH+VSRLIGAPPGYVG+ QGG+L D+VDQNP+SV+LLDEIEK+HPD+ NILLQ+M
Sbjct: 530 SEYMERHSVSRLIGAPPGYVGYDQGGLLTDAVDQNPHSVLLLDEIEKAHPDLFNILLQVM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GK + FRN ILIMTTNAGA +M+K  IGFG    +DA ++A++   +PEF 
Sbjct: 590 DNGRLTDHHGKTVDFRNTILIMTTNAGASDMAKESIGFGELTREDAQEDAVKKLFTPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF  L  +I+ +V+ KF+++LELQL ++ +     +E   WL   GYD   GA
Sbjct: 650 NRLDAIVPFGYLPPEIVARVIDKFVLQLELQLADRDVHITLDDEAKAWLTKRGYDKLYGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RP+ R+++E +K PLA+E+LFGKL  GG V
Sbjct: 710 RPMGRLMQEKIKQPLAEELLFGKLVHGGEV 739


>gi|103485664|ref|YP_615225.1| ATPase AAA-2 [Sphingopyxis alaskensis RB2256]
 gi|98975741|gb|ABF51892.1| ATPase AAA-2 [Sphingopyxis alaskensis RB2256]
          Length = 779

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/771 (57%), Positives = 577/771 (74%), Gaps = 15/771 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FSE+LEK LH AL  A+ER+HEYATLEHLL ALIDD  AA VM +C V L  L++ +
Sbjct: 1   MPSFSESLEKTLHNALKAASERHHEYATLEHLLFALIDDDHAAEVMRACGVALGDLQSAV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           ++Y+D +  + LK     +  PTS FQRVVQRA+LHVQS+G+  VTGAN+LVALFSE +S
Sbjct: 61  VHYLDTEL-DSLKVEGHSDPSPTSGFQRVVQRAILHVQSSGKDEVTGANVLVALFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKR-KEFANFQSKLNVDGSSAGSDGEGFVNDYQAKT 179
           +A YFLQ+Q++T  DAV+++SHG+ K  K  A  + +   +     S G+   N  +   
Sbjct: 120 YAVYFLQQQDLTRLDAVSYLSHGVGKGGKPAAQAEPEEKEEAKDKDSSGK---NKKET-- 174

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                 AL  + V+L EK K GKVD L+GR  E++RTIQILCRRSKNNPLYVGDPGVGKT
Sbjct: 175 ------ALDQFTVNLNEKAKTGKVDPLIGRSAEVDRTIQILCRRSKNNPLYVGDPGVGKT 228

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A++I++G VP++LL A I+SLDMG L+AGTRYRGDFEER+K++V E+E   +AI
Sbjct: 229 AIAEGLARKIIEGDVPEVLLPAVIYSLDMGALLAGTRYRGDFEERLKQVVTELEGLPHAI 288

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHT++GAG+ SG ++DASNLLKPALS G +RCIGSTTY E+R  FEKD+AL+RRF
Sbjct: 289 LFIDEIHTVIGAGATSGGAMDASNLLKPALSGGVIRCIGSTTYKEFRNHFEKDRALLRRF 348

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV EP++ED  +I+ G++  FE HHQ+RY+ +AI AAV LS R+   RKLPDKAIDV
Sbjct: 349 QKIDVVEPTLEDTKKILAGLRSAFEAHHQVRYTPDAINAAVDLSARYINDRKLPDKAIDV 408

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDE GA Q+L   SKR+K IT ++I+  IA+M R I   S S DD +VL++LE +L  VV
Sbjct: 409 IDEVGAMQMLVAPSKRKKTITAREIEAVIATMAR-IPPKSVSTDDKAVLASLETDLKRVV 467

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ  AI+ LSS+IK++RAGL DP KPIG Y+FSGPTGVGKTE++KQLA  +G+ L RFD
Sbjct: 468 FGQNTAIEVLSSAIKLSRAGLRDPEKPIGNYLFSGPTGVGKTEVAKQLASIMGIPLQRFD 527

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERH+VSRLIGAPPGYVG+ QGG+L D++DQNP+ V+LLDEIEK+HPD+ NILLQ+
Sbjct: 528 MSEYMERHSVSRLIGAPPGYVGYDQGGLLTDAIDQNPHCVLLLDEIEKAHPDLFNILLQV 587

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD G LTD  GK + FRNVILIMTTNAGA +M++  IGFG    +DA +EA++   +PEF
Sbjct: 588 MDNGRLTDHHGKTVDFRNVILIMTTNAGASDMARESIGFGQQTREDAQEEAVKRMFTPEF 647

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+I+PF  L  +++ +VV KFI++LELQL ++ +     +    WL + GYD   G
Sbjct: 648 RNRLDAIVPFGYLPPEVVARVVDKFILELELQLADRNVHIQLDDAAREWLTAKGYDKLYG 707

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGV-VKVSLNPDKSASSPIFFEI 769
           ARP+ R+I+E +K PLA+E+LFGKL  GG V VK+    D    +P+ FEI
Sbjct: 708 ARPMGRLIQEKIKQPLAEELLFGKLVHGGEVKVKMKTGEDAHIGNPLAFEI 758


>gi|84500106|ref|ZP_00998372.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Oceanicola
           batsensis HTCC2597]
 gi|84392040|gb|EAQ04308.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Oceanicola
           batsensis HTCC2597]
          Length = 776

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/759 (57%), Positives = 573/759 (75%), Gaps = 7/759 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE+ATLEHLLLALID+ DAA VM +C+V+++ L+  L
Sbjct: 1   MPSFSNTLEQAIHAALALANARRHEFATLEHLLLALIDEPDAARVMKACSVEVEDLRKTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           L ++++D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  LEFVEDDLSNLVTDVDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +     +   A         +   K  
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPAYGENRPVTGAEEEEAAQQASAAAPEGDGKES 180

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL  K + G VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 181 -----ALAKYCVDLNAKSRHGDVDPLIGRAHEVERCIQVLCRRRKNNPLLVGDPGVGKTA 235

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G  P +L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 236 IAEGLARKIVSGETPSVLANTTIYSLDMGALLAGTRYRGDFEERLKAVVTELEDHEDAVL 295

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 296 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEFRQHFEKDRALSRRFQ 355

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS++D I+I++G+KPYFE+HHQ+RY+++AI+ AV+LS R+   RKLPDKAIDVI
Sbjct: 356 KIDVNEPSVDDTIKILQGLKPYFEDHHQIRYTQDAIKTAVELSARYINDRKLPDKAIDVI 415

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+I+  +A + R I   + ++DD  VL +LE+ L  VV+
Sbjct: 416 DEAGAAQHLIAESKRRKTIGTKEIESVVAKIAR-IPPKNVTKDDAEVLKDLEQTLKRVVF 474

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA +LGV+LLRFDM
Sbjct: 475 GQDLAIESLSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADSLGVELLRFDM 534

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+M
Sbjct: 535 SEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVYNILLQVM 594

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+ ++FRNVILIMT+NAGA E++K+ IGFG  R +  D  A+    +PEF 
Sbjct: 595 DNGQLTDHNGRTVNFRNVILIMTSNAGASELAKSAIGFGRDRREGEDTAAIERTFTPEFR 654

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  D I QVV KF+++LE QL ++ ++   +     WL   GYD KMGA
Sbjct: 655 NRLDAVISFQPLPKDTILQVVEKFVLQLEAQLMDRNVTIELTTPAAEWLAEKGYDDKMGA 714

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           RPL R+I+E++K PLA+E+LFGKL K GGVV+V +   K
Sbjct: 715 RPLGRVIQENIKKPLAEELLFGKLSK-GGVVRVGVKNGK 752


>gi|56551301|ref|YP_162140.1| ATP-dependent Clp protease ATP-binding subunit clpA [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241760955|ref|ZP_04759044.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|56542875|gb|AAV89029.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241374574|gb|EER64035.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
          Length = 773

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/777 (56%), Positives = 579/777 (74%), Gaps = 20/777 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F++ LE+ LH AL +A+ R+HEYA LEHLLLALIDD  A+ VM  C VDL  LK +L
Sbjct: 1   MPSFAKALEQTLHNALAIASRRHHEYAMLEHLLLALIDDEHASQVMAGCGVDLAELKRSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D +  + LK     +  PTS FQRV+QRA+LHVQS+GR  VTGAN+LVALFSE +S
Sbjct: 61  TTYLDTEL-DALKIEGNSDPSPTSGFQRVIQRAILHVQSSGRDEVTGANVLVALFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+M+  DAV+F+SHG+ K    A+ Q++            E       ++  
Sbjct: 120 YAVYFLQQQDMSRLDAVSFLSHGVGKGGVAADNQAE------------EEKTQQRPSEVS 167

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  + V+L EK + G++D L+GR  E++RTIQILCRRSKNNPLYVGDPGVGKTA
Sbjct: 168 KKNESALKQFTVNLNEKAEVGRIDPLIGRSAEVDRTIQILCRRSKNNPLYVGDPGVGKTA 227

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++I++  VP++L    I+SLDMG L+AGTRYRGDFEER+K +V E++    A+L
Sbjct: 228 IAEGLARKIIEDQVPEVLKDTVIYSLDMGALLAGTRYRGDFEERLKAVVTELQKQPKAVL 287

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSG +RCIGSTTY E+R  FEKD+AL+RRFQ
Sbjct: 288 FIDEIHTIIGAGATSGGAMDASNLLKPALSSGTIRCIGSTTYKEFRNHFEKDRALLRRFQ 347

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP++EDA++I+ G++P FEEHH +RY+ +AIR+AV+LS R+   RKLPDKAIDVI
Sbjct: 348 KIDVVEPTVEDAVKILNGLRPSFEEHHSVRYTSDAIRSAVELSARYINDRKLPDKAIDVI 407

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA+Q+L P SKRRK I  KD++  +A+M R I   + S DD  +L+NLE +L  VV+
Sbjct: 408 DEVGAAQMLLPPSKRRKVILAKDVEAVVATMAR-IPPKTVSNDDSQILANLETDLKRVVF 466

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AIK L+S+IK++RAGL + +KPIG Y+FSGPTGVGKTE+++QLA  LG+ L RFDM
Sbjct: 467 GQDKAIKTLASAIKLSRAGLREMHKPIGSYLFSGPTGVGKTEVARQLASLLGIPLKRFDM 526

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH+VSRLIGAPPGYVG+ QGG+L D+++QNP+SV+LLDEIEK+HPD+ NILLQ+M
Sbjct: 527 SEYMERHSVSRLIGAPPGYVGYDQGGLLTDAIEQNPHSVLLLDEIEKAHPDLFNILLQVM 586

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GK + FRNVILIMT+NAGA +M++  IGFG    +  D EA++   SPEF 
Sbjct: 587 DNGKLTDPHGKTVDFRNVILIMTSNAGASDMARETIGFGDLTREGEDFEAIKTMFSPEFR 646

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+++PF  LS ++I++VV KFI++LE+QL ++ +   F +E   WL   GYD   GA
Sbjct: 647 NRLDAVVPFGYLSPEMIQRVVDKFILELEIQLADRKVDIAFDDEAREWLGKKGYDRLYGA 706

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNIS 777
           RP+ R+I+E +K PLA+E+LFGKL  GG  VKV L  ++ +     FEI     ++S
Sbjct: 707 RPMGRLIQEKIKQPLAEELLFGKLVDGGE-VKVHLKENEPS-----FEIVPGAPSVS 757


>gi|163732301|ref|ZP_02139747.1| ATP-dependent Clp protease, ATP-binding subunit ClpA, putative
           [Roseobacter litoralis Och 149]
 gi|161394599|gb|EDQ18922.1| ATP-dependent Clp protease, ATP-binding subunit ClpA, putative
           [Roseobacter litoralis Och 149]
          Length = 773

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/744 (56%), Positives = 562/744 (75%), Gaps = 9/744 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE+ATLEHLLLALID+ DA+ VM +C+VD   L+  L
Sbjct: 1   MPSFSTTLEQAIHSALALANARRHEFATLEHLLLALIDEPDASRVMKACSVDTDDLRRTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + ++D D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFVDEDLSNLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +    V G+    +    V + + K  
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPAYGEPRP---VSGAPEAEEETQGVTEGEKKES 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  YCVDL  K ++G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 178 -----ALEKYCVDLNAKSREGDIDPLIGRASEVERCIQVLCRRRKNNPLLVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G  P++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 233 IAEGLARKIVAGETPEVLAETTIYSLDMGALLAGTRYRGDFEERLKSVVSELEDHKDAVL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+ G +R +GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALAGGKLRTMGSTTYKEFRQHFEKDRALSRRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+EDA++I++G+KPYFE+HH ++Y+ +AI+ +V+L+ R+   RKLPD AIDVI
Sbjct: 353 KIDVNEPSVEDAVKILRGLKPYFEDHHSVKYTADAIKTSVELASRYINDRKLPDSAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   +KRRK I  ++I+  +A + R I   + S+DD  VL +LE +L  VV+
Sbjct: 413 DEAGAAQHLVVAAKRRKTIGTREIENVVAKIAR-IPPKNVSKDDAEVLKDLEGSLKRVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ  AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 472 GQNAAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPDV NILLQ+M
Sbjct: 532 SEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEMEKAHPDVYNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNV+LIMT+NAGA E +K  IGFG  R +  D  A+    +PEF 
Sbjct: 592 DHGKLTDHNGRTVDFRNVVLIMTSNAGAAEQAKEAIGFGRDRREGEDTAAIERTFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL  ++I +VV KF+++LE QL ++ ++   ++    WL   GYD KMGA
Sbjct: 652 NRLDAVISFAPLPKEVILRVVEKFVLQLEAQLMDRNVTIELTKPAAEWLADKGYDSKMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKL 744
           RPL R+I+E++K PLA+++LFGKL
Sbjct: 712 RPLGRVIQEYIKKPLAEDLLFGKL 735


>gi|304321616|ref|YP_003855259.1| ClpA, ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Parvularcula bermudensis HTCC2503]
 gi|303300518|gb|ADM10117.1| ClpA, ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Parvularcula bermudensis HTCC2503]
          Length = 782

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/774 (56%), Positives = 573/774 (74%), Gaps = 15/774 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M+ FS+NLE+ +H+A+ LA     E ATLEHLL AL +D DA  VML+C+VDL  L+ +L
Sbjct: 1   MATFSDNLEQSIHRAIGLATRHKQELATLEHLLYALTEDEDARAVMLACDVDLDELREHL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           ++YI++D  +KL+     E KPT+ F RVVQRA++HV+++GR  VTGANILVA+F+E +S
Sbjct: 61  MDYIEDDL-DKLRVEDADEAKPTAGFHRVVQRALIHVETSGRSEVTGANILVAIFAERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA+YFL  Q MT YDAVN+ISHG+SK       QS          S  +    + QAK  
Sbjct: 120 HASYFLNAQGMTRYDAVNYISHGLSK-----TGQSPTE---PRTPSGAQEEEEETQAKQG 171

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL AY  +L EK ++GK+DIL+GR +E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 172 AQ---ALEAYTTNLNEKARRGKIDILIGREKEVERAIQVLCRRRKNNPLLVGDPGVGKTA 228

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IVD  VP++L  A IFSLDMG L+AGTRYRGDFEER+K ++KE+E+   A+L
Sbjct: 229 IAEGLARRIVDEQVPEVLAEATIFSLDMGALLAGTRYRGDFEERLKAVLKELEATPGAVL 288

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL +G+++C+GSTT+ EY+Q FEKD+AL RRFQ
Sbjct: 289 FIDEIHTIIGAGATSGGAMDASNLLKPALQNGSLKCMGSTTFKEYKQHFEKDRALSRRFQ 348

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI D IEI++G+KP FEEHH L Y+ EAI +AV+L+ ++ T R+LPDKAIDVI
Sbjct: 349 KIDVAEPSIADTIEILRGLKPAFEEHHGLNYNDEAIVSAVELASKYMTDRRLPDKAIDVI 408

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA Q+L P + R   I    +++ +A M R I   + S+ D   L N+  +L  VVY
Sbjct: 409 DEAGARQMLFPAADRVTEIGVPQVEEVVAQMAR-IPPKTVSKSDTERLRNMGGDLKRVVY 467

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  L+++IK+ARAGL +P+KPIG Y+F+GPTGVGKTE++KQLA  +GV+LLRFDM
Sbjct: 468 GQDKAIDALTAAIKLARAGLREPDKPIGSYLFAGPTGVGKTEVAKQLAKMMGVELLRFDM 527

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQ-GGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           SEYMERH VSRLIGAPPGYVGF Q GG+L D VDQNP++VVLLDEIEK+HP++ NILLQ+
Sbjct: 528 SEYMERHTVSRLIGAPPGYVGFDQGGGLLTDQVDQNPHAVVLLDEIEKAHPEIFNILLQV 587

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD G LTD  GKKI FRNVI+IMTTNAGA + SK  IGFG  R  D  ++A+    +PEF
Sbjct: 588 MDNGQLTDSHGKKIDFRNVIIIMTTNAGAADASKNEIGFGRGRATDQQQQAIEKLFTPEF 647

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+II F  LS  I+ ++V KF+++LE QL ++ ++F  +E    WL   G+D  MG
Sbjct: 648 RNRLDAIISFAGLSKPIVDRIVAKFVLQLEAQLADRNVTFEVTEAATRWLTERGFDEDMG 707

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSG 773
           ARPL R I+EH+K P+ADEILFG LK+ GG+V+V++      +  + FE    G
Sbjct: 708 ARPLARTIQEHIKKPIADEILFGSLKE-GGIVRVTVKKTADDTEGLSFEFLAEG 760


>gi|260753078|ref|YP_003225971.1| ATP-dependent Clp protease ATP-binding subunit clpA [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|258552441|gb|ACV75387.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 773

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/777 (56%), Positives = 579/777 (74%), Gaps = 20/777 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F++ LE+ LH AL +A+ R+HEYA LEHLLLALIDD  A+ VM  C VDL  LK +L
Sbjct: 1   MPSFAKALEQTLHNALAIASRRHHEYAMLEHLLLALIDDEHASQVMAGCGVDLAELKRSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D +  + LK     +  PTS FQRV+QRA+LHVQS+GR  VTGAN+LVALFSE +S
Sbjct: 61  TTYLDTEL-DALKIEGNSDPSPTSGFQRVIQRAILHVQSSGRDEVTGANVLVALFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+M+  DAV+F+SHG+ K    A+ Q++            E       ++  
Sbjct: 120 YAVYFLQQQDMSRLDAVSFLSHGVGKGGVAADNQAE------------EEKTQQRPSEVS 167

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  + V+L EK + G++D L+GR  E++RTIQILCRRSKNNPLYVGDPGVGKTA
Sbjct: 168 KKNESALKQFTVNLNEKAEVGRIDPLIGRSAEVDRTIQILCRRSKNNPLYVGDPGVGKTA 227

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++I++  VP++L    I+SLDMG L+AGTRYRGDFEER+K +V E++    A+L
Sbjct: 228 IAEGLARKIIEDQVPEVLKDTVIYSLDMGALLAGTRYRGDFEERLKAVVTELQKQPKAVL 287

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALSSG +RCIGSTTY E+R  FEKD+AL+RRFQ
Sbjct: 288 FIDEIHTIIGAGATSGGAMDASNLLKPALSSGTIRCIGSTTYKEFRNHFEKDRALLRRFQ 347

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP++EDA++I+ G++P FEEHH +RY+ +AIR+AV+LS R+   RKLPDKAIDVI
Sbjct: 348 KIDVVEPTVEDAVKILNGLRPSFEEHHSVRYTSDAIRSAVELSARYINDRKLPDKAIDVI 407

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA+Q+L P SKRRK I  KD++  +A+M R I   + S DD  +L+NLE +L  VV+
Sbjct: 408 DEVGAAQMLLPPSKRRKVILAKDVEAVVATMAR-IPPKTVSNDDSQILANLETDLKRVVF 466

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AIK L+S+IK++RAGL + +KPIG Y+FSGPTGVGKTE+++QLA  LG+ L RFDM
Sbjct: 467 GQDKAIKTLASAIKLSRAGLREMHKPIGSYLFSGPTGVGKTEVARQLASLLGIPLKRFDM 526

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH+VSRLIGAPPGYVG+ QGG+L D+++QNP+SV+LLDEIEK+HPD+ NILLQ+M
Sbjct: 527 SEYMERHSVSRLIGAPPGYVGYDQGGLLTDAIEQNPHSVLLLDEIEKAHPDLFNILLQVM 586

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GK + FRNVILIMT+NAGA +M++  IGFG    +  D EA++   SPEF 
Sbjct: 587 DNGKLTDPHGKTVDFRNVILIMTSNAGASDMARETIGFGDLTREGDDFEAIKTMFSPEFR 646

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+++PF  LS ++I++VV KFI++LE+QL ++ +   F +E   WL   GYD   GA
Sbjct: 647 NRLDAVVPFGYLSPEMIQRVVDKFILELEIQLADRKVDIAFDDEAREWLGKKGYDRLYGA 706

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNIS 777
           RP+ R+I+E +K PLA+E+LFGKL  GG  VKV L  ++ +     FEI     ++S
Sbjct: 707 RPMGRLIQEKIKQPLAEELLFGKLVDGGE-VKVHLKENEPS-----FEIVPGAPSVS 757


>gi|310815409|ref|YP_003963373.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Ketogulonicigenium vulgare Y25]
 gi|308754144|gb|ADO42073.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Ketogulonicigenium vulgare Y25]
          Length = 769

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/759 (57%), Positives = 582/759 (76%), Gaps = 12/759 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+ +LE+ +H AL +AN  +HE ATLEHLLLAL+D+ DAA V+ +C VD+  L+ +L
Sbjct: 1   MPSFTNSLEQSIHSALSIANAHHHELATLEHLLLALLDEPDAAHVLRACAVDMTDLRKSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +++D+D +  +      E  PT++FQRV+QRA +HVQS GR  VTGAN++VALF+E +S
Sbjct: 61  EDFVDDDLTTLVTTVEGSEAVPTAAFQRVIQRAAIHVQSAGRVEVTGANVIVALFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQEQ+MT YDAVNFI+HG++K  +FA  ++   V+G++ G D      D + K  
Sbjct: 121 HAVYFLQEQDMTRYDAVNFIAHGVAKDPDFAENRT---VNGATNGEDRSAPTGDEKEK-- 175

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL  K +KG VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 176 -----ALAKYCVDLNSKARKGDVDPLIGRDLEVERAIQVLCRRRKNNPLLVGDPGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +IV G VP++L    I+SLDMG L+AGTRYRGDFEER+K +VKE+E + +A+L
Sbjct: 231 IAEGLAWKIVQGDVPEVLAATTIYSLDMGALLAGTRYRGDFEERLKAVVKELEDHPDAVL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL+ G +RC+GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALAGGKLRCMGSTTYKEFRQHFEKDRALARRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPSI+DA++I++G+KP FEEHH ++Y+ +AIRA+V+L+ R+   RKLPD AID+I
Sbjct: 351 KIDVNEPSIDDAVKILRGLKPNFEEHHGVKYTNDAIRASVELAARYIHDRKLPDSAIDII 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L P S+RRK I+ K+++  +A + R I     S+DD + L +LE +L  VV+
Sbjct: 411 DEAGAAQHLVPESRRRKTISVKEVEAVVAKIAR-IPPKQVSKDDAATLKDLEPSLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L+S+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV++LRFDM
Sbjct: 470 GQDKAIEALASAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVEMLRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D +DQ+P+SV+LLDEIEK+HPDV NILLQ+M
Sbjct: 530 SEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGIDQHPHSVLLLDEIEKAHPDVFNILLQVM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+++ FRNVILIMT+NAGA + ++  +GFG  R +  D  A+    +PEF 
Sbjct: 590 DHGKLTDHNGRQVDFRNVILIMTSNAGAADQAREALGFGRDRREGEDTAAIERTFTPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL+ + I +VV KF+++LE QL ++ + F  S     WL   GYD KMGA
Sbjct: 650 NRLDAVIAFAPLAKETISKVVEKFVLQLEAQLLDRNVHFELSPAAAAWLGDEGYDEKMGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           RPL R+I+EH+K PLA+E+LFG L+K GG+V+V +   K
Sbjct: 710 RPLARVIQEHIKKPLAEELLFGSLQK-GGLVRVGVKDGK 747


>gi|332187792|ref|ZP_08389526.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Sphingomonas
           sp. S17]
 gi|332012142|gb|EGI54213.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Sphingomonas
           sp. S17]
          Length = 772

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/751 (58%), Positives = 558/751 (74%), Gaps = 12/751 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+  LE  LH+AL  A  R HEYATLEHLLLALIDD  A+ VM +C+VDL  LK  +
Sbjct: 1   MPSFAPALETTLHKALEAATVRRHEYATLEHLLLALIDDEHASKVMEACHVDLGELKATV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D +  + LK     +  PTS FQRVVQRA+LHVQS+GR  VTGAN+LVALFSE +S
Sbjct: 61  AQYLDAEL-DALKVEAATDPSPTSGFQRVVQRAILHVQSSGRDEVTGANVLVALFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+M+  DAV+FISHG+ K            V+        E    +      
Sbjct: 120 YAVYFLQQQDMSRLDAVSFISHGVGKGGAATESAPPKGVEEEKPAKPTEKGKGES----- 174

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  + VDL EK K GKVD L+GR  E++RT+QILCRRSKNNPLYVGDPGVGKTA
Sbjct: 175 -----ALKQFTVDLNEKAKLGKVDPLIGRGPEVDRTVQILCRRSKNNPLYVGDPGVGKTA 229

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G VP++L  A I+SLDMG L+AGTRYRGDFEER+K +V E+E   +A+L
Sbjct: 230 IAEGLARKIVEGDVPEVLRQAVIYSLDMGALLAGTRYRGDFEERLKAVVNELEKLPHAVL 289

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALS G +RCIGSTTY E+R  FEKD+AL+RRFQ
Sbjct: 290 FIDEIHTVIGAGATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFRNHFEKDRALLRRFQ 349

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+IED I+I+ G++  FEEHHQ++Y+ +AI++AV+LS R+   RKLPDKAIDVI
Sbjct: 350 KIDVNEPTIEDTIKILAGLRSAFEEHHQVKYTPDAIKSAVELSARYIADRKLPDKAIDVI 409

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA Q+L P+SKR+K IT K+I+  IA+M R I   S S DD   L  LE +L  VV+
Sbjct: 410 DEVGAMQMLVPVSKRKKTITPKEIEAVIATMAR-IPPKSVSTDDRQQLETLETDLKRVVF 468

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ  AI+ LSS+IK++RAGL DP+KPIG Y+F+GPTGVGKTE+++QLA  LG+ L RFDM
Sbjct: 469 GQNAAIENLSSAIKLSRAGLRDPDKPIGNYLFTGPTGVGKTEVARQLATILGIPLQRFDM 528

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH+VSRLIGAPPGYVG+ QGG+L D+VDQNP+SV+LLDEIEK+HPD+ NILLQ+M
Sbjct: 529 SEYMERHSVSRLIGAPPGYVGYDQGGLLTDAVDQNPHSVLLLDEIEKAHPDLFNILLQVM 588

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GK + FRN I+IMTTNAGA +M++  +GFG+   +  D++A++   +PEF 
Sbjct: 589 DNGKLTDHHGKTVDFRNTIIIMTTNAGAADMARETVGFGNLTREGEDEQAVQKMFTPEFR 648

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF  L  +++ +VV KFI++LELQL ++ +     E   +WL   GYD   GA
Sbjct: 649 NRLDAIVPFGYLPPEVVARVVDKFILQLELQLADRNVHISLDEAAKSWLTEKGYDRLYGA 708

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           RP+ R+I+E +K PLA+E+LFGKL  GG V 
Sbjct: 709 RPMGRLIQEKIKQPLAEELLFGKLVHGGEVT 739


>gi|94498369|ref|ZP_01304927.1| ATP dependent Clp protease [Sphingomonas sp. SKA58]
 gi|94422124|gb|EAT07167.1| ATP dependent Clp protease [Sphingomonas sp. SKA58]
          Length = 776

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/750 (58%), Positives = 566/750 (75%), Gaps = 12/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+  LE  LH AL  A+ER HEYATLEHLLLALIDD  A+ VM +C V+L  L + +
Sbjct: 1   MPSFAAALETTLHNALTHASERRHEYATLEHLLLALIDDDHASKVMQACGVELGELGDAV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +Y+D +  + LK     +  PTS FQRVVQRA+LHVQS+G+  VTGAN+LVALFSE +S
Sbjct: 61  THYLDTEL-DSLKVEGSSDPSPTSGFQRVVQRAILHVQSSGKDEVTGANVLVALFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+M+  DAV+FISHG+ K       Q       +   ++ E  V D + K D
Sbjct: 120 YAVYFLQQQDMSRLDAVSFISHGVGKGTPTPERQE------TKGTAEEEKKVQDGKGKKD 173

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  + V+L EK  +GKVD L+GR  E++RT+QILCRRSKNNPLYVGDPGVGKTA
Sbjct: 174 ----SALDQFTVNLNEKADRGKVDPLIGRSAEVDRTVQILCRRSKNNPLYVGDPGVGKTA 229

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++I++G VPD+L  A I+SLDMG L+AGTRYRGDFEER+K +V E+E   +A+L
Sbjct: 230 IAEGLARKIIEGDVPDVLKEAVIYSLDMGALLAGTRYRGDFEERLKAVVTELEKMPHAVL 289

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALS G +RCIGSTTY E+R  FEKD+AL+RRFQ
Sbjct: 290 FIDEIHTVIGAGATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFRNHFEKDRALLRRFQ 349

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP+I+D I+I+ G++  FEEHH ++Y+ +AI+AAV+LS R+   RKLPDKAIDVI
Sbjct: 350 KIDVNEPTIDDTIKILAGLRSAFEEHHSVKYTPDAIKAAVELSARYINDRKLPDKAIDVI 409

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA Q+L   SKR+K IT K+I++ IA+M R I   + S DD SVL +L  +L  VV+
Sbjct: 410 DEVGAMQMLVVPSKRKKTITPKEIEQVIATMAR-IPPKTVSSDDKSVLESLTTDLKRVVF 468

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ LSS+IK++RAGL DP+KPIG Y+FSGPTGVGKTE+++QLA  LG+ L RFDM
Sbjct: 469 GQDKAIEVLSSAIKLSRAGLRDPDKPIGNYLFSGPTGVGKTEVARQLATLLGIPLQRFDM 528

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH+VSRLIGAPPGYVG+ QGG+L D+VDQNP+SV+LLDEIEK+HPD+ NILLQ+M
Sbjct: 529 SEYMERHSVSRLIGAPPGYVGYDQGGLLTDAVDQNPHSVLLLDEIEKAHPDLFNILLQVM 588

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GK + FRN ILIMTTNAGA +M+K  IGFG    DD  ++A++   +PEF 
Sbjct: 589 DNGRLTDHHGKTVDFRNTILIMTTNAGASDMAKESIGFGELTRDDVQEDAVKKLFTPEFR 648

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF  L  +I+ +V+ KF+++LELQL ++ +     ++   WL   GYD   GA
Sbjct: 649 NRLDAIVPFGYLPPEIVARVIDKFVLQLELQLADRDVHITLDDDAKAWLTKKGYDKLYGA 708

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RP+ R+++E +K PLA+E+LFGKL  GG V
Sbjct: 709 RPMGRLMQEKIKQPLAEELLFGKLVHGGEV 738


>gi|126728272|ref|ZP_01744088.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Sagittula
           stellata E-37]
 gi|126711237|gb|EBA10287.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Sagittula
           stellata E-37]
          Length = 776

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/762 (58%), Positives = 574/762 (75%), Gaps = 13/762 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R+HE+ATLEHLLLALID+ DA+ VM +C+VD + L+  L
Sbjct: 1   MPSFSNTLEQAIHSALALANSRSHEFATLEHLLLALIDEPDASRVMKACSVDTEELRTTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + +ID+D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFIDDDLSNLVTDIEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFAN---FQSKLNVDGSSAGSDGEGFVNDYQA 177
           +A YFLQEQ+MT YDAVNFI+HG++K   +      Q     +  +A ++     ND ++
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKNPAYGEARPVQGATEAEEEAAQTESAAPANDKES 180

Query: 178 KTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG 237
                   AL  YCVDL  K + G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVG
Sbjct: 181 --------ALGKYCVDLNAKAEIGDIDPLIGRDHEVERCIQVLCRRRKNNPLLVGDPGVG 232

Query: 238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN 297
           KTAIAEG A++IV G VP++L  A I+SLDMG L+AGTRYRGDFEER+K +V E+E + +
Sbjct: 233 KTAIAEGLARKIVAGEVPEVLSEATIYSLDMGALLAGTRYRGDFEERLKAVVTELEEHPD 292

Query: 298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR 357
           A+L+IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL R
Sbjct: 293 AVLFIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALSR 352

Query: 358 RFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI 417
           RFQKIDV+EPS+ED I+I+KG+KPYFEEHH ++Y+ +AI+ AV+LS R+   RKLPDKAI
Sbjct: 353 RFQKIDVNEPSVEDTIKILKGLKPYFEEHHAIKYTGDAIKTAVELSARYINDRKLPDKAI 412

Query: 418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGT 477
           DVIDEAGA+Q L   SKRRK I  K+I++ +A + R I   + S+DD  VL +LE  L  
Sbjct: 413 DVIDEAGAAQHLVAASKRRKSIGTKEIEEVVAKIAR-IPPKNVSKDDAEVLKDLEGTLKR 471

Query: 478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLR 537
           VV+GQ+ AI  LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLR
Sbjct: 472 VVFGQDAAIAALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLASTLGVELLR 531

Query: 538 FDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL 597
           FDMSEYME+HAVSRLIGAPPGYVGF QGG L D VDQ+P+ V+LLDEIEK+HPDV NILL
Sbjct: 532 FDMSEYMEKHAVSRLIGAPPGYVGFDQGGQLTDGVDQHPHCVLLLDEIEKAHPDVFNILL 591

Query: 598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP 657
           Q+MD+G LTD +G+ + FRNVILIMT+NAGA E +KA IGFG  R +  D  A+    +P
Sbjct: 592 QVMDHGTLTDHNGRSVDFRNVILIMTSNAGAAEQAKAAIGFGRDRREGEDTAAIERTFTP 651

Query: 658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVK 717
           EF NRLD++I F PL  + I  VV KF+++LE QL ++ ++   +     WL   GYD K
Sbjct: 652 EFRNRLDAVISFAPLPKETILAVVEKFVLQLEAQLMDRNVTIELTRPAAEWLAEKGYDDK 711

Query: 718 MGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           MGARPL R+I+EH+K PLA+E+LFGKL K GG+VKVS+  D+
Sbjct: 712 MGARPLGRVIQEHIKKPLAEELLFGKLTK-GGIVKVSVKDDE 752


>gi|307294290|ref|ZP_07574134.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Sphingobium
           chlorophenolicum L-1]
 gi|306880441|gb|EFN11658.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Sphingobium
           chlorophenolicum L-1]
          Length = 773

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/750 (57%), Positives = 563/750 (75%), Gaps = 11/750 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  F+  LE  LH AL  A+ER HEYATLEHLLLALIDD  A+ VM +C V+L  L + +
Sbjct: 1   MPSFAPALETTLHNALTHASERRHEYATLEHLLLALIDDEHASKVMQACGVELGELNDAV 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             Y+D++  + LK     +  PTS FQRVVQRA+LHVQS+G+  VTGAN+LVALFSE +S
Sbjct: 61  TQYLDSEL-DSLKVEGASDPSPTSGFQRVVQRAILHVQSSGKDEVTGANVLVALFSERES 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQ+Q+M+  DAV++ISHG+ K       Q +     +   ++ E    D + K D
Sbjct: 120 YAVYFLQQQDMSRLDAVSYISHGVGKGTAVPEQQRE-----TKGAAEEEKKTQDSKGKKD 174

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL  + V+L EK  +GKVD L+GR  E++RTIQILCRRSKNNPLYVGDPGVGKTA
Sbjct: 175 ----SALEQFTVNLNEKAARGKVDPLIGRASEVDRTIQILCRRSKNNPLYVGDPGVGKTA 230

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV+G VPD+L  A I+SLDMG L+AGTRYRGDFEER+K +V E+E   +A+L
Sbjct: 231 IAEGLARKIVEGEVPDVLKEAVIYSLDMGALLAGTRYRGDFEERLKAVVTELEKMPHAVL 290

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPALS G +RCIGSTTY E+R  FEKD+AL+RRFQ
Sbjct: 291 FIDEIHTVIGAGATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFRNHFEKDRALLRRFQ 350

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++ED I+I+ G++  FEEHH ++Y+ +AI+AAV+LS R+   RKLPDKAIDVI
Sbjct: 351 KIDVNEPTVEDTIKILAGLRSAFEEHHNVKYTPDAIKAAVELSARYINDRKLPDKAIDVI 410

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA Q+L   SKR+K IT ++I++ IA+M R I   + S DD SVL  L+ +L  VV+
Sbjct: 411 DEVGAMQMLVVPSKRKKTITPREIEQVIATMAR-IPPKTVSADDKSVLETLDTDLKRVVF 469

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ  AI+ LSS+IK++RAGL DP+KPIG Y+FSGPTGVGKTE+++QLA  LG+ L RFDM
Sbjct: 470 GQNRAIEVLSSAIKLSRAGLRDPDKPIGNYLFSGPTGVGKTEVARQLATLLGIPLQRFDM 529

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH+VSRLIGAPPGYVG+ QGG+L D+VDQNP+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 530 SEYMERHSVSRLIGAPPGYVGYDQGGLLTDAVDQNPHCVLLLDEIEKAHPDLFNILLQVM 589

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD  GK + FRN ILIMTTNAGA +M+K  IGFG    +D  ++A++   +PEF 
Sbjct: 590 DNGRLTDHHGKTVDFRNTILIMTTNAGASDMAKESIGFGEFTREDVQEDAVKKLFTPEFR 649

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+++PF  L  +I+ +V+ KF+++LELQL ++ +     +E   WL   GYD   GA
Sbjct: 650 NRLDAVVPFGYLPPEIVARVIDKFVLQLELQLADRDVHITLDDEAKAWLTKRGYDKLYGA 709

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RP+ R+++E +K PLA+E+LFGKL  GG V
Sbjct: 710 RPMGRLMQEKIKQPLAEELLFGKLVHGGEV 739


>gi|56698001|ref|YP_168372.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Ruegeria
           pomeroyi DSS-3]
 gi|56679738|gb|AAV96404.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Ruegeria
           pomeroyi DSS-3]
          Length = 775

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/761 (57%), Positives = 580/761 (76%), Gaps = 20/761 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL  ANER HE+ATLEHLLLAL+D+ DA  VM +C+VDLK L++ L
Sbjct: 1   MPSFSSTLEQAIHAALAAANERRHEFATLEHLLLALLDEPDAVRVMQACSVDLKELRDTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + ++D D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFVDEDLSNLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVD------GSSAGSDGEGFVND 174
           +A YFLQEQ+MT YDAVNFI+HG++K   F   +     +       S+   DGE     
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPAFGENRPVTGAEHGEEETSSAPSGDGE----- 175

Query: 175 YQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDP 234
            Q ++      ALS YCV+L  K + G +D L+GR  E+ R IQ+LCRR KNNPL VGDP
Sbjct: 176 -QKES------ALSKYCVNLNAKSRAGDIDPLIGRDHEVERCIQVLCRRRKNNPLLVGDP 228

Query: 235 GVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES 294
           GVGKTAIAEG A++IV G +P++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E 
Sbjct: 229 GVGKTAIAEGLARKIVAGEIPEVLSKTTIYSLDMGALLAGTRYRGDFEERLKAVVNELED 288

Query: 295 YANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKA 354
           + +A+L+IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+A
Sbjct: 289 HPDAVLFIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRA 348

Query: 355 LVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD 414
           L RRFQKIDV+EP++ED+++I+KG+KPYFEEHH++RY+ +AI++AV+LS R+   RKLPD
Sbjct: 349 LSRRFQKIDVNEPTVEDSVKILKGLKPYFEEHHEVRYTADAIKSAVELSARYINDRKLPD 408

Query: 415 KAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKN 474
           KAIDVIDEAGA+Q L   SKRRK I  K+I+  +A + R I   + ++DD  VL +LE +
Sbjct: 409 KAIDVIDEAGAAQHLVAESKRRKTIGVKEIEAVVAKIAR-IPPKNVTKDDAEVLKDLEAS 467

Query: 475 LGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQ 534
           L  VV+GQ++AI+ LSS+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+
Sbjct: 468 LKRVVFGQDKAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLAETLGVE 527

Query: 535 LLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLN 594
           LLRFDMSEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPDV N
Sbjct: 528 LLRFDMSEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEMEKAHPDVYN 587

Query: 595 ILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNF 654
           ILLQ+MD+G LTD +G+ ++FRNV+LIMT+NAGA E +K+ IGFG  R +  D  A+   
Sbjct: 588 ILLQVMDHGQLTDHNGRTVNFRNVVLIMTSNAGAAEQAKSAIGFGRDRREGEDTAAIERT 647

Query: 655 LSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGY 714
            +PEF NRLD++I F PL  ++I QVV KF+++LE QL ++ +    + +   WL   GY
Sbjct: 648 FTPEFRNRLDAVISFAPLPKEVILQVVEKFVLQLEAQLMDRHVHIELTPQAAEWLADKGY 707

Query: 715 DVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           D KMGARPL R+I+EH+K PLA+E+LFGKL K GGVV+VS+
Sbjct: 708 DDKMGARPLGRVIQEHIKKPLAEELLFGKLAK-GGVVRVSV 747


>gi|89053532|ref|YP_508983.1| ATPase AAA-2 [Jannaschia sp. CCS1]
 gi|88863081|gb|ABD53958.1| ATPase AAA-2 [Jannaschia sp. CCS1]
          Length = 785

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/757 (57%), Positives = 567/757 (74%), Gaps = 26/757 (3%)

Query: 4   FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNY 63
           FS  LE+ +H AL  AN R HE ATLEHLLLALID+ DA  VM +C+VD++VL++ L  +
Sbjct: 12  FSNTLEQAIHAALANANARRHELATLEHLLLALIDEPDAQKVMKACSVDIEVLRDTLSKF 71

Query: 64  IDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHAT 123
           ID+D S    +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S+A 
Sbjct: 72  IDDDLSTLETDVEGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERESNAA 131

Query: 124 YFLQEQEMTLYDAVNFISHGISKRKEFA----------NFQSKLNVDGSSAGSDGEGFVN 173
           YFLQEQ+MT YDAVNFI+HG++K   +           + Q   NV   + G + E    
Sbjct: 132 YFLQEQDMTRYDAVNFIAHGVAKDPSYGEARPVTGAEDDEQVTPNVQDDAGGEEKES--- 188

Query: 174 DYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGD 233
                       ALS YCVDL  K  KG VD L+GR  E+ R IQ+LCRR KNNPL VGD
Sbjct: 189 ------------ALSKYCVDLNAKATKGDVDPLIGRASEVERCIQVLCRRRKNNPLLVGD 236

Query: 234 PGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIE 293
           PGVGKTAIAEG AK+IV+G  P++L  A IFSLDMG L+AGTRYRGDFEER+K +VKE+E
Sbjct: 237 PGVGKTAIAEGLAKKIVEGETPEVLENATIFSLDMGALLAGTRYRGDFEERLKAVVKELE 296

Query: 294 SYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDK 353
            + +A+L+IDEIHT++GAG+ SG ++DASNLLKPAL  G +RC+GSTTY E+RQ FEKD+
Sbjct: 297 DHPDAVLFIDEIHTVIGAGATSGGAMDASNLLKPALQGGGLRCMGSTTYKEFRQHFEKDR 356

Query: 354 ALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLP 413
           AL RRFQKIDV EPS++DA++I+KG+KPYFEEHH ++Y+ +AI+ +V+L+ R+   RKLP
Sbjct: 357 ALSRRFQKIDVEEPSVDDAVKILKGLKPYFEEHHSVKYTADAIKTSVELASRYINDRKLP 416

Query: 414 DKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEK 473
           D AIDVIDEAGA+Q L   SKRRK I  K+++  +A + R I   + S+DD  VL +LE 
Sbjct: 417 DSAIDVIDEAGAAQHLVVESKRRKTIGTKEVEDVVAKIAR-IPPKTVSKDDAIVLKDLEV 475

Query: 474 NLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGV 533
           +L  VV+GQ++AI+ L+SSIK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV
Sbjct: 476 SLKRVVFGQDKAIEALASSIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGV 535

Query: 534 QLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVL 593
           +L+RFDMSEYME+HAVSRLIGAPPGYVGF QGG+L D +DQ+P+ V+LLDEIEK+HPDV 
Sbjct: 536 ELIRFDMSEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGIDQHPHCVLLLDEIEKAHPDVF 595

Query: 594 NILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRN 653
           NILLQ+MD+G LTD +G+ + FRNV+LIMT+NAGA E +KA IGF   R +  D  A+  
Sbjct: 596 NILLQVMDHGTLTDHNGRSVDFRNVVLIMTSNAGAAEQAKAAIGFNRDRREGEDTAAIER 655

Query: 654 FLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHG 713
             +PEF NRLD++I F PL  ++I QVV KF+++LE QL ++ ++   ++    WL   G
Sbjct: 656 TFTPEFRNRLDAVISFGPLPKEVILQVVEKFVLQLEAQLMDRNVTIELTKPAAEWLADKG 715

Query: 714 YDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           YD +MGARPL R+I+EH+K PLA+E+LFGKL KGG V
Sbjct: 716 YDDRMGARPLGRVIQEHIKKPLAEELLFGKLAKGGNV 752


>gi|260432833|ref|ZP_05786804.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416661|gb|EEX09920.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 774

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/756 (58%), Positives = 575/756 (76%), Gaps = 11/756 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL  ANER HE+ATLEHLLLAL+++ DAA VM +C+VDL+ L+ +L
Sbjct: 1   MPSFSSTLEQAIHAALAAANERRHEFATLEHLLLALLEEPDAARVMKACSVDLEELRRSL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + +ID D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFIDEDLSNLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVD-GSSAGSDGEGFVNDYQAKT 179
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +     D G        G  +  ++  
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPAYGENRPVTGADQGDEEPQSSAGETDQKES-- 178

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                 AL  YCVDL  K + G VD L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKT
Sbjct: 179 ------ALGKYCVDLNAKARAGDVDPLIGRAAEVERCIQVLCRRRKNNPLLVGDPGVGKT 232

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A +IV G  P++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+
Sbjct: 233 AIAEGLAYKIVQGDAPEVLANTTIYSLDMGALLAGTRYRGDFEERLKAVVTELEDHPDAV 292

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL RRF
Sbjct: 293 LFIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALSRRF 352

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV+EPS+ED+++I++G+KPYFEEHH ++Y+ +AI+ AV+LS R+   RKLPDKAIDV
Sbjct: 353 QKIDVNEPSVEDSVKILRGLKPYFEEHHDIKYTADAIKTAVELSARYINDRKLPDKAIDV 412

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA+Q L   SKRRK I  K+I+  +A + R I   + ++DD  VL +LE +L  VV
Sbjct: 413 IDEAGAAQHLVAESKRRKTIGVKEIEAVVAKIAR-IPPKNVTKDDAEVLKDLEASLKRVV 471

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ++AI+ L+S+IK+ARAGL +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFD
Sbjct: 472 FGQDQAIEALASAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFD 531

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+
Sbjct: 532 MSEYMEKHAVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNILLQV 591

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G+ ++FRNV+LIMT+NAGA E +KA IGFG  R +  D  A+    +PEF
Sbjct: 592 MDHGELTDHNGRTVNFRNVVLIMTSNAGAQEQAKAAIGFGRDRREGEDTAAIERTFTPEF 651

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD++I F PL  ++I QVV KF+++LE QL ++G++   + +   WL   GYD KMG
Sbjct: 652 RNRLDAVISFAPLPKEVILQVVEKFVLQLEAQLLDRGVTIDLTPKAAEWLADKGYDDKMG 711

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           ARPL R+I+EH+K PLA+E+LFGKL K GGVV+VS+
Sbjct: 712 ARPLGRVIQEHIKKPLAEELLFGKLAK-GGVVRVSV 746


>gi|83952816|ref|ZP_00961546.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Roseovarius
           nubinhibens ISM]
 gi|83835951|gb|EAP75250.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Roseovarius
           nubinhibens ISM]
          Length = 750

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/731 (57%), Positives = 554/731 (75%), Gaps = 5/731 (0%)

Query: 29  LEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKPTSSFQR 88
           +EHLLLAL+D+ DAA VM +C+VD + L+  L+++ID + SN + +    E  PT++FQR
Sbjct: 1   MEHLLLALVDEPDAARVMKACSVDTEELRGTLVDFIDEELSNLVTDIEGSEAVPTAAFQR 60

Query: 89  VVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRK 148
           V+QRA +HVQS+GR  VTGAN+LVA+F+E +S+A +FLQEQ+MT YDAVN+I+HG++K  
Sbjct: 61  VIQRAAIHVQSSGRTEVTGANVLVAIFAERESNAAFFLQEQDMTRYDAVNYIAHGVAKDP 120

Query: 149 EFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVG 208
            F   +     D   + S   G     Q +   +   AL+ YCVDL +K + G VD L+G
Sbjct: 121 AFGESRPVTGADAEDSSSSHSGGDGTEQVQEGES---ALAKYCVDLNQKSRAGDVDPLIG 177

Query: 209 RHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDM 268
           R  E+ R IQ+LCRR KNNPL VGDPGVGKTAIAEG A +IV G  P+IL    I+SLDM
Sbjct: 178 RASEVERCIQVLCRRRKNNPLLVGDPGVGKTAIAEGLAYKIVKGETPEILSKTTIYSLDM 237

Query: 269 GNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPA 328
           G L+AGTRYRGDFEER+K ++ E+E++ +A+L+IDEIHT++GAG+ SG ++DASNLLKPA
Sbjct: 238 GALLAGTRYRGDFEERLKAVMTELENHPDAVLFIDEIHTVIGAGATSGGAMDASNLLKPA 297

Query: 329 LSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQ 388
           L  G +RC+GSTTY E+RQ FEKD+AL RRFQKIDV EPS+EDA++I+KG+KPYFE+HH 
Sbjct: 298 LQGGKLRCMGSTTYKEFRQHFEKDRALSRRFQKIDVVEPSVEDAVKILKGLKPYFEDHHS 357

Query: 389 LRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTI 448
           ++Y+ +AI+ AV+LS R+   RKLPDKAIDVIDEAGA+Q L   SKRRK I  K+I++ +
Sbjct: 358 VKYTNDAIQTAVELSSRYINDRKLPDKAIDVIDEAGAAQHLLAASKRRKSIGTKEIEEVV 417

Query: 449 ASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIG 508
           A + R I   + S+DD  VL +L  +L  VV+GQ+ AI+ LSS+IK+ARAGL +P KPIG
Sbjct: 418 AKIAR-IPPKNVSKDDAEVLKDLAASLKRVVFGQDTAIEALSSAIKLARAGLREPEKPIG 476

Query: 509 CYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGIL 568
            Y+F+GPTGVGKTE++KQL+  LGV+LLRFDMSEYME+HAVSRLIGAPPGYVGF QGG+L
Sbjct: 477 NYLFAGPTGVGKTEVAKQLSMTLGVELLRFDMSEYMEKHAVSRLIGAPPGYVGFDQGGLL 536

Query: 569 ADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGA 628
            D VDQ+P+ V+LLDEIEK+HPDV NILLQ+MD+G LTD +G+ + FRNVILIMT+NAGA
Sbjct: 537 TDGVDQHPHCVLLLDEIEKAHPDVYNILLQVMDHGQLTDHNGRTVDFRNVILIMTSNAGA 596

Query: 629 LEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKL 688
            E +K  IGFG  R +  D  A+    +PEF NRLD++I F  L  ++I QVV KF+++L
Sbjct: 597 AEQAKEAIGFGRDRREGEDTAAIERTFTPEFRNRLDAVISFGALPKEVILQVVEKFVLQL 656

Query: 689 ELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGG 748
           E QL ++ ++   + +   WL   GYD KMGARPL R+I+EH+K PLA+E+LFGKL K G
Sbjct: 657 EAQLLDRKVTIELTPKAAEWLADKGYDSKMGARPLGRVIQEHIKKPLAEELLFGKLAK-G 715

Query: 749 GVVKVSLNPDK 759
           G+VKV +   K
Sbjct: 716 GIVKVGIKDGK 726


>gi|126739846|ref|ZP_01755537.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Roseobacter
           sp. SK209-2-6]
 gi|126719078|gb|EBA15789.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Roseobacter
           sp. SK209-2-6]
          Length = 743

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/731 (57%), Positives = 555/731 (75%), Gaps = 16/731 (2%)

Query: 33  LLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKPTSSFQRVVQR 92
           +LALI++ +AA VM +C+V+L  L+++L+ +ID D SN + +    E  PT++FQRV+QR
Sbjct: 1   MLALIEEPEAARVMRACSVELGELRSSLIEFIDEDLSNLVTDVDGSEAVPTAAFQRVIQR 60

Query: 93  AVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFAN 152
           A +HVQS+GR  VTGAN+LVA+F+E +S A YFLQ+Q+MT YDAVNFI+HG++K   +  
Sbjct: 61  AAIHVQSSGRTEVTGANVLVAIFAERESDAAYFLQDQDMTRYDAVNFIAHGVAKDPAYGE 120

Query: 153 FQ----SKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVG 208
            +    +K N D + + +  EG   +           AL  YCVDL  K ++G +D L+G
Sbjct: 121 SRPVTGAKDNDDDTMSAAPSEGEKKES----------ALDKYCVDLNAKSREGDIDPLIG 170

Query: 209 RHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDM 268
           R  E+ R IQ+LCRR KNNPL VGDPGVGKTAIAEG A++IV G VP++L    IFSLDM
Sbjct: 171 RGHEVERCIQVLCRRRKNNPLLVGDPGVGKTAIAEGLARKIVQGEVPEVLSQTTIFSLDM 230

Query: 269 GNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPA 328
           G L+AGTRYRGDFEER+K +V E+E + + +L+IDEIHT++GAG+ SG ++DASNLLKPA
Sbjct: 231 GALLAGTRYRGDFEERLKAVVNELEDHPDGVLFIDEIHTVIGAGATSGGAMDASNLLKPA 290

Query: 329 LSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQ 388
           L  G +R +GSTT+ E+RQ FEKD+AL RRFQKIDV+EPS+ D+I+I+KG+KPYFEEHH 
Sbjct: 291 LQGGKLRTMGSTTFKEFRQHFEKDRALSRRFQKIDVNEPSVPDSIDILKGLKPYFEEHHG 350

Query: 389 LRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTI 448
           ++++ +AI+ AV+LS R+   RKLPDKAIDVIDEAGA+Q L P SKRRK I  K+I+  +
Sbjct: 351 IKFTADAIKTAVELSARYINDRKLPDKAIDVIDEAGAAQHLVPESKRRKTIGVKEIEAVV 410

Query: 449 ASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIG 508
           A + R I   S S+DD  VL +LEK L  VV+GQ++AI  LSS+IK+ARAGL +P KPIG
Sbjct: 411 AKIAR-IPPKSVSKDDAEVLKDLEKTLKRVVFGQDDAIDALSSAIKLARAGLREPEKPIG 469

Query: 509 CYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGIL 568
            Y+F+GPTGVGKTE++KQLA  LGV+LLRFDMSEYME+HAVSRLIGAPPGYVGF QGG+L
Sbjct: 470 NYLFAGPTGVGKTEVAKQLADTLGVELLRFDMSEYMEKHAVSRLIGAPPGYVGFDQGGLL 529

Query: 569 ADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGA 628
            D VDQ+P+ V+LLDEIEK+HPDV NILLQ+MD G LTD +G+ ++FRNV+LIMT+NAGA
Sbjct: 530 TDGVDQHPHCVLLLDEIEKAHPDVFNILLQVMDNGQLTDHNGRAVNFRNVVLIMTSNAGA 589

Query: 629 LEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKL 688
            +M+KA IGFG  R +  D  A+    +PEF NRLD++I F PL  ++I QVV KF+++L
Sbjct: 590 SDMAKAAIGFGRDRREGEDTAAIERTFTPEFRNRLDAVIGFAPLPKEVILQVVEKFVLQL 649

Query: 689 ELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGG 748
           E QL ++ +S   + +   WL   GYD +MGARPL R+I+EH+K PLA+E+LFGKL K G
Sbjct: 650 EAQLMDRNVSIELTRKAAEWLAEKGYDDRMGARPLGRVIQEHIKKPLAEELLFGKLAK-G 708

Query: 749 GVVKVSLNPDK 759
           G+VKV +   K
Sbjct: 709 GLVKVGIKDGK 719


>gi|254510894|ref|ZP_05122961.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Rhodobacteraceae bacterium KLH11]
 gi|221534605|gb|EEE37593.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Rhodobacteraceae bacterium KLH11]
          Length = 767

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/736 (58%), Positives = 563/736 (76%), Gaps = 9/736 (1%)

Query: 20  NERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVE 79
           NER HE+ATLEHLLLAL+++ DA  VM +C+VDL  L++ L+ +ID D SN + +    E
Sbjct: 13  NERRHEFATLEHLLLALLEEPDAIRVMKACSVDLDELRSTLVEFIDEDLSNLVTDIDGSE 72

Query: 80  CKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNF 139
             PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S+A YFLQEQ+MT YDAVNF
Sbjct: 73  AVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERESNAAYFLQEQDMTRYDAVNF 132

Query: 140 ISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVK 199
           I+HG++K   +   ++    D      + E        +T+     AL  YC+DL  K +
Sbjct: 133 IAHGVAKDPAYGENRAVTGAD------EPEEETQTASGETEQK-ESALGKYCIDLNAKSR 185

Query: 200 KGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILL 259
            G VD L+GR +E+ R IQ+LCRR KNNPL VGDPGVGKTAIAEG A +IV G  PD+L 
Sbjct: 186 AGDVDPLIGRSDEVERCIQVLCRRRKNNPLLVGDPGVGKTAIAEGLAHKIVGGEAPDVLS 245

Query: 260 GARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISV 319
              I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L+IDEIHT++GAG+ SG ++
Sbjct: 246 ETTIYSLDMGALLAGTRYRGDFEERLKAVVTELEDHPDAVLFIDEIHTVIGAGATSGGAM 305

Query: 320 DASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGI 379
           DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL RRFQKIDV+EPS+ED+++I++G+
Sbjct: 306 DASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALSRRFQKIDVNEPSVEDSVKILRGL 365

Query: 380 KPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFI 439
           KPYFE+HH+++Y+ +AI+ AV+L+ R+   RKLPDKAIDVIDEAGA+Q L   SKRRK I
Sbjct: 366 KPYFEKHHEIKYTADAIKTAVELAARYINDRKLPDKAIDVIDEAGAAQHLVAESKRRKTI 425

Query: 440 TEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAG 499
             K+I+  +A + R I   + ++DD  VL +LE +L  VV+GQ+EAI+ LSS+IK+ARAG
Sbjct: 426 GVKEIEAVVAKIAR-IPPKNVTKDDAEVLKDLEASLKRVVFGQDEAIEALSSAIKLARAG 484

Query: 500 LSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGY 559
           L +P KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDMSEYME+HAVSRLIGAPPGY
Sbjct: 485 LREPEKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDMSEYMEKHAVSRLIGAPPGY 544

Query: 560 VGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVI 619
           VGF QGG+L D VDQ+P+ V+LLDEIEK+HPDV NILLQ+MD+G LTD +G+ ++FRNV+
Sbjct: 545 VGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDVFNILLQVMDHGELTDHNGRTVNFRNVV 604

Query: 620 LIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQ 679
           LIMT+NAGA E +KA IGF   R +  D  A+    +PEF NRLD++I F PL  ++I Q
Sbjct: 605 LIMTSNAGAQEQAKAAIGFARDRREGEDTAAIERTFTPEFRNRLDAVISFAPLPKEVILQ 664

Query: 680 VVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEI 739
           VV KF+++LE QL ++ ++   + +   WL   GYD KMGARPL R+I+EH+K PLA+E+
Sbjct: 665 VVEKFVLQLEAQLLDRNVTIDLTRKAAEWLADEGYDDKMGARPLGRVIQEHIKKPLAEEL 724

Query: 740 LFGKLKKGGGVVKVSL 755
           LFGKL K GGVV+VS+
Sbjct: 725 LFGKLAK-GGVVRVSV 739


>gi|163745694|ref|ZP_02153054.1| ATP-dependent Clp protease, ATP-binding subunit ClpA, putative
           [Oceanibulbus indolifex HEL-45]
 gi|161382512|gb|EDQ06921.1| ATP-dependent Clp protease, ATP-binding subunit ClpA, putative
           [Oceanibulbus indolifex HEL-45]
          Length = 773

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/753 (57%), Positives = 570/753 (75%), Gaps = 10/753 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M  FS  LE+ +H AL LAN R HE+ATLEHLLLAL+D+ DA  VM +C+VD+  L++ L
Sbjct: 1   MPSFSTTLEQAIHAALALANARRHEFATLEHLLLALLDEPDAVQVMKACSVDVSDLRDTL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + ++D+D SN + +    E  PT++FQRV+QRA +HVQS+GR  VTGAN+LVA+F+E +S
Sbjct: 61  VEFVDDDLSNLVTDIDGSEAVPTAAFQRVIQRAAIHVQSSGRTEVTGANVLVAIFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           +A YFLQEQ+MT YDAVNFI+HG++K   +   +    V G+    +    V +   K  
Sbjct: 121 NAAYFLQEQDMTRYDAVNFIAHGVAKDPAYGEARP---VSGAPEHEEEPQGVTEGDKKES 177

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                AL+ YCVDL  K ++G +D L+GR  E+ R IQ+LCRR KNNPL VGDPGVGKTA
Sbjct: 178 -----ALAKYCVDLNAKSREGDIDPLIGRESEVERCIQVLCRRRKNNPLLVGDPGVGKTA 232

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IV G  P++L    I+SLDMG L+AGTRYRGDFEER+K +V E+E + +A+L
Sbjct: 233 IAEGLARKIVAGETPEVLANTTIYSLDMGALLAGTRYRGDFEERLKAVVTELEEHKDAVL 292

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ SG ++DASNLLKPAL  G +R +GSTTY E+RQ FEKD+AL RRFQ
Sbjct: 293 FIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRTMGSTTYKEFRQHFEKDRALSRRFQ 352

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDVSEPS+EDA +I+KG+KPYFEEHH ++Y+ +AI+ +V+L+ R+   RKLPD AIDVI
Sbjct: 353 KIDVSEPSVEDATKILKGLKPYFEEHHSVKYTADAIKTSVELAHRYINDRKLPDSAIDVI 412

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q L   SKRRK I  K+++  +A + R I   + S+DD  VL +LE +L  VV+
Sbjct: 413 DEAGAAQHLVAASKRRKTIGTKEVEAVVAKIAR-IPPKNVSKDDVVVLKDLESSLKRVVF 471

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  LSS+IK++RAGL +P+KPIG Y+F+GPTGVGKTE++KQLA  LGV+LLRFDM
Sbjct: 472 GQDDAIVALSSAIKLSRAGLREPDKPIGNYLFAGPTGVGKTEVAKQLADTLGVELLRFDM 531

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+HAVSRLIGAPPGYVGF QGG+L D VDQ+P+ V+LLDE+EK+HPDV NILLQ+M
Sbjct: 532 SEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEMEKAHPDVYNILLQVM 591

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+ + FRNV+LIMT+NAGA E +K  +GFG  R    D  A+    +PEF 
Sbjct: 592 DHGKLTDHNGRTVDFRNVVLIMTSNAGASEQAKEAVGFGRERRTGEDTAAIERTFTPEFR 651

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F PL   +I +VV KF+++LE QL ++ ++   S++   WL   GYD KMGA
Sbjct: 652 NRLDAVISFAPLPKSVILRVVEKFVLQLEAQLMDRNVTIELSKKAAEWLADKGYDDKMGA 711

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKV 753
           RPL R+I+EH+K PLA+E+LFGKL K GGVVKV
Sbjct: 712 RPLGRVIQEHIKKPLAEELLFGKLAK-GGVVKV 743


>gi|294084617|ref|YP_003551375.1| ATPase [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664190|gb|ADE39291.1| ATPase with chaperone activity, ATP-binding subunit [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 764

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/746 (56%), Positives = 556/746 (74%), Gaps = 19/746 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S  LE+ L +A+  A  R HE+ATLEHLLLAL +DSDA  V+ +CNVD++ L   L  
Sbjct: 1   MLSRELEESLRRAMSNATTRAHEFATLEHLLLALTEDSDALEVLNACNVDIQELARKLQE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           YI+ +  + +     ++ +PT+SFQRV+QRA++H QS+GR + TGAN+LV++FSE +SHA
Sbjct: 61  YIEVELESIVSTKDGLDVQPTASFQRVIQRAIIHTQSSGREVATGANVLVSIFSERESHA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            +FL+   MT  DAV+F+SHG  K    A         G+   ++GE  ++D  A +D  
Sbjct: 121 VWFLKSLNMTRLDAVSFLSHG--KDGNIAR--------GTEDQTEGEP-IDD--AGSD-- 165

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               LS Y V+L  K   G++D L+GR  E++RTIQ+LCRR+KNNPLYVGDPGVGKTAIA
Sbjct: 166 ---PLSQYAVNLIAKAANGRIDPLIGRDREVDRTIQVLCRRTKNNPLYVGDPGVGKTAIA 222

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +I +G VP++L  A I++LDMG L+AGTRYRGDFEER+K ++K +E   NAIL+I
Sbjct: 223 EGLALRIYNGEVPEVLTNAVIYALDMGQLLAGTRYRGDFEERLKAVMKAVEDDENAILFI 282

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ SG ++DASNLLKPAL  G +RCIGSTTY EYR  FEKD+ALVRRFQKI
Sbjct: 283 DEIHTVIGAGATSGGAMDASNLLKPALQEGNLRCIGSTTYKEYRGHFEKDRALVRRFQKI 342

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EP++ D I+I+ G+K  +E HH++RY+  A++ AV L+ R+   RKLPDKAIDVIDE
Sbjct: 343 DVAEPTVADTIKILNGLKSRYEAHHKIRYTGAALKTAVDLAARYINDRKLPDKAIDVIDE 402

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           A A+Q L P S+R+  + +K+I+ TIA+M R I +   SRDD +VL+ LE +L  +V+GQ
Sbjct: 403 AAAAQNLLPPSRRKATVGQKEIEATIATMAR-IPSKHVSRDDKAVLATLEDDLKRLVFGQ 461

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI  LSS+IK++RAGL +  KP+G Y+FSGPTGVGKTE+++QLA ALG++L+RFDMSE
Sbjct: 462 DAAISALSSAIKLSRAGLREVEKPVGNYLFSGPTGVGKTEVARQLAEALGIKLIRFDMSE 521

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L D+VDQ P++V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 522 YMERHTVSRLIGAPPGYVGFDQGGLLTDAVDQTPHAVLLLDEIEKAHPDLFNILLQVMDH 581

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +GK + FRNVILIMTTNAGA E+SK  IGFG   ND AD EA+    +PEF NR
Sbjct: 582 GKLTDNNGKSVDFRNVILIMTTNAGAQELSKKAIGFGRDMNDGADIEAIEKMFTPEFRNR 641

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD++IPF PL SD+IR VV KF+M+L+ QL ++ +    SE   +WL   GYD   GARP
Sbjct: 642 LDAMIPFAPLESDVIRLVVDKFMMQLDAQLADRNVEIELSEAARDWLAVRGYDRNYGARP 701

Query: 723 LERIIKEHVKVPLADEILFGKLKKGG 748
           L R+++E +K PLAD +LFG+L  GG
Sbjct: 702 LARVVQESIKKPLADALLFGELAGGG 727


>gi|330814166|ref|YP_004358405.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327487261|gb|AEA81666.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 756

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/750 (55%), Positives = 557/750 (74%), Gaps = 17/750 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M+ F+++LEK + +A  +A E+NH+Y TLEHLLL+L D+ DA  VM +C+VD  +LK NL
Sbjct: 1   MATFTKSLEKSISKAFQVATEKNHQYVTLEHLLLSLTDEEDALNVMKACSVDTDLLKENL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             YIDN+  N + +    + +PTS FQRV+QR+++HVQS+G+  VTGANILV+LF+E +S
Sbjct: 61  EYYIDNELDNIVNSEKNNDPQPTSGFQRVIQRSIVHVQSSGKSEVTGANILVSLFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HATYFLQEQE+T YD VNFISHGI+K   F    S                 N+     +
Sbjct: 121 HATYFLQEQEVTRYDVVNFISHGITKIDNFTYVDS----------------ANEKSKTRE 164

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            +    L  YCV+L ++ +K K+D LVGR++E++R  QILCRR+KNNPL VGDPGVGKTA
Sbjct: 165 SSPNSPLDTYCVNLIKRAEKNKIDTLVGRNDEVDRITQILCRRTKNNPLLVGDPGVGKTA 224

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           I EG A +I    VPDIL    I+SLDMG LIAGTRYRGDFEER+K I+ EIE     IL
Sbjct: 225 IVEGLANKIFRNEVPDILKDNVIYSLDMGLLIAGTRYRGDFEERLKAIINEIEKNPKYIL 284

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIH+LVG GS SG S+DA+N+LKPAL SG +RC+GSTT+SEYRQFFEKD+AL RRFQ
Sbjct: 285 FIDEIHSLVGTGSTSGNSMDAANMLKPALQSGQIRCVGSTTFSEYRQFFEKDRALQRRFQ 344

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDVSEPS+EDA +I+ G+K  +E+ H+++YS +AIRA+V LS ++  +++LPDK+ID+I
Sbjct: 345 KIDVSEPSVEDAYKIMFGLKAKYEDFHKVKYSDDAIRASVDLSYKYIGNKRLPDKSIDII 404

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE G+ + L+   +++  + E DI+K ++ + + I   + + +D + L ++EKNL  ++Y
Sbjct: 405 DELGSYESLKKNDQKKDVLDESDIEKIVSKITK-IPEKNITLNDRNYLKDIEKNLKRIIY 463

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L+SSIK++R+GL D NK IG Y+FSGPTGVGKTE++KQLA  LGV+L+RFDM
Sbjct: 464 GQDHAIEALASSIKLSRSGLRDSNKTIGNYLFSGPTGVGKTELAKQLAKTLGVELIRFDM 523

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEY ERH +S+LIGAPPGYVGF QGG L++ V++NP++V+L+DEIEK+HPD+ NILLQIM
Sbjct: 524 SEYSERHTISKLIGAPPGYVGFDQGGQLSELVEKNPHAVLLIDEIEKAHPDIYNILLQIM 583

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           DYG LTDQ+GKKI FRN+ILI+TTNAGA ++ K +IGF     ++ D E ++   +PEF 
Sbjct: 584 DYGNLTDQNGKKIDFRNIILILTTNAGATDLEKNQIGFVKETYNNNDFETIKKIFTPEFR 643

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDS+I F  L+ +IIRQVV KFI++LE+QL  + I+   S+E  + + S GY   MGA
Sbjct: 644 NRLDSVIRFNNLNKEIIRQVVSKFIIELEIQLNARDITIELSDEACDLICSIGYSQTMGA 703

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           RP+ R I E ++ PLA+EI+ GKL  GG V
Sbjct: 704 RPISRTIDEKIRKPLANEIIHGKLIDGGFV 733


>gi|56477974|ref|YP_159563.1| ATP-dependent protease [Aromatoleum aromaticum EbN1]
 gi|56314017|emb|CAI08662.1| probable ATP-dependent protease [Aromatoleum aromaticum EbN1]
          Length = 757

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/766 (53%), Positives = 554/766 (72%), Gaps = 16/766 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLLAL+D+  AA V+ +C  ++  L+  L  
Sbjct: 1   MIAQELEVSLHMAFVEARQKRHEFITVEHLLLALLDNPSAAEVLRACAANVDELRRELTT 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I N+ + +++    ++ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  FI-NEHTPRVEGADEIDTQPTLGFQRVIQRAILHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQ Q ++  D VNFISHGI+K       Q   N  G S    GE      Q      
Sbjct: 120 VYFLQRQNISRLDVVNFISHGIAKAP-----QQGANAPGRSEPEQGEQETETAQPGG--- 171

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL  Y  +L ++   GK+D L+GR  E+ R IQ LCRR KNNPL VG+ GVGKTAIA
Sbjct: 172 ---ALENYTQNLNQQALVGKIDPLIGRDRELERVIQTLCRRRKNNPLLVGEAGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++I++G +P+IL GA++++LDMG L+AGT+YRGDFE+R+K ++K++    NAIL+I
Sbjct: 229 EGLARRIIEGRIPEILDGAQVYALDMGALLAGTKYRGDFEQRLKAVLKQLRETQNAILFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TTYSE+RQ FEKD AL RRFQK+
Sbjct: 289 DEIHTLIGAGAASGGTLDASNLLKPALSSGQLKCIGATTYSEFRQIFEKDHALSRRFQKV 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DVSEPS+ + +EI+KG+K  FEEHH ++YS  A+ +A +LS R+   R LPDKAIDVIDE
Sbjct: 349 DVSEPSVAETVEILKGLKSRFEEHHNVKYSAAALSSAAELSARYINDRHLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P SK+RK I + +I+  +A + R I   S S DD + L NLE++L  VV+GQ
Sbjct: 409 AGAAQRILPKSKQRKLIGKGEIEDIVAKIAR-IPPRSVSNDDKTALMNLERDLKNVVFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           E AI  L+ +IK++R+GL +P KPIG ++FSGPTGVGKTE+++QLAF +G++L+RFDMSE
Sbjct: 468 EAAIDALAKAIKMSRSGLGNPAKPIGSFLFSGPTGVGKTEVARQLAFTMGIELVRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 528 YMERHAVSRLIGAPPGYVGFDQGGLLTEAITKKPHCVLLLDEIEKAHPDIYNILLQVMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G++  FRNVILIMTTNAGA  M KA IGF + R    +   ++   SPEF NR
Sbjct: 588 GTLTDNNGRQADFRNVILIMTTNAGAESMQKAVIGFSAKREAGDEMADIKRMFSPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+ I F  L +++I +VV KF+M+LE QL EK +  HF++E+  WL   G+D  MGARP
Sbjct: 648 LDATISFKALDNEVILRVVDKFLMQLEAQLHEKKVEAHFTDELKAWLAGEGFDPMMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           + R+I++ ++  LADE+LFG+L  GG   KV+++ D      + F+
Sbjct: 708 MARLIQDTIRSALADELLFGRLANGG---KVTIDLDADGKVKLVFD 750


>gi|71908708|ref|YP_286295.1| AAA ATPase, central region:Clp, N terminal [Dechloromonas aromatica
           RCB]
 gi|71848329|gb|AAZ47825.1| AAA ATPase, central region:Clp, N terminal [Dechloromonas aromatica
           RCB]
          Length = 753

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/770 (52%), Positives = 550/770 (71%), Gaps = 21/770 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLLALID+  AA  + +C      L+ +L N
Sbjct: 1   MIAQELEVSLHMAFVEARQKRHEFITVEHLLLALIDNPSAADALRACGAKPDTLRKDLTN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +   +     ++ +PT  FQRV+QRA+LHVQS+G+  V GAN+LVA++ E DSHA
Sbjct: 61  FIDEHTPT-VSGEDDIDTQPTLGFQRVIQRAILHVQSSGKKEVNGANVLVAIYGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQ+Q +T  D VNFISHGISK  +              A +  EG V     K +  
Sbjct: 120 VYFLQKQGVTRLDVVNFISHGISKVPQ-------------QAKATQEGEVETEGEKAEAG 166

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L  Y ++L     +GK+D L+GR +E+ R IQ LCRR KNNPL VG+ GVGKTAIA
Sbjct: 167 ---PLDQYTINLNALALQGKIDPLIGRDKELERVIQTLCRRRKNNPLLVGEAGVGKTAIA 223

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A+++V+G VP+IL  A +++LDMG+L+AGT+YRGDFE+R+K ++K ++   NAIL+I
Sbjct: 224 EGLARKVVEGEVPEILAKANVYALDMGSLLAGTKYRGDFEQRLKGVLKALQDNPNAILFI 283

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAGSASG ++DASNLLKPALSSG ++CIG+TTY+E+R  FEKD AL RRFQKI
Sbjct: 284 DEIHTLIGAGSASGGTLDASNLLKPALSSGQLKCIGATTYTEFRGIFEKDSALSRRFQKI 343

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPS+ + +EI+KG+K  FE HH ++YS  AI +A +LS R+ T R LPDKAIDVIDE
Sbjct: 344 DVNEPSVAETVEILKGLKARFEAHHGIKYSATAISSAAELSARYITDRHLPDKAIDVIDE 403

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P SK++K I + DI++ +A + R I +   S DD   L NL+++L   V+GQ
Sbjct: 404 AGAAQRILPKSKQKKVINKTDIEEIVAKIAR-IPSQHVSLDDRGALKNLDRDLKATVFGQ 462

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           E+AI  L+ +IK+AR+GL +P KPIG ++FSGPTGVGKTE++KQLA+ LGV+L RFDMSE
Sbjct: 463 EKAIDALAKAIKMARSGLGNPGKPIGSFLFSGPTGVGKTEVAKQLAYCLGVELQRFDMSE 522

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG+L +++ + PY V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 523 YMERHAVSRLIGAPPGYVGFDQGGLLTEAITKKPYCVLLLDEIEKAHPDIFNILLQVMDH 582

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNV++IMTTNAGA ++ K+ +GF  ++    +   ++   +PEF NR
Sbjct: 583 GTLTDNNGRKADFRNVVIIMTTNAGAADLQKSSMGFTVNKQTGDEMAEIKRLFTPEFRNR 642

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+ I F PL  ++I +VV KF+M+LE QL EK +  HFSE V   L   G+D  MGARP
Sbjct: 643 LDATISFAPLDHEVILRVVDKFLMQLEEQLHEKKVEAHFSEAVKKMLAEKGFDPLMGARP 702

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENS 772
           + R+I++ ++  LADE+LFGKL  GG   +V+++ DK     + FE E +
Sbjct: 703 MARLIQDTIRSALADELLFGKLASGG---RVTVDLDKEGKIRLDFEEEKT 749


>gi|53804153|ref|YP_114227.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Methylococcus
           capsulatus str. Bath]
 gi|53757914|gb|AAU92205.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Methylococcus
           capsulatus str. Bath]
          Length = 756

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/748 (53%), Positives = 551/748 (73%), Gaps = 15/748 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE+ L+ A   A E+ HE+ T+EHLLLA++D+  A  V+ +C  +L +L+N L  
Sbjct: 1   MLSKELEQSLNAAFRTAYEKRHEFITVEHLLLAMLDNGAAIEVLRACGGNLDLLRNELNE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D +++  +  G + + +PT  FQRV+QRA  HVQS+G+  VTGAN+LVA+FSE DSHA
Sbjct: 61  FLD-ETTPLIPAGVKRDTQPTLGFQRVLQRAAFHVQSSGKKEVTGANVLVAIFSEQDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L +Q++T  D VNFISHGISK ++ A        DG++ GS  E   +D ++ +  N
Sbjct: 120 VYLLHKQDITRLDVVNFISHGISKVRDEA--------DGTARGSAPES--DDAESGSSAN 169

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L  +  +L E  ++GK+D L+GR +E+ RT+Q+LCRR KNNPL+VG+ GVGKTAIA
Sbjct: 170 ---PLEKFATNLNESARRGKIDPLIGRKDELERTVQVLCRRRKNNPLFVGEAGVGKTAIA 226

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IV+  VP++L  + I+SLD+G+L+AGT+YRGDFE+R+K ++ +++   NAIL+I
Sbjct: 227 EGLAKKIVENDVPEVLKDSTIYSLDLGSLVAGTKYRGDFEKRLKSLLAQLKKEPNAILFI 286

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG  +DASNL+KP L+SG +RCIGSTTY EYR  FEKD+AL RRFQKI
Sbjct: 287 DEIHTIIGAGSASGGVMDASNLIKPVLASGELRCIGSTTYQEYRGIFEKDRALARRFQKI 346

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EPS+E+  +I+KG+K  FE+HH ++YS  A+R AV+LS R+   R LPDKAIDVIDE
Sbjct: 347 DIPEPSVEETYQILKGLKTRFEQHHDVKYSLAALRTAVELSDRYINDRHLPDKAIDVIDE 406

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q L P S+R+K I   DI+  ++ + R I   + S +D   L +LE NL  +V+GQ
Sbjct: 407 AGANQRLLPPSRRKKTIGTVDIEDIVSKIAR-IPAKTVSANDKEKLRDLESNLKMLVFGQ 465

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           +EAI  LSS+IK++RAGL D  KPIG ++F+GPTGVGKTE+++QLA  LGV+L+RFDMSE
Sbjct: 466 DEAIAALSSAIKLSRAGLRDGQKPIGSFLFAGPTGVGKTEVTRQLARMLGVELIRFDMSE 525

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L ++++++P++V+LLDEIEK+HPDV N+LLQ+MD+
Sbjct: 526 YMERHTVSRLIGAPPGYVGFDQGGLLTEAINKHPHAVLLLDEIEKAHPDVFNLLLQVMDH 585

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRN+IL+MTTNAGA E ++  IGF    +     +A+    SPEF NR
Sbjct: 586 GTLTDNNGRKADFRNIILVMTTNAGAFEGARPSIGFTPQDHSTDSLKAIERTFSPEFRNR 645

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F PLS + I  VV KFI +LE QL EK +S     +   WL  HG+D KMGARP
Sbjct: 646 LDAIIQFNPLSPETIGHVVDKFIFELEAQLAEKQVSLVIEPDARAWLAEHGFDSKMGARP 705

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I+E++K PLA+EILFG+L  GG V
Sbjct: 706 MARVIQENIKKPLAEEILFGRLAHGGTV 733


>gi|34499124|ref|NP_903339.1| ATP-dependent Clp protease, ATP-binding subunit [Chromobacterium
           violaceum ATCC 12472]
 gi|34104975|gb|AAQ61331.1| ATP-dependent Clp protease, ATP-binding subunit [Chromobacterium
           violaceum ATCC 12472]
          Length = 760

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/765 (52%), Positives = 557/765 (72%), Gaps = 18/765 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A  + HE+ ++EHLLLA+ D+  AA V+ +C  ++  LK  L +
Sbjct: 1   MIAQELEVSLHMAFMDARRKRHEFISVEHLLLAMTDNPSAAEVLRACGANIDQLKKQLTD 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID + +  +     VE +PT  FQRV+QRA+LHVQS+G+  V+GANILVA+F E DSHA
Sbjct: 61  FID-EHTPTVPGETEVETQPTLGFQRVIQRAILHVQSSGKKEVSGANILVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y+L +Q ++  D VNFISHGI+K++     Q   +   + A S+ +             
Sbjct: 120 VYYLHQQGISRLDVVNFISHGITKQRSQQPPQEPRDNGNNDADSEEQA----------TG 169

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL  Y  +L +  + GK+D L+GR  E+ RT+QILCRR KNNPL VG+ GVGKTAIA
Sbjct: 170 PGGALENYTQNLNQMARDGKIDPLIGREHELERTVQILCRRRKNNPLLVGEAGVGKTAIA 229

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VP+IL  + +++LDMG L+AGT+YRGDFE+R+K ++K++    NAIL+I
Sbjct: 230 EGLARRIVNGEVPEILSKSTVYALDMGALLAGTKYRGDFEQRLKAVIKQLTDDTNAILFI 289

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALS+G++RCIG+TTY+EYR  FEKD AL RRFQKI
Sbjct: 290 DEIHTLIGAGAASGGTLDASNLLKPALSNGSLRCIGATTYNEYRGIFEKDNALSRRFQKI 349

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EP++E  +EI+KG+K  FE HH ++Y++ A+  A +LS R+   R LPDKAIDVIDE
Sbjct: 350 DVTEPTVEQTVEILKGLKSRFEAHHGVKYTQSALSTAAELSARYINDRHLPDKAIDVIDE 409

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P S+++K I + +I++ +A + R I   + S DD +VL NLE++L  VV+GQ
Sbjct: 410 AGAAQKILPKSRQKKVINKSEIEEIVAKIAR-IPPKTVSSDDKNVLKNLERDLKNVVFGQ 468

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           E+AI+ L+S+IK+ R+GL +P KPIG ++FSGPTGVGKTE+++QLA+ LGV+L+RFDMSE
Sbjct: 469 EKAIEGLASAIKMTRSGLGNPQKPIGSFLFSGPTGVGKTELARQLAYILGVELIRFDMSE 528

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG L ++++++PY+VVLLDEIEK+HPD+ N+LLQ+MD+
Sbjct: 529 YMERHAVSRLIGAPPGYVGFEQGGQLTEAINKHPYAVVLLDEIEKAHPDIYNVLLQVMDH 588

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNV+LIMTTNAGA  +SK  +GF  ++    +   ++   SPEF NR
Sbjct: 589 GTLTDNNGRKADFRNVVLIMTTNAGAESLSKPSLGFTQTKAAGDEMGDIKRMFSPEFRNR 648

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+IIPF  L   II QVV KF+M+LE QL EK +  HF++E+  +L  +G+D  MGARP
Sbjct: 649 LDAIIPFGMLDEQIILQVVDKFLMQLEQQLAEKHVDIHFTDELRRYLAKNGFDPLMGARP 708

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV------KVSLNPDKSA 761
           + R+I++ ++  LADE+LFG+L  GG V       KV L  D+ A
Sbjct: 709 MARLIQDTLRKALADELLFGRLVAGGEVTVTVIDDKVELKFDQDA 753


>gi|285018229|ref|YP_003375940.1| ATP-dependent clp protease ATP-binding subunit clpa protein
           [Xanthomonas albilineans GPE PC73]
 gi|283473447|emb|CBA15952.1| probable atp-dependent clp protease atp-binding subunit clpa
           protein [Xanthomonas albilineans]
          Length = 761

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/749 (53%), Positives = 549/749 (73%), Gaps = 13/749 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLLAL+D+  A  V+ +C  D+  L+N+L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLALLDNPSAQAVLKACGADVDRLRNDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            ID   +   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIDASVARLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN++SHGI+K  E     S  +VDG +    GEG     + K D  
Sbjct: 120 VYFLNQQDITRLDIVNYLSHGIAKMGEEGEHASP-SVDGEARSEVGEG-----EPKGD-- 171

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ +  +L E+ + G++D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 172 ---ALAEFATNLNEQARNGRIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IV+G VP++L  A IFSLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 229 EGLAKRIVEGSVPEVLADAVIFSLDLGALVAGTKYRGDFEKRLKGVLSALKKVPNAVLFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPALSSG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 289 DEIHTIIGAGSASGGTMDASNLIKPALSSGELRCIGSTTFQEYRGIFEKDRALARRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+KP +E HH + Y+ EA++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 349 DIVEPTVGETFEILQGLKPKYEAHHGVIYADEALQAAVDLSVKHIGDRLLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P  +R++ I  ++I+  +A M R I T   S  D  VL +LE+NL  V++GQ
Sbjct: 409 AGARQRLLPEGQRKELIDIEEIETIVAKMAR-IPTKQVSATDKDVLQHLERNLKMVIFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI+ L+SSIK+AR+GLS+P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 468 DTAIETLASSIKLARSGLSNPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 528 YMEPHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G+LTD +G++ +F+NVIL+MTTNAGA + S+  IGF    +     E +R   +PEF NR
Sbjct: 588 GMLTDTNGREANFKNVILVMTTNAGATQASRRSIGFTQQDHSTDAMEIIRRSFTPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+++ F  L+ + I +VV KF+++LE+ LQEK +S   +    +WL  HG+D  MGARP
Sbjct: 648 LDAVVQFEALAFNHILRVVDKFVIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV 751
           + R+I++ VK PLADE+LFGKL  GG V 
Sbjct: 708 MARLIQDKVKRPLADELLFGKLVNGGRVT 736


>gi|262277127|ref|ZP_06054920.1| ATP-dependent Clp protease ATP-binding subunit ClpA [alpha
           proteobacterium HIMB114]
 gi|262224230|gb|EEY74689.1| ATP-dependent Clp protease ATP-binding subunit ClpA [alpha
           proteobacterium HIMB114]
          Length = 763

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/759 (52%), Positives = 555/759 (73%), Gaps = 17/759 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M+ F+++LEK +  A  LA E+NH+Y TLEHLL +L+D+ DA  VM +C+VD+ +L+ NL
Sbjct: 1   MATFTKSLEKSISNAFALATEKNHQYVTLEHLLFSLMDEEDAQNVMKACSVDIGLLRENL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
            +YID++  N + +    + +PT+ FQRV+QR+++HVQS+G+  VTGANILV+LF+E +S
Sbjct: 61  EHYIDHELDNIVNSEKISDPQPTAGFQRVIQRSIVHVQSSGKSEVTGANILVSLFAERES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HATYFLQEQE+T YD VNFISHGI+K + F               S  E    D +    
Sbjct: 121 HATYFLQEQEVTRYDVVNFISHGITKIENF---------------SYTENLETDQKIGQR 165

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            N   AL  +CV+L  K    K+D L+GR EE++R  QILCRR+KNNPL VGDPGVGKTA
Sbjct: 166 TNERTALDNFCVNLNLKASANKIDTLIGRDEEVSRMAQILCRRTKNNPLLVGDPGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           I EG AK+I +  VP+ L  + IFSLD+G+L+AGTRYRGDFEER+K I+ EIE   N IL
Sbjct: 226 IVEGLAKRIFNKNVPEPLKDSVIFSLDLGSLLAGTRYRGDFEERLKTIINEIEKNDNYIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTLVGAG+ +G S+DA+N+LKPAL SG ++CIGSTT++EYR  FEKD+AL RRFQ
Sbjct: 286 FIDEIHTLVGAGTTTGNSMDAANMLKPALQSGKIKCIGSTTFTEYRSNFEKDRALQRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDVSEP+I++A +I+ G++  +EE+H+++YS +AI+A+V LS ++  +++LPDK+ID++
Sbjct: 346 KIDVSEPTIDEAYKIMFGLRDKYEEYHKVKYSDDAIKASVDLSAKYIGNKRLPDKSIDIL 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DE GA + L+    R++ + E D+++ +A + + I   S + +D   L +L+KNL  ++Y
Sbjct: 406 DELGAFENLKENKDRKEILDESDVEQVVAKITK-IPEKSITANDRYYLKDLDKNLKRLIY 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ A+  L SSIK++R+GL +P K IG Y+F+GPTGVGKTE++KQL+  LGV+L+RFDM
Sbjct: 465 GQDHAVDALCSSIKLSRSGLRNPEKTIGNYLFNGPTGVGKTELAKQLSKTLGVELVRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SE+ E+H +S+LIG+PPGYVGF QGG L++S+++NPY V+L+DEIEK+HPD+ NILLQIM
Sbjct: 525 SEFSEKHTISKLIGSPPGYVGFDQGGQLSESIEKNPYCVLLIDEIEKAHPDIFNILLQIM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           DYG L DQ+GK + FRNVILI+T+N GA E+ K +IGF + +N++ D++ +    SPEF 
Sbjct: 585 DYGKLKDQNGKNVDFRNVILILTSNIGAAELEKDQIGFSTKKNNEIDQQTINKVFSPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDSII F  L   II+Q+V KFI++LE QL  + +    S    + +   GY   MGA
Sbjct: 645 NRLDSIISFNRLDKSIIKQIVSKFILELETQLNARDVVIELSNTANDLICEKGYSQTMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           RP+ R I EH+K  LADEI+ GKL  GG  VKV +  +K
Sbjct: 705 RPISRYIDEHIKKTLADEIIHGKLVDGGH-VKVDVKDEK 742


>gi|254282440|ref|ZP_04957408.1| ATP-dependent Clp protease ATP-binding subunit ClpA [gamma
           proteobacterium NOR51-B]
 gi|219678643|gb|EED34992.1| ATP-dependent Clp protease ATP-binding subunit ClpA [gamma
           proteobacterium NOR51-B]
          Length = 758

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/760 (54%), Positives = 543/760 (71%), Gaps = 20/760 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S++LE+ L++    A  R HE+ T+EHLLL+L+DD+ A  V+ +C+VDL+ L+ +L+ 
Sbjct: 1   MLSKDLEQTLNETFRNARGRRHEFITVEHLLLSLLDDTAAIAVLKACSVDLEALRGDLVE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +     +   VE +PT  FQRV+QRAV HVQS+G+  VTGANILVA+FSE +S A
Sbjct: 61  FIDATTPLLPDDDEAVETQPTLGFQRVLQRAVFHVQSSGKNEVTGANILVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGS--SAGSDGEGFVNDYQAKTD 180
            +FL+ Q+++  D VN+I+HGI+K  E      +   D S  + G+D             
Sbjct: 121 VFFLKSQDVSRLDVVNYITHGIAKPDEEGEGIERTESDTSEDAGGADAS----------- 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L  Y  DL  + ++G +D L+GR EE+ R  QIL RR KNNPL VG+ GVGKTA
Sbjct: 170 -----PLDTYATDLNAEAREGNIDPLIGRLEEVERVAQILARRRKNNPLLVGESGVGKTA 224

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK IVDG VP+IL  A ++SLD+G L+AGT+YRGDFE+R K ++ +++   ++IL
Sbjct: 225 IAEGLAKLIVDGDVPEILKDAVVYSLDLGALLAGTKYRGDFEKRFKGLLADLKERDHSIL 284

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ASG  +DASNLLKP LSSG +RCIGSTT++EYR  F+KDKAL RRFQ
Sbjct: 285 FIDEIHTIIGAGAASGGVMDASNLLKPLLSSGKMRCIGSTTFAEYRGIFDKDKALSRRFQ 344

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV EPS++DA +I+KG+K  FEEHH LRYS  ++R AV+++ R+ T R LPDKAIDVI
Sbjct: 345 KVDVLEPSVDDAYKILKGLKSRFEEHHGLRYSDRSLRTAVEMASRYITDRFLPDKAIDVI 404

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA Q LQ  SKR+K I   DI+  IA + R I   + + DD S+L  LE NL  VV+
Sbjct: 405 DEAGAYQQLQAPSKRKKVIGPGDIESIIAKIAR-IPPKTVTSDDKSLLEKLEPNLQMVVF 463

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ +AI  L ++IK+ARAGL   +KPIG ++ +GPTGVGKTE++KQLA  LG++L RFDM
Sbjct: 464 GQNKAISSLVAAIKLARAGLRSGDKPIGSFLLAGPTGVGKTEVTKQLAMQLGLELSRFDM 523

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVG+ QGG+L D+V ++P+SVVLLDEIEK+HP+V N+LLQ+M
Sbjct: 524 SEYMERHTVSRLIGAPPGYVGYDQGGLLTDAVTKHPHSVVLLDEIEKAHPEVFNLLLQVM 583

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVIL+MTTNAGA  +S+  IGF    +     EA+    +PEF 
Sbjct: 584 DHGTLTDNNGRKADFRNVILVMTTNAGAENVSRRSIGFTEQDHSTDSLEAINRTFTPEFR 643

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+PF PL  D+I  VV KF+ +L+ QL EKG+     EE   WLV  GYD  MGA
Sbjct: 644 NRLDAIVPFEPLGEDVILTVVDKFLTELQGQLDEKGVDLEVDEEARLWLVEKGYDRTMGA 703

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKS 760
           RP+ R+I+EH+K PLAD +LFG+L KGG  V VS+  D+S
Sbjct: 704 RPMARVIQEHIKKPLADMVLFGELSKGGSAV-VSMKDDRS 742


>gi|224824764|ref|ZP_03697871.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Lutiella
           nitroferrum 2002]
 gi|224603257|gb|EEG09433.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Lutiella
           nitroferrum 2002]
          Length = 759

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/749 (53%), Positives = 557/749 (74%), Gaps = 14/749 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A  + HE+ ++EHLLLA+ D+  AA V+ +C  +L  LK  L +
Sbjct: 1   MIAQELEVSLHMAFMDARRKRHEFISVEHLLLAMTDNPSAAEVLRACGANLDQLKKQLTD 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID + +  +     VE +PT  FQRV+QRA+LHVQS+G+  VTGANILVA+F E DSHA
Sbjct: 61  FID-EHTPTVPGETEVETQPTLGFQRVIQRAILHVQSSGKKEVTGANILVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y+L +Q ++  D VNFISHGI+K++     Q   N    ++ S+ E    D  A    N
Sbjct: 120 VYYLHQQGISRLDVVNFISHGITKQRS----QPTPNEQRDNSESETE----DASA----N 167

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
           +  AL  Y  +L    ++GK+D L+GR  E+ RT+QILCRR KNNPL VG+ GVGKTAIA
Sbjct: 168 VGGALENYTQNLNALAREGKIDPLIGREHELERTVQILCRRRKNNPLLVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VP++L  A ++SLDMG L+AGT+YRGDFE+R+K ++K++    +AIL+I
Sbjct: 228 EGLARRIVNGEVPEVLDRATVYSLDMGALLAGTKYRGDFEQRLKAVIKQLTEDPHAILFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALS+G++RCIG+TTY+E+R  FEKD AL RRFQKI
Sbjct: 288 DEIHTLIGAGAASGGTLDASNLLKPALSNGSLRCIGATTYNEFRGIFEKDNALSRRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D++EP++E  +EI+KG+K  FE HH ++Y++ A+  A +L+ R+   R LPDKAIDVIDE
Sbjct: 348 DINEPTVEQTVEILKGLKSRFESHHGVKYTQGALVTAAELAARYINDRHLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P S++RK I + +I+  +A + R I   + S +D +VL NL+++L +VV+GQ
Sbjct: 408 AGAAQKILPKSRQRKVINKAEIEDIVAKIAR-IPAKTVSSNDKNVLKNLDRDLRSVVFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ L+++IK+AR+GL +P KPIG ++FSGPTGVGKTE++KQLA+ LGV++LRFDMSE
Sbjct: 467 DKAIEALATAIKMARSGLGNPQKPIGSFLFSGPTGVGKTEVAKQLAYFLGVEMLRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG+L ++++++PY+V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 527 YMERHAVSRLIGAPPGYVGFEQGGLLTEAINKHPYAVLLLDEIEKAHPDIYNILLQVMDH 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVI+IMTTNAGA  +SK  +GF +++    +   ++   SPEF NR
Sbjct: 587 GTLTDNNGRKADFRNVIIIMTTNAGAESLSKPSMGFTNAKQTGDEMADIKRLFSPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+ IPF  L  +II QVV KF+M+LE QL EK +  HF++ +  +L  +G+D  MGARP
Sbjct: 647 LDATIPFRMLDENIILQVVDKFLMQLEHQLAEKKVDIHFTDMLRQYLAKNGFDPLMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV 751
           + R+I++ ++  LADE+LFG+L  GG V 
Sbjct: 707 MARLIQDTIRKALADELLFGRLVDGGEVT 735


>gi|220935007|ref|YP_002513906.1| ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996317|gb|ACL72919.1| ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 753

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/753 (53%), Positives = 545/753 (72%), Gaps = 16/753 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E+ HE+ T+EHLLLAL ++  AA V+ +C V+L  L+  L  
Sbjct: 1   MLNKELEFSLNLAFKAAREKRHEFMTVEHLLLALTENPTAASVLRACGVNLDKLRGELAE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D ++     N  R + +PT  FQRV+QRAV HVQS+GR  VTGAN+LVA+F E +SHA
Sbjct: 61  FVDANTPRLPPNDPR-DTQPTLGFQRVLQRAVFHVQSSGRKEVTGANVLVAIFGEQESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L + ++   D VN+ISHGISK  E        + + SS          +  A+ + N
Sbjct: 120 VYLLSQHDVARLDVVNYISHGISKVPE-----EHPDEEASSQ--------QEAPAEGEEN 166

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L AY  +L E+ +KGK+D L+GR  E+ RT+QILCRR KNNPLYVG+ GVGKTAIA
Sbjct: 167 RQNPLEAYATNLNEQARKGKIDPLIGRAHELERTVQILCRRRKNNPLYVGEAGVGKTAIA 226

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVDG VP++L  A I+SLD+G L+AGT+YRGDFE+R+K ++ +++    ++L+I
Sbjct: 227 EGLAKKIVDGEVPEVLKDAVIYSLDLGALVAGTKYRGDFEKRLKGVLAQLKRRKGSVLFI 286

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DASNL+KP L+SG ++CIGSTTY EYR  FEKD+AL RRFQKI
Sbjct: 287 DEIHTIIGAGAASGGVMDASNLIKPMLASGELKCIGSTTYQEYRGIFEKDRALARRFQKI 346

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EP++++  EI+KG+K  FE HH +RY+ +A+RAA +L+ R+ T R LPDKAIDVIDE
Sbjct: 347 DVNEPTVDETYEILKGLKSRFESHHDVRYTNKALRAAAELASRYITDRHLPDKAIDVIDE 406

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA++ LQP S R+K I+  D++  +A + R I   S S  D   L NLE+NL  VV+GQ
Sbjct: 407 AGANRRLQPASTRKKTISVHDVEAIVAKIAR-IPPKSVSASDMETLKNLERNLNMVVFGQ 465

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           +EAI  L+++IK+AR+GL D  KPIG ++F+GPTGVGKTE+++QLA  LG++L+RFDMSE
Sbjct: 466 DEAISTLAAAIKMARSGLGDGQKPIGSFLFAGPTGVGKTEVTRQLADLLGIELVRFDMSE 525

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVG+ +GG+L D++ ++P++V+LLDE+EK+HPDV N+LLQ+MD+
Sbjct: 526 YMERHTVSRLIGAPPGYVGYDEGGLLTDAILKHPHAVLLLDEVEKAHPDVFNLLLQVMDH 585

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K+ FRNVIL+MT+N GA   S+A +GF    +     E L+   +PEF NR
Sbjct: 586 GTLTDTNGRKVDFRNVILVMTSNVGADVSSRATMGFTRQDHSSDAMEVLKRTFTPEFRNR 645

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F PL+ + I  VV KF+ +L+ QL EK +     EE   WL  HGYD KMGARP
Sbjct: 646 LDAIIQFRPLAPETIASVVDKFLTQLQAQLDEKKVVLDVDEEARTWLAEHGYDPKMGARP 705

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           + R+I+EH+K PLA+EILFG+L  GGG V V++
Sbjct: 706 MARVIQEHIKKPLAEEILFGRL-AGGGEVSVTV 737


>gi|289666026|ref|ZP_06487607.1| ATP-dependent Clp protease subunit [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289670484|ref|ZP_06491559.1| ATP-dependent Clp protease subunit [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 760

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/748 (54%), Positives = 543/748 (72%), Gaps = 14/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLL+L+D+  A  V+ +C  D   L N+L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLSLLDNPSAQAVLKACGADQVRLHNDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN++SHGI+K  E     S    DG S    GEG     +AK D  
Sbjct: 120 VYFLNQQDITRLDIVNYLSHGIAKLGEDGEQPSA--PDGESKSEGGEG-----EAKGD-- 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ +  +L E+ + GK+D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 171 ---ALAEFATNLNEQARNGKIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVD  VP++L  A I+SLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 228 EGLAKRIVDNDVPEVLADAVIYSLDLGALVAGTKYRGDFEKRLKGVLAALKKVPNAVLFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPALSSG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGTMDASNLIKPALSSGELRCIGSTTFQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+KP +E HH + Y+ +A++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 348 DIVEPTVGETFEILQGLKPKYEAHHGVTYADDALQAAVDLSVKHIGDRLLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P  KR++ I  ++I+  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 408 AGARQRLLPEGKRKELIDIEEIETIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ SIK+AR+GL++P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 NPAIETLAGSIKLARSGLANPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 527 YMEAHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           GILTD +G++ +F+NVIL+MTTNAGA + S+  IGF    +     E++R   +PEF NR
Sbjct: 587 GILTDTNGREANFKNVILVMTTNAGATQASRRSIGFTKQDHSTDAMESIRRGFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F PL  D I +VV KFI++LE+ LQEK +S   +    +WL  HG+D  MGARP
Sbjct: 647 LDAIVQFQPLGFDHILRVVDKFIIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I+E +K PLADE+LFGKL  GG V
Sbjct: 707 MSRVIQEKIKRPLADELLFGKLVDGGRV 734


>gi|78047605|ref|YP_363780.1| ATP-dependent Clp protease subunit [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927855|ref|ZP_08189079.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Xanthomonas
           perforans 91-118]
 gi|78036035|emb|CAJ23726.1| ATP-dependent Clp protease subunit [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325541695|gb|EGD13213.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Xanthomonas
           perforans 91-118]
          Length = 760

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/748 (54%), Positives = 544/748 (72%), Gaps = 14/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLL+L+D+  A  V+ +C  D   L N+L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLSLLDNPSAQAVLKACGADQVRLHNDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN++SHGI+K  E     S    DG S    GEG     +AK D  
Sbjct: 120 VYFLNQQDITRLDIVNYLSHGIAKLGEDGEQPSA--PDGESKSEGGEG-----EAKGD-- 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ +  +L ++ + GK+D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 171 ---ALAEFATNLNDQARNGKIDPLVGRSDEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVD  VP++L  A I+SLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 228 EGLAKRIVDNDVPEVLADAVIYSLDLGALVAGTKYRGDFEKRLKGVLAALKKVPNAVLFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPALSSG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGTMDASNLIKPALSSGELRCIGSTTFQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+KP +E HH + Y+ +A++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 348 DIVEPTVGETFEILQGLKPKYEAHHGVTYADDALQAAVDLSVKHIGDRLLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P  KR++ I  ++I+  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 408 AGARQRLLPEGKRKELIDIEEIETIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ SIK+AR+GL++P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 NPAIETLAGSIKLARSGLANPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 527 YMEAHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           GILTD +G++ +F+NVIL+MTTNAGA + S+  IGF    +     E++R   +PEF NR
Sbjct: 587 GILTDTNGREANFKNVILVMTTNAGATQASRRSIGFTKQDHSTDAMESIRRGFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F PL+ D I +VV KFI++LE+ LQEK +S   +    +WL  HG+D  MGARP
Sbjct: 647 LDAIVQFQPLAFDHILRVVDKFIIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I+E +K PLADE+LFGKL  GG V
Sbjct: 707 MSRVIQEKIKRPLADELLFGKLVDGGRV 734


>gi|88812889|ref|ZP_01128133.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Nitrococcus
           mobilis Nb-231]
 gi|88789811|gb|EAR20934.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Nitrococcus
           mobilis Nb-231]
          Length = 755

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/750 (53%), Positives = 539/750 (71%), Gaps = 15/750 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE  L+ A   A E++HE+ T+EHLLLAL D+  A  V+ +C  +L  L+ +L +
Sbjct: 1   MLSKELEFTLNLAFKEAREKHHEFLTVEHLLLALTDNPAALEVLRACGANLDQLRRDLES 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D  +     N  R E +PT  FQRV+QRA+LHVQS+GR  VTGAN+LVA+FSE +S A
Sbjct: 61  FLDETTPVLPPNDSR-ETQPTLGFQRVLQRAILHVQSSGRKEVTGANVLVAIFSEQESQA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFV-NDYQAKTDL 181
            YFL ++ ++  D VNFISHGISK            V G   G++  G   +D +A  + 
Sbjct: 120 VYFLHKENISRLDTVNFISHGISK------------VPGDGDGTEPSGMPQDDEEAAAEP 167

Query: 182 NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
           +    L ++  DL  K ++G++D L+GR  EI RTIQ+LCRR KNNPLYVG+ GVGKTAI
Sbjct: 168 SSRKPLESFAADLNAKAERGEIDPLIGRRNEIERTIQVLCRRRKNNPLYVGEAGVGKTAI 227

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG AK IVD  VPD+L  ARI+ LD+G ++AGT+YRGDFE+R+K ++ +++   NAIL+
Sbjct: 228 AEGLAKMIVDRQVPDVLKDARIYCLDLGAVVAGTKYRGDFEKRLKGVLAQLKREKNAILF 287

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHT++GAGSASG  +DASNL+KP L+SG ++CIGSTTY EYR  FEKD+AL RRFQK
Sbjct: 288 IDEIHTVIGAGSASGGVMDASNLIKPMLASGELKCIGSTTYQEYRGVFEKDRALARRFQK 347

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           IDVSEP+IE+ + I++G+K  FE HH +RY++ A+ +A  L+ ++ T R+LPDKAIDVID
Sbjct: 348 IDVSEPTIEETVLILRGLKERFEAHHGVRYTQPALESAAGLAAKYITDRRLPDKAIDVID 407

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           EAGA   L P SKRRK +   D++  IA M R I     S  D  +L NL+++L  V++G
Sbjct: 408 EAGAKLRLLPPSKRRKTVNVTDVETIIAKMAR-IPPRRVSTSDMRLLENLDQDLKRVIFG 466

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q++AI  LS++IK++RAGL D  KP+GC++F+GPTGVGKTE+++QLA  +GVQLLRFDMS
Sbjct: 467 QDQAIDTLSTTIKMSRAGLRDTEKPVGCFLFAGPTGVGKTEVTRQLAEVMGVQLLRFDMS 526

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERH VSRLIGAPPGYVGF QGG+L + V ++P+SVVLLDEIEK+H DV N+LLQ+MD
Sbjct: 527 EYMERHTVSRLIGAPPGYVGFDQGGLLTEEVIKHPHSVVLLDEIEKAHADVFNLLLQVMD 586

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
           +G LTD +G++  FRNVIL+MTTNAGA E S+  IGF +  +     E +R   +PEF N
Sbjct: 587 HGALTDNNGRQADFRNVILVMTTNAGAQEQSRRSIGFTAQDHSSDSMEIIRRIFAPEFRN 646

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD+II F  L+  ++ +V  KF+ +L  QL EK ++   S+    WL  HGYD KMGAR
Sbjct: 647 RLDAIIQFNALAPAVVERVADKFLRELRHQLAEKKVTLDVSDSARYWLAEHGYDPKMGAR 706

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           P+ R+I++ +K PLADE+LFG+L  GG VV
Sbjct: 707 PMARLIQDRIKRPLADELLFGRLASGGHVV 736


>gi|91774863|ref|YP_544619.1| ATPase AAA-2 [Methylobacillus flagellatus KT]
 gi|91708850|gb|ABE48778.1| ATPase AAA-2 [Methylobacillus flagellatus KT]
          Length = 763

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/748 (53%), Positives = 546/748 (72%), Gaps = 17/748 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A ++ HE  T+EHLLLA+ID+  AA V+ SC  +L  L++ L N
Sbjct: 1   MIAQELEVSLHMAFMDARQKRHELITVEHLLLAMIDNPTAADVLRSCGANLDNLRSELNN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           YI+ + +  ++    V+ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA++ E DSHA
Sbjct: 61  YIE-EHTPTVEGSEEVDTQPTLGFQRVIQRAILHVQSSGKKEVTGANVLVAIYGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            +FL +Q +T  D VN+ISHG++K  +               GS+ +    + +A+ D +
Sbjct: 120 VFFLHQQGITRLDVVNYISHGVAKVAD---------------GSNAKRPETEQEAEADSS 164

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL  Y  +L ++V  GK+D L+GR +E+ R IQ LCRR KNNPL VG+ GVGKTAIA
Sbjct: 165 PSSALENYTQNLNQQVLAGKIDPLIGRAQELERVIQTLCRRRKNNPLLVGEAGVGKTAIA 224

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VP++L  A I+SLDMG L+AGT+YRGDFE+R+K ++K++     AIL+I
Sbjct: 225 EGLARRIVEGNVPEVLENAVIYSLDMGALLAGTKYRGDFEQRLKAVMKKLADQPGAILFI 284

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALS+G+++CIG+TTY E+R  FEKD AL RRFQK+
Sbjct: 285 DEIHTLIGAGAASGGTLDASNLLKPALSNGSLKCIGATTYQEFRGIFEKDHALSRRFQKV 344

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPS+ + +EI+KG+K  FE+HH ++Y+  A+  A +LS R+   R LPDKAIDVIDE
Sbjct: 345 DVVEPSVSETVEILKGLKSRFEKHHSVKYTASALNTAAELSARYINDRHLPDKAIDVIDE 404

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P SK++K I  K+I+  IA + R I   + S DD + L  LE++L   V+GQ
Sbjct: 405 AGAAQRILPKSKQKKVIGNKEIEDIIAKVAR-IPPKNISSDDRNALKTLERDLKATVFGQ 463

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ LS++IK+AR+GL  PNKPIG ++FSGPTGVGKTE+++QLA+ LGV+L+RFDMSE
Sbjct: 464 DKAIEALSAAIKMARSGLGSPNKPIGSFLFSGPTGVGKTEVARQLAYTLGVELIRFDMSE 523

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG+L +++++ PY V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 524 YMERHAVSRLIGAPPGYVGFEQGGLLTEAINKTPYCVLLLDEIEKAHPDIFNILLQVMDH 583

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNV +IMTTNAGA  +SK  IGF    N   +   ++   SPEF NR
Sbjct: 584 GTLTDNNGRKADFRNVTIIMTTNAGAEAISKTSIGFTLGSNSGDEMGDIKRLFSPEFRNR 643

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F PLS +II +VV KF+M+LE QL EK +   FS+ +  +L   G+D  MGARP
Sbjct: 644 LDAIVSFAPLSEEIIVRVVDKFLMQLEDQLHEKKVEATFSDALKAYLGKKGFDPLMGARP 703

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I++ ++  LADE+LFGKL  GG V
Sbjct: 704 MSRLIQDTIRRALADELLFGKLANGGHV 731


>gi|226939298|ref|YP_002794369.1| ClpA [Laribacter hongkongensis HLHK9]
 gi|226714222|gb|ACO73360.1| ClpA [Laribacter hongkongensis HLHK9]
          Length = 776

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/782 (51%), Positives = 568/782 (72%), Gaps = 8/782 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A ++ HE  ++EHLLLA++D+  AA V+ SC  ++  L+  L  
Sbjct: 1   MIAQELEVSLHMAFMEARQKRHELISVEHLLLAMLDNPSAAEVLRSCGANIDQLRKQLTE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           + D + +  +     VE +PT  FQRV+QRA+LHVQS+G+  VTGANILVA+F E DSHA
Sbjct: 61  FTD-EHTPVVPGSEDVETQPTLGFQRVIQRAILHVQSSGKKEVTGANILVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q ++  D VNFISHGI+K     N +S+      +  S  E   N+ +A+   +
Sbjct: 120 VYFLHQQNISRLDVVNFISHGITK-DSGNNKKSEPPPGRPAPSSQNENSENEQEAEAS-S 177

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL  Y  +L +  + GK+D ++GR  E+ R IQILCRR KNNPL VG+ GVGKTAIA
Sbjct: 178 AGGALENYTQNLNQMAQAGKIDPVIGRDHELERVIQILCRRRKNNPLLVGEAGVGKTAIA 237

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV G VP++L  + +++LDMG L+AGT+YRGDFE+R+K +VK++    NAIL+I
Sbjct: 238 EGLARRIVQGEVPEVLAQSTVYALDMGALLAGTKYRGDFEQRLKGVVKQLSEDRNAILFI 297

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALS+G++RCIG+TTY+EYR  FEKD AL RRFQKI
Sbjct: 298 DEIHTLIGAGAASGGTLDASNLLKPALSNGSLRCIGATTYNEYRGIFEKDNALSRRFQKI 357

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EP++E  I+I+KG+K  FE HH ++Y+  A+  A +LS R+   R LPDKAIDVIDE
Sbjct: 358 DVAEPTVEQTIQILKGLKSRFEAHHGIKYTLSALSTAAELSARYINDRHLPDKAIDVIDE 417

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P S+++K I++ +I+  ++ + R I   + S +D + L  LE++L  VV+GQ
Sbjct: 418 AGAAQRILPKSRQKKVISKHEIEDIVSKIAR-IPAKTVSNNDRNALKTLERDLKNVVFGQ 476

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI+ L+++IK+AR+GL +P KPIG ++FSGPTGVGKTE+++QLA+ LG++L+RFDMSE
Sbjct: 477 DPAIEALAAAIKMARSGLGNPQKPIGSFLFSGPTGVGKTEVARQLAYTLGIELIRFDMSE 536

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG+L + ++++PY+V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 537 YMERHAVSRLIGAPPGYVGFEQGGLLTEQINKHPYAVLLLDEIEKAHPDIFNILLQVMDH 596

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVI+IMTTNAGA  +SK+ IGF S++    +   ++   +PEF NR
Sbjct: 597 GTLTDNNGRKADFRNVIIIMTTNAGAESLSKSSIGFTSTKASGDELADIKRLFTPEFRNR 656

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F  L   II QVV KF+M+LE QL E+ +   FS+E+  +L   G+D +MGARP
Sbjct: 657 LDAIISFRMLDETIILQVVDKFLMQLEAQLSERKVEIQFSDELKRFLARKGFDPQMGARP 716

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIF-FEIENSGSNISLETE 781
           + R+I++ ++  LADE+LFG+L +GG    V+++ D+SA   +  F+ E++ +     TE
Sbjct: 717 MARLIQDTIRKALADELLFGRLSEGG---SVTIDHDESADKVVLQFDQEDTHTRQQAITE 773

Query: 782 EK 783
           ++
Sbjct: 774 DE 775


>gi|325915387|ref|ZP_08177704.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325538434|gb|EGD10113.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 760

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/748 (53%), Positives = 543/748 (72%), Gaps = 14/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLL+L+D+  A  V+ +C  D   L N+L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLSLLDNPSAQAVLKACGADQLRLHNDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN++SHGI+K  E     S  + +  S G +GE       AK D  
Sbjct: 120 VYFLNQQDITRLDIVNYLSHGIAKLGEDGEQPSASDGEPKSEGGEGE-------AKGD-- 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ Y  +L E+ + GK+D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 171 ---ALAEYATNLNEQARNGKIDPLVGRGDEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVD  VP++L  A IFSLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 228 EGLAKRIVDNDVPEVLADAVIFSLDLGALVAGTKYRGDFEKRLKGVLAALKKVPNAVLFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPALSSG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGTMDASNLIKPALSSGELRCIGSTTFQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+KP +E HH + Y+ +A++AAV LSV+H   R LPDKAIDV+DE
Sbjct: 348 DIVEPTVGETFEILQGLKPKYEAHHGVTYADDALQAAVDLSVKHIGDRLLPDKAIDVMDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P   R++ I  ++I+  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 408 AGARQRLLPDGVRKELIDIEEIETIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ SIK+AR+GL++P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 NPAIETLAGSIKLARSGLANPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 527 YMEAHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           GILTD +G++ +F+NVIL+MTTNAGA + S+  IGF    +     E++R   +PEF NR
Sbjct: 587 GILTDTNGREANFKNVILVMTTNAGATQASRRSIGFTKQDHSTDAMESIRRGFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F PL  D I +VV KFI++LE+ LQEK +S   +    +WL  HG+D  MGARP
Sbjct: 647 LDAIVQFQPLGFDHILRVVDKFIIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I+E +K PLADE+LFGKL +GG V
Sbjct: 707 MSRVIQEKIKRPLADELLFGKLVEGGRV 734


>gi|21242745|ref|NP_642327.1| ATP-dependent Clp protease subunit [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|294625257|ref|ZP_06703896.1| ATP-dependent Clp protease subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294666595|ref|ZP_06731834.1| ATP-dependent Clp protease subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|21108223|gb|AAM36863.1| ATP-dependent Clp protease subunit [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|292600431|gb|EFF44529.1| ATP-dependent Clp protease subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292603615|gb|EFF47027.1| ATP-dependent Clp protease subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 760

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/748 (54%), Positives = 543/748 (72%), Gaps = 14/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLL+L+D+  A  V+ +C  D   L N+L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLSLLDNPSAQAVLKACGADQVRLHNDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN++SHGI+K  E     S    DG S    GEG     +AK D  
Sbjct: 120 VYFLNQQDITRLDIVNYLSHGIAKLGEDGEQPSA--PDGESKSEGGEG-----EAKGD-- 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ +  +L E+ + GK+D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 171 ---ALAEFASNLNEQARNGKIDPLVGRSDEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVD  VP++L  A I+SLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 228 EGLAKRIVDNDVPEVLADAVIYSLDLGALVAGTKYRGDFEKRLKGVLAALKKVPNAVLFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPALSSG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGTMDASNLIKPALSSGELRCIGSTTFQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+KP +E HH + Y+ +A++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 348 DIVEPTVGETFEILQGLKPKYEAHHGVTYADDALQAAVDLSVKHIGDRLLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P   R++ I  ++I+  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 408 AGARQRLLPEGTRKELIDIEEIETIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ SIK+AR+GL++P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 NPAIETLAGSIKLARSGLANPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 527 YMEAHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           GILTD +G++ +F+NVIL+MTTNAGA + S+  IGF    +     E++R   +PEF NR
Sbjct: 587 GILTDTNGREANFKNVILVMTTNAGATQASRRSIGFTKQDHSTDAMESIRRGFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F PL+ D I +VV KFI++LE+ LQEK +S   +    +WL  HG+D  MGARP
Sbjct: 647 LDAIVQFQPLAFDHILRVVDKFIIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I+E +K PLADE+LFGKL  GG V
Sbjct: 707 MSRVIQEKIKRPLADELLFGKLVDGGRV 734


>gi|74317255|ref|YP_314995.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Thiobacillus
           denitrificans ATCC 25259]
 gi|74056750|gb|AAZ97190.1| ATP-dependent Clp protease, ATP-binding subunit [Thiobacillus
           denitrificans ATCC 25259]
          Length = 750

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/749 (52%), Positives = 542/749 (72%), Gaps = 18/749 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A ++ HE+ ++EHLL+A++D+  AA V+ +C  ++  ++  L  
Sbjct: 1   MIAQELEVSLHMAFMDARQKRHEFISVEHLLMAMLDNPSAAEVLRACGANIDTMREQLGK 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +     +G  V+ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  FIDEHTPRVGGDG-EVDTQPTLGFQRVIQRAILHVQSSGKKEVTGANVLVAVFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q +T  D VNFISHGI+K       QS+      +  +  E   N         
Sbjct: 120 VYFLTQQGVTRLDIVNFISHGITKTP-----QSEPTRPEDATEASAEAVSN--------- 165

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L ++  +L  +   G++D L+GR  E+ R +Q LCRR KNNPL VG+ GVGKTAIA
Sbjct: 166 --APLDSFAQNLNAQALAGRIDPLIGRDPELERVVQTLCRRRKNNPLLVGEAGVGKTAIA 223

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VPDIL  + +++LDMG L+AGT+YRGDFE+R+K ++K++     AIL+I
Sbjct: 224 EGLARRIVEGNVPDILAQSTVYALDMGALLAGTKYRGDFEQRLKGVLKQLADNPKAILFI 283

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALSSG +RCIG+TTY+EYR  FEKD AL RRFQK+
Sbjct: 284 DEIHTLIGAGAASGGTLDASNLLKPALSSGQLRCIGATTYTEYRGIFEKDHALSRRFQKV 343

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPS+ + + I++G+K  FE+HH ++Y+  A+  A QL+ R+   R LPDKAIDVIDE
Sbjct: 344 DVPEPSVNETVAILRGLKSRFEDHHGVKYTAAALSTAAQLAARYINDRHLPDKAIDVIDE 403

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P SK+R+ IT ++I++ I+ + R I   + S DD + L  L+++L  VVYGQ
Sbjct: 404 AGAAQRILPKSKQRRVITPREIEEIISKIAR-IPPKTVSSDDKNSLKTLDRDLKAVVYGQ 462

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI  LS++IK++R+GL +P KPIG ++FSGPTGVGKTE+++QLA+ LGV+L+RFDMSE
Sbjct: 463 DAAIDALSTAIKMSRSGLGNPQKPIGNFLFSGPTGVGKTEVARQLAYVLGVELIRFDMSE 522

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG+L ++V ++PY+VVLLDE+EK+HPD+ N+LLQ+MD+
Sbjct: 523 YMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKHPYAVVLLDEVEKAHPDIFNVLLQVMDH 582

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNV+LIMTTNAGA  ++KA IGF  +R    +   ++   +PEF NR
Sbjct: 583 GTLTDTNGRKADFRNVVLIMTTNAGAEMLNKATIGFAGARESGDEMGEIKRMFTPEFRNR 642

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+IIPF PLS  +I QVV KF+M+LE QL EK +   F++ +  +L  HG+D  MGARP
Sbjct: 643 LDAIIPFAPLSEPVILQVVEKFLMQLEEQLHEKKVEAVFTDALKAYLAKHGFDPSMGARP 702

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV 751
           + R+I++ ++  LADE+LFG+L  GG V 
Sbjct: 703 MARLIQDTIRKALADELLFGRLATGGRVT 731


>gi|238028417|ref|YP_002912648.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           glumae BGR1]
 gi|237877611|gb|ACR29944.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           glumae BGR1]
          Length = 765

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/771 (52%), Positives = 555/771 (71%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           + D + AG DG     D  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTG---------SSDAAKAG-DGTPESEDANAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGRETEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A++FSLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAWRITRGEVPDILANAQVFSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGNLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVNEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSSRFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKAEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M K  IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKGTIGFTTRRETGDEMAEIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDS I F  L  +II +VV KF+++LE QL EK +   F++ +  +L  HG+D  MGA
Sbjct: 645 NRLDSTISFRSLDEEIIMRVVDKFLIQLEDQLHEKKVDALFTDALRKYLSKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V         V L+ D SA  P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVSGGRVTVDVDENDAVQLSFDNSAEPP 755


>gi|288941932|ref|YP_003444172.1| ATP-dependent Clp protease ATP-binding subunit clpA [Allochromatium
           vinosum DSM 180]
 gi|288897304|gb|ADC63140.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Allochromatium vinosum DSM 180]
          Length = 755

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/752 (53%), Positives = 538/752 (71%), Gaps = 16/752 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE  L++A   A  ++HEY T+EH+LL+L+D+  AA V+ +C  D + L+  +  
Sbjct: 1   MLSKELEFTLNRAFKEARAKHHEYMTVEHMLLSLLDNPTAAKVLRACGADAERLRREIAT 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I+  +     N  R + +PT  FQRV+QRAV HVQS G+  VTGAN+LVALFSE DS A
Sbjct: 61  FIEETTPLIPPNEER-DTQPTLGFQRVLQRAVFHVQSAGKKEVTGANVLVALFSEQDSQA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L +Q++T  D VN+ISHGISK            V G +   DG G     +A+ +  
Sbjct: 120 VYLLNQQDVTRLDVVNYISHGISK------------VPGENRDEDGHGGGEADEARGEEK 167

Query: 183 LFPA-LSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
              + L ++  +L E  ++G++D L+GR  E+ RTIQILCRR KNNPL+VG+ GVGKTAI
Sbjct: 168 EGASPLESFTTNLNELARQGRIDPLIGRAPEVERTIQILCRRRKNNPLFVGEAGVGKTAI 227

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG AK+IVDG VP++L  A I+SLD+G L+AGT+YRGDFE+R+K ++ +++   +AIL+
Sbjct: 228 AEGLAKKIVDGEVPEVLANAVIYSLDLGGLVAGTKYRGDFEKRLKAVLAQLKRQPHAILF 287

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHT++GAGSASG  +DASNL+KP L+SG +RCIGSTTY EYR  FEKD+AL RRFQK
Sbjct: 288 IDEIHTIIGAGSASGGVMDASNLIKPVLASGDLRCIGSTTYQEYRGIFEKDRALARRFQK 347

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           IDV EPS+E+ +EI+KG+K  FE HHQ+ Y++ A+RAA +LS RH   R LPDKAIDVID
Sbjct: 348 IDVEEPSVEETVEILKGLKSRFEAHHQVSYTQPALRAAAELSARHINDRHLPDKAIDVID 407

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           EAGA   L   SKR+K I   D++  +A + R I     S  D   L NL+++L  VVYG
Sbjct: 408 EAGAHVQLMAPSKRKKRIDVADVEAIVAKIAR-IPPKRVSASDAESLKNLDRDLKMVVYG 466

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q+ AI  L+S+I++ R+GL    KPIG ++F+GPTGVGKTE+++QLA  LG++LLRFDMS
Sbjct: 467 QDAAIDALTSAIRMNRSGLGHEEKPIGSFLFTGPTGVGKTEVTRQLARILGMELLRFDMS 526

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERH VSRLIGAPPGYVGF QGG+L + ++++P++V+LLDEIEK+HPDV N+LLQ+MD
Sbjct: 527 EYMERHTVSRLIGAPPGYVGFDQGGLLTEQINKHPHAVLLLDEIEKAHPDVFNLLLQVMD 586

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
           +G LTD +G+K  FRNV+L+MTTNAGA E S+  IGF    +     EAL+ + +PEF N
Sbjct: 587 HGTLTDNNGRKADFRNVVLVMTTNAGAEETSRRSIGFTEQNHATDGMEALKRYFTPEFRN 646

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLDSI+ F PL  D I  VV KFI +LE QL+EK ++    ++   WL   GYD KMGAR
Sbjct: 647 RLDSIVQFGPLGEDTILNVVDKFIFELEQQLEEKKVALTIDQDARRWLADTGYDPKMGAR 706

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVVKV 753
           P+ RII++H+K PLA+E+LFG L  GGG V+V
Sbjct: 707 PMARIIQQHIKKPLANELLFGDL-VGGGSVRV 737


>gi|21231415|ref|NP_637332.1| ATP-dependent Clp protease subunit [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768531|ref|YP_243293.1| ATP-dependent Clp protease subunit [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21113083|gb|AAM41256.1| ATP-dependent Clp protease subunit [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573863|gb|AAY49273.1| ATP-dependent Clp protease subunit [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 760

 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/748 (53%), Positives = 541/748 (72%), Gaps = 14/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLL+L+D+  A  V+ +C  D   L  +L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLSLLDNPSAQAVLKACGADQVRLHTDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN++SHGI+K  E     S  + +  S   +GEG       K D  
Sbjct: 120 VYFLNQQDITRLDIVNYLSHGIAKLGEDGEQPSASDGEPKSDAGEGEG-------KGD-- 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ Y  +L +  + GK+D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 171 ---ALAEYATNLNDHARNGKIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVD  VP++L  A IFSLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 228 EGLAKRIVDADVPEVLADAVIFSLDLGALVAGTKYRGDFEKRLKGVLTALKKVPNAVLFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPAL+SG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGTMDASNLIKPALASGELRCIGSTTFQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+KP +E HH + Y+ +A++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 348 DIVEPTVGETFEILQGLKPKYEAHHGVTYADDALQAAVDLSVKHIGDRLLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P  +R++ I  ++I+  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 408 AGARQRLLPEGQRKELIDIQEIETIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ SIK+AR+GL++P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 NPAIETLAGSIKLARSGLANPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 527 YMEAHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           GILTD +G++ +F+NVIL+MTTNAGA + S+  IGF    +     E++R   +PEF NR
Sbjct: 587 GILTDTNGREANFKNVILVMTTNAGATQASRRSIGFTKQDHSTDAMESIRRGFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F PL  D I +VV KFI++LE+ LQEK +S   +    +WL  HG+D  MGARP
Sbjct: 647 LDAIVQFQPLGFDHILRVVDKFIIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I+E +K PLADE+LFGKL +GG V
Sbjct: 707 MSRVIQEKIKRPLADELLFGKLVEGGRV 734


>gi|187478581|ref|YP_786605.1| ATP-dependent clp protease ATP-binding [Bordetella avium 197N]
 gi|115423167|emb|CAJ49698.1| ATP-dependent clp protease ATP-binding (chaperone) [Bordetella
           avium 197N]
          Length = 767

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/757 (54%), Positives = 553/757 (73%), Gaps = 20/757 (2%)

Query: 4   FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNY 63
            S+ LE  LH A V A    HE+ T+EHLLLAL+D++ A  V+ +C  +L  L+ NL  +
Sbjct: 2   ISQELEVSLHMAFVEARSARHEFITVEHLLLALLDNASAVEVLRACAANLDDLRRNLRQF 61

Query: 64  IDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQS--TGRGIVTGANILVALFSEPDSH 121
           +  +++  + +G  V+ +PT  FQRV+QRA++HV +  TG+  VTGAN+LVA+F E DSH
Sbjct: 62  V-TENTPVIPSGAEVDTQPTLGFQRVIQRAIMHVSAGGTGKKPVTGANVLVAIFGEKDSH 120

Query: 122 ATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDL 181
           A Y+LQ+Q +T  D VNF+SHGI+K+ +    Q     +  SA  +G       +A+   
Sbjct: 121 AVYYLQQQGVTRLDVVNFLSHGITKQPQDEPVQK----EPQSASEEGS------EARQS- 169

Query: 182 NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
                L  Y  DL    + G++D L+GR  E+ R IQ+LCRR KNNPL VG+ GVGKTAI
Sbjct: 170 ----PLDQYANDLNAAAEAGRIDPLIGREHEVERVIQVLCRRRKNNPLLVGEAGVGKTAI 225

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG A +I  G VP+IL  A ++SLDMG L+AGT+YRGDFE+R+K ++K+I    +AIL+
Sbjct: 226 AEGLAWRITRGEVPEILQSAHVYSLDMGALLAGTKYRGDFEQRLKGVLKQIRGNPDAILF 285

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHTL+GAGSASG ++DASNLLKPALSSG ++CIG+TTY+EYR  FEKD AL RRFQK
Sbjct: 286 IDEIHTLIGAGSASGGTLDASNLLKPALSSGQLKCIGATTYTEYRGVFEKDHALSRRFQK 345

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           IDV EPS+E  ++I++G+K  FEEHH +RYS  A+ AA +LS R+   R LPDKAIDVID
Sbjct: 346 IDVPEPSVEQTVQILRGLKSRFEEHHSVRYSAAALSAAAELSARYINDRHLPDKAIDVID 405

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           EAGA+Q L P S+++K I + +I+  ++ + R I   S S DD S L+ L+++L TVV+G
Sbjct: 406 EAGAAQRLLPRSRQKKVIGKAEIEAIVSKIAR-IPPQSVSNDDRSRLATLDRDLKTVVFG 464

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q++AI  L++SIK+AR+GL  P KPIG ++FSGPTGVGKTE+++QLAF LGV+LLRFDMS
Sbjct: 465 QDQAIDALAASIKMARSGLGRPEKPIGAFLFSGPTGVGKTEVARQLAFTLGVELLRFDMS 524

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ NILLQ+MD
Sbjct: 525 EYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKQPHCVLLLDEIEKAHPDIFNILLQVMD 584

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
           +G LTD +G+K  FRNVILIMTTNAGA  +++A IGF +SR    +   +R   +PEF N
Sbjct: 585 HGTLTDNNGRKADFRNVILIMTTNAGAETLNRAAIGFTNSRVAGDEMAEIRRMFTPEFRN 644

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD+IIPF  L+ DII +VV KF+M+LE QL E+ +   F+E++ ++L  HG+D  MGAR
Sbjct: 645 RLDAIIPFAALNRDIILRVVDKFLMQLEDQLHERRVEAVFTEKLRDYLAKHGFDPLMGAR 704

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           P++R+I++ ++  LADE+LFG+L  GG V  V LN D
Sbjct: 705 PMQRLIQDTIRRALADELLFGRLVDGGNVT-VDLNED 740


>gi|188991660|ref|YP_001903670.1| ATP-dependent Clp protease subunit [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167733420|emb|CAP51621.1| ATP-dependent Clp protease subunit [Xanthomonas campestris pv.
           campestris]
          Length = 760

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/748 (53%), Positives = 541/748 (72%), Gaps = 14/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLL+L+D+  A  V+ +C  D   L  +L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLSLLDNPSAQAVLKACGADQVRLHTDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN++SHGI+K  E     S  + +  S   +GEG       K D  
Sbjct: 120 VYFLNQQDITRLDIVNYLSHGIAKLGEDGEQPSASDGEPKSDAGEGEG-------KGD-- 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ Y  +L +  + GK+D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 171 ---ALAEYATNLNDHARNGKIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVD  VP++L  A IFSLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 228 EGLAKRIVDADVPEVLADAVIFSLDLGALVAGTKYRGDFEKRLKGVLTALKKVPNAVLFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPAL+SG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGTMDASNLIKPALASGELRCIGSTTFQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+KP +E HH + Y+ +A++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 348 DIVEPTVGETFEILQGLKPKYEAHHGVTYADDALQAAVDLSVKHIGDRLLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P  +R++ I  ++I+  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 408 AGARQRLLPEGQRKELIDIEEIETIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ SIK+AR+GL++P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 NPAIETLAGSIKLARSGLANPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 527 YMEAHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           GILTD +G++ +F+NVIL+MTTNAGA + S+  IGF    +     E++R   +PEF NR
Sbjct: 587 GILTDTNGREANFKNVILVMTTNAGATQASRRSIGFTKQDHSTDAMESIRRGFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F PL  D I +VV KFI++LE+ LQEK +S   +    +WL  HG+D  MGARP
Sbjct: 647 LDAIVQFQPLGFDHILRVVDKFIIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I+E +K PLADE+LFGKL +GG V
Sbjct: 707 MSRVIQEKIKRPLADELLFGKLVEGGRV 734


>gi|254496297|ref|ZP_05109184.1| ATP binding protease component ClpA [Legionella drancourtii LLAP12]
 gi|254354485|gb|EET13133.1| ATP binding protease component ClpA [Legionella drancourtii LLAP12]
          Length = 755

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/753 (51%), Positives = 546/753 (72%), Gaps = 22/753 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E+ HE+ T+EHLLL+L+D+  A  V+ +C+ +++ L+ +L+ 
Sbjct: 1   MLNKELEFTLNLAFKEAKEKRHEFMTVEHLLLSLLDNPAAGNVLQACDANIEALRRDLIE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +    ++    E +PT  FQRV+QRAV HVQS G+  VTGAN+L A+FSE +S A
Sbjct: 61  FIDETTPRIPEDELDRETQPTLGFQRVLQRAVFHVQSAGKTEVTGANVLAAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKE---FANFQSKLNVD-GSSAGSDGEGFVNDYQAK 178
            YFL+ + +T  D +N+ISHG+SK +      N  S ++ D GSS G++           
Sbjct: 121 VYFLRRENITRLDVINYISHGVSKYQNNDMHENMNSSMDEDMGSSEGNES---------- 170

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                   L +YC +L ++ K+GK+D L+GRHEE+ RTIQ+LCRR KNNPL VG+ GVGK
Sbjct: 171 -------PLESYCTNLNKRAKQGKIDPLIGRHEEVQRTIQVLCRRRKNNPLLVGEAGVGK 223

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A++IVDG +P+ +    ++SLD+G L+AGT+YRGDFE+R+K ++K++     A
Sbjct: 224 TAIAEGLARRIVDGEIPEAIRDCVVYSLDLGALLAGTKYRGDFEKRLKAVLKQLGQQEGA 283

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           +L+IDEIHT++GAG+ASG  +DASNL+KP L++G ++CIGSTTY EYR  FEKD+AL RR
Sbjct: 284 VLFIDEIHTIIGAGAASGGVMDASNLIKPLLANGELKCIGSTTYQEYRGIFEKDRALARR 343

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKID+ EPSI++  EI+KG+K   EEHH ++++  A++AA +LS ++   R LPDKAID
Sbjct: 344 FQKIDIPEPSIDETFEILKGLKGRLEEHHGVKFTIPALKAAAELSAKYINDRFLPDKAID 403

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           V+DEAGA Q L   SKR+K I+  +I+  +A + R       +RD D+ L NLE++L  +
Sbjct: 404 VVDEAGAYQNLLTASKRKKIISVTEIESVVAKIARIPIKKVSARDKDT-LRNLERDLKLL 462

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           VYGQ++AI  LSS+IK+ R+GL +P KP+GC++F+GPTGVGKTE+++QLA  LG++LLRF
Sbjct: 463 VYGQDQAITALSSAIKLGRSGLREPQKPVGCFLFAGPTGVGKTEVTRQLANVLGIELLRF 522

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYME+H VSRLIGAPPGYVG+ QGG+L ++V +NP++V+LLDEIEK+HPDV N+LLQ
Sbjct: 523 DMSEYMEKHTVSRLIGAPPGYVGYDQGGLLTEAVTKNPHAVLLLDEIEKAHPDVFNLLLQ 582

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           IMD+G LTD +G++  FR++IL+MT+NAGA E+ +  IGF +  N +   E ++   SPE
Sbjct: 583 IMDHGTLTDTNGRQADFRHIILVMTSNAGASELVRNSIGFSAQDNTNDGLEVIKKQFSPE 642

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+II F PL S  I  VV KFIM+L+ QL  KG+SF+  +    WL+ HGYD  M
Sbjct: 643 FRNRLDAIINFAPLDSVTIGLVVDKFIMELDEQLSHKGVSFNVDKMAREWLIEHGYDKAM 702

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           GARP+ R+I+E+VK PLADE+LFGKL  GG V 
Sbjct: 703 GARPMARLIQENVKKPLADELLFGKLMHGGHVT 735


>gi|297539531|ref|YP_003675300.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylotenera
           sp. 301]
 gi|297258878|gb|ADI30723.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylotenera
           sp. 301]
          Length = 757

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/779 (51%), Positives = 552/779 (70%), Gaps = 34/779 (4%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A ++ HE  T+EHLLLA+ID+  AA VM +C   L+VL+  L  
Sbjct: 1   MIAQELEVSLHMAFMDARQKRHELITVEHLLLAMIDNPTAAEVMRACGAKLEVLRTELNQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           YI+  +   +     V+ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  YIEEHTPT-VGGQEDVDTQPTLGFQRVIQRAMLHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQ---SKLNVDGSSAGSDGEGFVNDYQAKT 179
            +FL +Q +T  D VNFISHG+SK  E A  +   ++ +V+ S AG              
Sbjct: 120 VFFLHQQGVTRLDVVNFISHGVSKIGETAKPEGADTEADVEASPAG-------------- 165

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                 AL  Y ++L  +V  GK+D L+GR  E+ R +Q LCRR KNNPL VG+ GVGKT
Sbjct: 166 ------ALENYTLNLNAQVAAGKIDPLIGRGPELERVVQTLCRRRKNNPLLVGEAGVGKT 219

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A++IV+  +P++L  A ++SLDMG L+AGT+YRGDFE+R+K ++K++    +AI
Sbjct: 220 AIAEGLARRIVEKDIPEVLANATVYSLDMGALLAGTKYRGDFEQRLKAVMKQLAENPDAI 279

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHTL+GAGSASG ++DASNLLKPALS+G ++CIG+TTY EYR  FEKD AL RRF
Sbjct: 280 LFIDEIHTLIGAGSASGGTLDASNLLKPALSNGTLKCIGATTYQEYRGIFEKDHALSRRF 339

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QK+DV+EPS+ + IEI+KG+K  FEEHH ++YS  A+  A +LS ++   R LPDKAIDV
Sbjct: 340 QKVDVTEPSVAETIEILKGLKSRFEEHHGVKYSASALTTAAELSAKYINDRHLPDKAIDV 399

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA+Q + P SK++K I  K+I+  IA + R I   + S DD S L  LE++L  VV
Sbjct: 400 IDEAGAAQRILPKSKQKKVIGNKEIEDIIAKIAR-IPPKNISADDRSALKTLERDLKAVV 458

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ+ AI+ L+S++K+AR+GL   NKP+G ++FSGPTGVGKTE++KQLA+ +G++L+RFD
Sbjct: 459 FGQDNAIEALTSAVKMARSGLGGNNKPVGSFLFSGPTGVGKTEVAKQLAYIMGIELIRFD 518

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERHAVSRLIGAPPGYVGF QGG++ +++ ++PY V+LLDEIEK+HPD+ NILLQ+
Sbjct: 519 MSEYMERHAVSRLIGAPPGYVGFEQGGLMTEAITKHPYCVLLLDEIEKAHPDIFNILLQV 578

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G+K  FRNV +IMTTNAGA  +SKA IGF +++    ++  ++   SPEF
Sbjct: 579 MDHGTLTDNNGRKADFRNVTIIMTTNAGAENLSKANIGFTNAKQAGDEQADIKRLFSPEF 638

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+ + F  LS DII +VV KF+++LE QL +K +   FS+ +  +L   G+D  MG
Sbjct: 639 RNRLDATVSFAALSQDIIIRVVDKFLIQLEDQLHDKKVEVTFSDALKAYLGKKGFDPLMG 698

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGV---------VKVSLNPDKSASSPIFFEI 769
           ARP+ R+I++ ++  LADE+LFGKL  GG V         VK+    DK+ S     E+
Sbjct: 699 ARPMARLIQDTIRKALADELLFGKLANGGSVHVDIDSKDEVKLIFADDKAPSESALAEV 757


>gi|317407704|gb|EFV87636.1| ATP-dependent Clp protease ATP-binding [Achromobacter xylosoxidans
           C54]
          Length = 775

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/789 (52%), Positives = 558/789 (70%), Gaps = 26/789 (3%)

Query: 2   SFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLL 61
           S  S+ LE  LH A V A    HE+ T+EHLLLAL+D++ A  V+ +C  +L  L+ NL 
Sbjct: 6   SVISQELEVSLHMAFVEARSARHEFITVEHLLLALLDNASAVEVLRACAANLDDLRRNLR 65

Query: 62  NYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQS--TGRGIVTGANILVALFSEPD 119
            ++ ++++  + +G  V+ +PT  FQRV+QRA++HV +  TG+  VTGAN+LVA+F E D
Sbjct: 66  QFV-SENTPVIPSGAEVDTQPTLGFQRVIQRAIMHVSAGGTGKKPVTGANVLVAIFGEKD 124

Query: 120 SHATYFLQEQEMTLYDAVNFISHGISKRK--EFANFQSKLNVDGSSAGSDGEGFVNDYQA 177
           SHA Y+LQ+Q +T  D VNF+SHGI+K+   E A  Q +   +G   G   +        
Sbjct: 125 SHAVYYLQQQGVTRLDVVNFLSHGITKQPQVESAAVQKEQQTNGEEQGESRQS------- 177

Query: 178 KTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG 237
                    L  Y  DL      G++D L+GR  E+ R IQ+LCRR KNNPL VG+ GVG
Sbjct: 178 --------PLDQYATDLNAAALAGRIDPLIGREHEVERVIQVLCRRRKNNPLLVGEAGVG 229

Query: 238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN 297
           KTAIAEG A +I  G VP+IL  A++F+LDMG L+AGT+YRGDFE+R+K ++K+I    +
Sbjct: 230 KTAIAEGLAWRITRGEVPEILQAAQVFALDMGALLAGTKYRGDFEQRLKGVLKQIRGNPD 289

Query: 298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR 357
           AIL+IDEIHTL+GAGSASG ++DASNLLKPALSSG ++CIG+TTY+EYR  FEKD AL R
Sbjct: 290 AILFIDEIHTLIGAGSASGGTLDASNLLKPALSSGQLKCIGATTYTEYRGVFEKDHALSR 349

Query: 358 RFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI 417
           RFQKIDV+EPS+E  ++I++G+K  FEEHH +RYS  A+ AA +LS R    R LPDKAI
Sbjct: 350 RFQKIDVAEPSVEQTVQILRGLKSRFEEHHNVRYSAAALSAAAELSARFINDRHLPDKAI 409

Query: 418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGT 477
           DVIDEAGA+Q L P S+++K I + DI+  ++ + R I   S S DD S L+ L+++L T
Sbjct: 410 DVIDEAGAAQRLLPRSRQKKVIGKVDIENIVSKIAR-IPPQSVSNDDRSKLATLDRDLKT 468

Query: 478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLR 537
           VV+GQ+ AI+ LS++IK+AR+GL  P KPIG ++FSGPTGVGKTE+++QLAF LGV+LLR
Sbjct: 469 VVFGQDNAIEALSAAIKMARSGLGKPEKPIGAFLFSGPTGVGKTEVARQLAFTLGVELLR 528

Query: 538 FDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL 597
           FDMSEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPDV NILL
Sbjct: 529 FDMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKQPHCVLLLDEIEKAHPDVFNILL 588

Query: 598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP 657
           Q+MD+G LTD +G+K  FRNVILIMTTNAGA  +++  IGF +SR    +   +R   +P
Sbjct: 589 QVMDHGTLTDNNGRKADFRNVILIMTTNAGAETLNRPSIGFANSRVVGDEMAEIRRMFTP 648

Query: 658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVK 717
           EF NRLD+IIPF PL  +II +VV KF+M+LE QL E+ +   F+  +   L   G+D  
Sbjct: 649 EFRNRLDAIIPFAPLDREIILRVVDKFLMQLEDQLHERRVEAVFTTALREHLAKEGFDPL 708

Query: 718 MGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNIS 777
           MGARP++R+I++ ++  LADE+LFGKL  GG     ++  D   +  +  + ++ G   S
Sbjct: 709 MGARPMQRLIQDTIRRALADELLFGKLVDGG-----TVTVDLDEAGKVTLDFDDHGKPPS 763

Query: 778 LETEEKEVE 786
              +++EVE
Sbjct: 764 AAPDKQEVE 772


>gi|88798704|ref|ZP_01114287.1| ATPase with chaperone activity, ATP-binding subunit [Reinekea sp.
           MED297]
 gi|88778467|gb|EAR09659.1| ATPase with chaperone activity, ATP-binding subunit [Reinekea sp.
           MED297]
          Length = 756

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/750 (52%), Positives = 544/750 (72%), Gaps = 20/750 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S++LE  L+ A   A  + HE+ T+EHLLLAL+D+  AA V+ +C  D+  L+ +L+ 
Sbjct: 1   MLSKDLELTLNSAFKEARAKRHEFMTVEHLLLALLDNHAAADVLSACAADIPQLRRDLIE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID+ +     +    E +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+FSE +S A
Sbjct: 61  FIDSTTPLIPVDDEDRETQPTLGFQRVLQRAVFHVQSSGKKEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRK----EFANFQSKLNVDGSSAGSDGEGFVNDYQAK 178
            YFL++Q ++  D VNFI+HGISK +    E  +F S+ + +   A S G          
Sbjct: 121 VYFLKQQSISRIDVVNFIAHGISKVQSDDAEHQDFHSEQSQEEGGAESSGSN-------- 172

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                   L ++  +L E    G++D LVGR  E++R +QIL RR KNNPL VG+ GVGK
Sbjct: 173 -------PLESFATNLNEAAANGRIDPLVGRDYEVDRVVQILSRRRKNNPLLVGETGVGK 225

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG AK+I+DG VP+I+LGA++FSLD+G L+AGT+YRGDFE+R+K ++ E++    +
Sbjct: 226 TAIAEGLAKRIIDGKVPEIMLGAQVFSLDLGALLAGTKYRGDFEKRLKALLAELKKRDKS 285

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHT++GAG+ASG  +DASNLLKP LSSG +RCIGSTT+ E+R  FEKD AL RR
Sbjct: 286 ILFIDEIHTIIGAGAASGGVMDASNLLKPMLSSGELRCIGSTTFQEFRGIFEKDSALTRR 345

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV+EPS+++  +I+KG+K  FEEHH L+Y+ +A+RAA +LS R+ T R LPDKAID
Sbjct: 346 FQKIDVNEPSVDETYKILKGLKSRFEEHHHLKYTDKALRAAAELSDRYITDRHLPDKAID 405

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDEAGA++ L+  SKR+K I   D++K +A++ R +   S +++D  +L+NLE+NL   
Sbjct: 406 VIDEAGAAERLKSESKRKKSIGVNDVEKVVAAIAR-VPAKSVNKNDKELLANLERNLKMT 464

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ+EAI+ ++S+IK+ARAGL   +KPIG ++F+GPTGVGKTE++KQLA +LGV+LLRF
Sbjct: 465 VFGQDEAIENIASAIKLARAGLKSADKPIGSFLFAGPTGVGKTEVTKQLAESLGVELLRF 524

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH  SRLIGAPPGYVGF QGG+L D V+++P+ V+LLDEIEK+HPDV N+LLQ
Sbjct: 525 DMSEYMERHTASRLIGAPPGYVGFDQGGLLTDGVNRHPHCVLLLDEIEKAHPDVFNLLLQ 584

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +G+K  FRNVILI+T+NAGA EMS+  +GF +  +     EA++   +PE
Sbjct: 585 VMDHGTLTDNNGRKTDFRNVILILTSNAGAQEMSRRSVGFTTQDHSTDGVEAIKKTFTPE 644

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD I+ F  L ++++  VV KF+++L+ QL +K +     +    WL   GYD  M
Sbjct: 645 FRNRLDGIVQFSALPAEVVLNVVDKFLVELQAQLDDKRVHLEVDQAAREWLAEQGYDRNM 704

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGG 748
           GARP+ R+I+E +K PLAD ILFG L  GG
Sbjct: 705 GARPMARLIQERIKRPLADLILFGALADGG 734


>gi|311107311|ref|YP_003980164.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Achromobacter
           xylosoxidans A8]
 gi|310762000|gb|ADP17449.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Achromobacter
           xylosoxidans A8]
          Length = 770

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/773 (53%), Positives = 549/773 (71%), Gaps = 28/773 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE  LH A V A    HE+ T+EHLLLAL+D++ A  V+ +C  +L  L+ NL  
Sbjct: 1   MISQELEVSLHMAFVEARSARHEFITVEHLLLALLDNASAVEVLRACAANLDDLRRNLRQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQS--TGRGIVTGANILVALFSEPDS 120
           ++ ++++  + +G  V+ +PT  FQRV+QRA++HV +  TG+  VTGAN+LVA+F E DS
Sbjct: 61  FV-SENTPVIPSGAEVDTQPTLGFQRVIQRAIMHVSAGGTGKKPVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRK--EFANFQSKLNVDGSSAGSDGEGFVNDYQAK 178
           HA Y+LQ+Q +T  D VNF+SHGI+K+   E A  Q +   +G   G   +         
Sbjct: 120 HAVYYLQQQGVTRLDVVNFLSHGITKQPQVESAAVQKEQQTNGEEQGESRQS-------- 171

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                   L  Y  DL      G++D L+GR  E+ R IQ+LCRR KNNPL VG+ GVGK
Sbjct: 172 -------PLDQYATDLNAAALAGRIDPLIGREHEVERVIQVLCRRRKNNPLLVGEAGVGK 224

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A +I  G VP+IL  A++FSLDMG L+AGT+YRGDFE+R+K ++K+I    +A
Sbjct: 225 TAIAEGLAWRITRGEVPEILQAAQVFSLDMGALLAGTKYRGDFEQRLKGVLKQIRGNPDA 284

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHTL+GAGSASG ++DASNLLKPALSSG ++CIG+TTY+EYR  FEKD AL RR
Sbjct: 285 ILFIDEIHTLIGAGSASGGTLDASNLLKPALSSGQLKCIGATTYTEYRGVFEKDHALSRR 344

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV+EPS+E  ++I++G+K  FEEHH +RYS  A+ AA +LS R    R LPDKAID
Sbjct: 345 FQKIDVAEPSVEQTVQILRGLKSRFEEHHSVRYSAAALSAAAELSARFINDRHLPDKAID 404

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDEAGA+Q L P S+++K I + DI+  ++ + R I   S S DD S L+ L+++L TV
Sbjct: 405 VIDEAGAAQRLLPRSRQKKVIGKVDIENIVSKIAR-IPPQSVSNDDRSKLATLDRDLKTV 463

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ+ AI+ LS++IK+AR+GL  P KPIG ++FSGPTGVGKTE+++QLAF LGV+LLRF
Sbjct: 464 VFGQDNAIEALSAAIKMARSGLGKPEKPIGAFLFSGPTGVGKTEVARQLAFTLGVELLRF 523

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPDV NILLQ
Sbjct: 524 DMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKQPHCVLLLDEIEKAHPDVFNILLQ 583

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +G+K  FRNVI+IMTTNAGA  +++  IGF +SR    +   +R   +PE
Sbjct: 584 VMDHGTLTDNNGRKADFRNVIVIMTTNAGAETLNRPSIGFANSRVVGDEMAEIRRMFTPE 643

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+IIPF PL  +II +VV KF+M+LE QL E+ +   F+  +   L   G+D  M
Sbjct: 644 FRNRLDAIIPFAPLDREIILRVVDKFLMQLEDQLHERRVEAIFTTTLREHLAKEGFDPLM 703

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           GARP++R+I++ ++  LADE+LFGKL  GG V        KV L+ D S   P
Sbjct: 704 GARPMQRLIQDTIRRALADELLFGKLVDGGTVTVDLDEEGKVKLDFDDSGKPP 756


>gi|291613433|ref|YP_003523590.1| ATP-dependent Clp protease ATP-binding protein [Sideroxydans
           lithotrophicus ES-1]
 gi|291583545|gb|ADE11203.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Sideroxydans
           lithotrophicus ES-1]
          Length = 753

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/750 (53%), Positives = 545/750 (72%), Gaps = 17/750 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLLA++D+  AA V+ +C  D++ L+  L+ 
Sbjct: 1   MIAQELEVSLHLAFVEARQKRHEFITVEHLLLAMLDNPSAAHVLRACGADIEELRAVLVQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I+  +      G  V+ +PT  FQRV+QRA+LHVQST +  VTGANILVALF E +SHA
Sbjct: 61  HIETHTPVVPGTG-EVDTQPTVGFQRVIQRAILHVQSTNKKEVTGANILVALFGEKESHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL ++ +T  D VN+I+HGI+K  E    Q       + A ++ E   ND        
Sbjct: 120 VYFLNQRAITRLDVVNYIAHGINKTAEI---QPATQKTANEADTEQES-SND-------- 167

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL  Y +DL      GKVD L+GR  E+ R IQ LCRR KNNPL VG+ GVGKTAIA
Sbjct: 168 --SALKNYTLDLNAHALAGKVDPLIGRSMELERVIQTLCRRRKNNPLLVGEAGVGKTAIA 225

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A+ I++G VP+IL  A ++SLDMG L+AGT+YRGDFE+R+K ++KE++   NA+L+I
Sbjct: 226 EGLARNIIEGEVPEILKDAHVYSLDMGALLAGTKYRGDFEQRLKAVLKELQDAPNAVLFI 285

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALSSGA++CIG+TTY EYR  FEKD AL RRFQKI
Sbjct: 286 DEIHTLIGAGAASGGTMDASNLLKPALSSGALKCIGATTYQEYRGIFEKDSALSRRFQKI 345

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DVSEPS+E  IEI+KG+K  FEEHH ++YS  A+ +A +LS R    R LPDKAIDV+DE
Sbjct: 346 DVSEPSVEQTIEILKGLKSRFEEHHSIKYSSAALTSAAELSSRFINDRHLPDKAIDVLDE 405

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P SK++K + + +I++ IA + R I   S S DD + L NL+++L   V+GQ
Sbjct: 406 AGAAQRILPKSKQKKVVGKHEIEEIIAKIAR-IPARSVSHDDRNALKNLDRDLKATVFGQ 464

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI  L+ +IK++R+GL +P KPIG ++FSGPTGVGKTE+++QLA+++G+ L RFDMSE
Sbjct: 465 DKAIDALARAIKMSRSGLGNPQKPIGSFLFSGPTGVGKTEVARQLAYSMGMPLHRFDMSE 524

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 525 YMERHAVSRLIGAPPGYVGFDQGGLLTEAITKQPHCVLLLDEIEKAHPDIFNILLQVMDH 584

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEA-LRNFLSPEFLN 661
           G LTD +G+K  FRNV++IMTTNAGA  ++KA++GF    +   D+   ++   +PEF N
Sbjct: 585 GTLTDNNGRKADFRNVVVIMTTNAGAEALNKAQMGFTKVASAVGDEMVDIKKMFTPEFRN 644

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD+I+ F PLS ++I +VV KF+M+LE QL EK +   F++ + ++L  +G+D  MGAR
Sbjct: 645 RLDAIVSFAPLSKEVILRVVDKFLMQLEEQLHEKKVDPLFTDALKDYLAENGFDPLMGAR 704

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           P+ R+I++ ++  LADE+LFGKL  GG V 
Sbjct: 705 PMARLIQDTIRSALADELLFGKLANGGKVT 734


>gi|325919555|ref|ZP_08181569.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Xanthomonas
           gardneri ATCC 19865]
 gi|325549964|gb|EGD20804.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Xanthomonas
           gardneri ATCC 19865]
          Length = 760

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/748 (54%), Positives = 544/748 (72%), Gaps = 14/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLL+L+D+  A  V+ +C  D   L N+L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLSLLDNDSAQAVLKACGADQVRLHNDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN++SHGI+K  E     S  + +  S G +GE       AK D  
Sbjct: 120 VYFLNQQDITRLDIVNYLSHGIAKLGEDGEQPSASDGEPKSEGGEGE-------AKGD-- 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ +  +L E+ + GK+D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 171 ---ALAEFATNLNEQARNGKIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVD  VP++L  A IFSLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 228 EGLAKRIVDNDVPEVLAEAVIFSLDLGALVAGTKYRGDFEKRLKGVLAALKKVPNAVLFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPALSSG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGTMDASNLIKPALSSGELRCIGSTTFQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+KP +E HH + Y+ +A++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 348 DIVEPTVGETFEILQGLKPKYEAHHGVTYADDALQAAVDLSVKHIGDRLLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P  KR++ I  ++I+  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 408 AGARQRLLPEGKRKELIDIEEIETIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ SIK+AR+GL++P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 NPAIETLAGSIKLARSGLANPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + V + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 527 YMEAHSISRLIGAPPGYVGFDQGGLLTEKVVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           GILTD +G++ +F+NVIL+MTTNAGA + S+  IGF    +     E++R   +PEF NR
Sbjct: 587 GILTDTNGREANFKNVILVMTTNAGATQASRRSIGFTKQDHSTDAMESIRRGFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F PL  D I +VV KFI++LE+ LQEK +S   +    +WL  HG+D  MGARP
Sbjct: 647 LDAIVQFQPLGFDHILRVVDKFIIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I+E +K PLADE+LFGKL +GG V
Sbjct: 707 MSRVIQEKIKRPLADELLFGKLVEGGRV 734


>gi|311694971|gb|ADP97844.1| ATP-dependent Clp protease ATP-binding subunit ClpA [marine
           bacterium HP15]
          Length = 756

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/769 (52%), Positives = 546/769 (71%), Gaps = 19/769 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S++LE  L+ A   A ++ HE+ T+EHLLLAL+D+  A  V+ +C  DLK L+  L+ 
Sbjct: 1   MLSKDLEITLNTAFKNARDKRHEFMTVEHLLLALLDNESAVGVLKACGADLKRLQEELVE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D+ +     +    E +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+FSE +S A
Sbjct: 61  FVDSTTPLIPSSDSERETQPTLGFQRVLQRAVFHVQSSGKKEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L++Q +   D VNF+SHGIS+ +   + +S+       AG +G       Q+K    
Sbjct: 121 VYVLKKQSIARIDVVNFVSHGISRVQGAEDQESQDQASHEEAGEEG------GQSK---- 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L +Y  +L E+ ++G++D L+GR  E+ R +QIL RR KNNPL VG+ GVGKTAIA
Sbjct: 171 ---PLESYATNLNEQARQGRIDPLIGREHEVERVVQILVRRRKNNPLLVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVDG VPDI+  A ++SLD+G L+AGT+YRGDFE+R+K ++ E++   +AIL+I
Sbjct: 228 EGLAKRIVDGQVPDIISDAVVYSLDLGALLAGTKYRGDFEKRLKGLLAELKKENHAILFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG  +DASNLLKP LSSG +RCIGSTT+ E+R  FEKD AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGVMDASNLLKPMLSSGEIRCIGSTTFQEFRGIFEKDSALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPS+ED  +I+KG+KP FE+HH L+Y+ +A+R A +LS R+ T R LPDKAIDVIDE
Sbjct: 348 DVNEPSVEDTYQILKGLKPNFEKHHDLKYTDKALRVAAELSDRYITDRHLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q LQP  KR+K +   +I+  +A++ R I   + S  D  +L NLE++L   V+GQ
Sbjct: 408 AGARQRLQPEGKRKKTVDVTEIEDVVANIAR-IPPKNVSTSDKDLLRNLERDLKMTVFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI+ LS++IK+ARAGL  P KP G ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 DPAIESLSTAIKLARAGLKAPEKPEGAFLFAGPTGVGKTEVTKQLAKVLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVG+ QGG+L +SV+++P+ V+LLDEIEK+HP+V N+LLQ+MD+
Sbjct: 527 YMERHTVSRLIGAPPGYVGYDQGGLLTESVNKHPHCVLLLDEIEKAHPEVFNLLLQVMDH 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FR+VIL+MTTNAGA  M++  IGF    +     E +    +PEF NR
Sbjct: 587 GTLTDNNGRKADFRHVILVMTTNAGAESMARRSIGFSEQDHSTDGMEIISKTFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD II F  L  D I  VV KF+ +L+ QL EK +  H  +E   WL   GYDV MGARP
Sbjct: 647 LDGIIQFGDLQIDTITHVVDKFLTELQAQLDEKHVVLHVDDEAKAWLAEKGYDVTMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIEN 771
           + R+I++ +K PLA++ILFG+L + GG V + L  D+     + FE E+
Sbjct: 707 MSRLIQDKIKRPLAEQILFGRLSEKGGDVFIHLRDDE-----LVFEYED 750


>gi|121998182|ref|YP_001002969.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Halorhodospira halophila SL1]
 gi|121589587|gb|ABM62167.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Halorhodospira
           halophila SL1]
          Length = 756

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/753 (52%), Positives = 545/753 (72%), Gaps = 14/753 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE  L+ A   A E+ HE+ T+EHLLLAL D+  A+ V+ +C  DL+ L+  L  
Sbjct: 1   MLSKELEFTLNLAFKDAREKRHEFLTVEHLLLALTDNPAASQVLKACGADLERLRGELQA 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++   +     N  R E +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+FSE +S A
Sbjct: 61  FLSETTPLLPVNDSR-ETQPTLGFQRVLQRAILHVQSSGKREVTGANVLVAIFSEQESQA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q ++  D VN+ISHGIS      +   +      S  +D EG     Q  +   
Sbjct: 120 VYFLHKQNISRLDVVNYISHGISSVGGEEDMGKE-----ESGPADEEGAAEPTQGGS--- 171

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L  Y  +L ++ + G++D L+GR  EI RT+Q+LCRR KNNPL+VG+ GVGKTAIA
Sbjct: 172 ---PLEQYATNLNQRARSGQIDPLIGRRYEIERTVQVLCRRRKNNPLFVGEAGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AKQIV+G VP++L  + I+SLD+G L+AGT+YRGDFE+R+K ++ +++  + +IL+I
Sbjct: 229 EGLAKQIVEGEVPEVLRESTIYSLDLGALVAGTKYRGDFEKRLKALLHQLKKDSGSILFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG  +DASNL+KP L+SG +RCIGSTTY EYR  FEKD+AL RRFQKI
Sbjct: 289 DEIHTIIGAGSASGGVMDASNLIKPMLASGELRCIGSTTYQEYRGIFEKDRALARRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DVSEPS+ED ++I+KG+K  FEEHH +R+++ A++AA +LS ++   R+LPDKAIDVIDE
Sbjct: 349 DVSEPSVEDTVQILKGLKSRFEEHHNVRFTEPALQAAAELSAKYINDRRLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA   L+P SKRRK +   DI+  +A + R I     S  D  VL NLE  L  +++GQ
Sbjct: 409 AGARLRLRPRSKRRKTVGLPDIESIVAKIAR-IPPKRVSSQDMKVLENLEGELKGLIFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           +EAI+ L+S+IK++RAGL  P++P+G ++F+GPTGVGKTE+++QLA   GVQ++RFDMSE
Sbjct: 468 DEAIESLASTIKMSRAGLGTPDRPVGTFLFAGPTGVGKTEVTRQLAEVTGVQMIRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVG+ QGG+L + V ++P+SV+LLDEIEK+HPDV N+LLQ+MD+
Sbjct: 528 YMERHTVSRLIGAPPGYVGYDQGGLLTEEVIKHPHSVLLLDEIEKAHPDVFNLLLQVMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G++  FRNV+L+MTTNAGA EMSK  IGF +  +     EA+R   SPEF NR
Sbjct: 588 GTLTDNNGREADFRNVVLVMTTNAGAEEMSKRSIGFTNESDTQDSMEAIRRTFSPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           +D+++ F PL  D +++VV KFI +L +QL EK ++     +   W+   GYD +MGARP
Sbjct: 648 IDAVVQFQPLGQDTVQRVVDKFIRELSVQLAEKRVTLVVDGDARRWIGEKGYDPQMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           + R+I++H+K PLA+++LFG+L  GGG V+V++
Sbjct: 708 MARVIQQHIKKPLAEQLLFGEL-TGGGEVEVTV 739


>gi|52841054|ref|YP_094853.1| ATP binding protease component ClpA [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628165|gb|AAU26906.1| ATP binding protease component ClpA [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 757

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/751 (51%), Positives = 546/751 (72%), Gaps = 14/751 (1%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M+  ++ LE  L+ A   A E+ HE+ T+EHLLL+L+D+  A  V+ +C+ +++ L+ +L
Sbjct: 1   MTMLNKELEFTLNLAFKEAKEKRHEFMTVEHLLLSLLDNPAAGNVLQACDANIEALRRDL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           + +ID  +    ++    E +PT  FQRV+QRAV HVQS G+  VTGAN+L A+FSE +S
Sbjct: 61  IEFIDETTPRIPEDELDRETQPTLGFQRVLQRAVFHVQSAGKTEVTGANVLAAIFSEQES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
            A YFL+ + +T  D +N+ISHG+SK   + N     N++ S         + +     +
Sbjct: 121 QAVYFLRRENITRLDVINYISHGVSK---YQNNDMHENMNSS---------MEEDMMTPE 168

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            N  P L +YC +L  + K+GK+D L+GRHEEI RTIQ+LCRR KNNPL VG+ GVGKTA
Sbjct: 169 GNESP-LDSYCTNLNRRAKQGKIDPLIGRHEEIQRTIQVLCRRRKNNPLLVGEAGVGKTA 227

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A++IVDG +PD + G  ++SLD+G L+AGT+YRGDFE+R+K ++K++     AIL
Sbjct: 228 IAEGLARRIVDGEIPDSIRGCVVYSLDLGALLAGTKYRGDFEKRLKAVLKQLGQQEGAIL 287

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ASG  +DASNL+KP L++G ++CIGSTTY EYR  FEKD+AL RRFQ
Sbjct: 288 FIDEIHTIIGAGAASGGVMDASNLIKPLLANGELKCIGSTTYQEYRGIFEKDRALARRFQ 347

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KID+SEP+I++  EI+KG+K   E HH +++S  +++AA +LS ++   R LPDKAIDV+
Sbjct: 348 KIDISEPTIDETFEILKGLKGKLEAHHGVKFSIPSLKAAAELSAKYINDRFLPDKAIDVV 407

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA Q L   +KR+K I+  +I+  +A + R       +RD D+ L NLE++L  +VY
Sbjct: 408 DEAGAYQNLLTANKRKKIISVTEIESVVAKIARIPIKKVSARDKDT-LRNLERDLKLLVY 466

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI  L+S+IK+ R+GL +P KP+GC++F+GPTGVGKTE+++QLA  LG++LLRFDM
Sbjct: 467 GQDQAITALASAIKLGRSGLREPQKPVGCFLFAGPTGVGKTEVTRQLANVLGIELLRFDM 526

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYME+H VSRLIGAPPGYVG+ QGG+L ++V +NP++V+LLDEIEK+HPDV N+LLQIM
Sbjct: 527 SEYMEKHTVSRLIGAPPGYVGYDQGGLLTEAVTKNPHAVLLLDEIEKAHPDVFNLLLQIM 586

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G++  FR++IL+MT+NAGA E+ +  IGF +  N +   E ++   SPEF 
Sbjct: 587 DHGTLTDTNGRQADFRHIILVMTSNAGASEIVRNSIGFSTQDNTNDGLEVIKKQFSPEFR 646

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F PL +  I  VV KFIM+L+ QL  KG++F   +    WL+ HGYD  MGA
Sbjct: 647 NRLDAIINFAPLDTQTIGLVVDKFIMELDEQLSHKGVTFTVDKSAREWLMEHGYDKAMGA 706

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           RP+ R+I+E++K PLADE+LFGKL  GG V 
Sbjct: 707 RPMARLIQENIKKPLADELLFGKLMHGGHVT 737


>gi|254247421|ref|ZP_04940742.1| ATP-dependent Clp protease ATP-binding subunit clpA [Burkholderia
           cenocepacia PC184]
 gi|124872197|gb|EAY63913.1| ATP-dependent Clp protease ATP-binding subunit clpA [Burkholderia
           cenocepacia PC184]
          Length = 772

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/772 (52%), Positives = 560/772 (72%), Gaps = 25/772 (3%)

Query: 2   SFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLL 61
           S  ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL 
Sbjct: 6   SMIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLR 65

Query: 62  NYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPD 119
           N+I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E D
Sbjct: 66  NFI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKD 124

Query: 120 SHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKT 179
           SHA Y+LQ+Q +T  D VNFISHGI+K     N ++  + D ++   D      + Q +T
Sbjct: 125 SHAVYYLQQQGVTRLDVVNFISHGIAKTN---NGEAAKSTDANAESEDA-----NAQKET 176

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                  L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKT
Sbjct: 177 ------PLAQFTQNLNQMAKDGRIDPLIGREPEVERVVQVLCRRRKNNPLLVGEAGVGKT 230

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AI
Sbjct: 231 AIAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAI 290

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRF
Sbjct: 291 LFIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRF 350

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QK+DV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDV
Sbjct: 351 QKVDVTEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDV 410

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV
Sbjct: 411 IDEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVV 469

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFD
Sbjct: 470 FGQDPAIDALAASIKMARAGLGKMDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFD 529

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+
Sbjct: 530 MSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQV 589

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF
Sbjct: 590 MDHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMTDIKRLFTPEF 649

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLDSII F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MG
Sbjct: 650 RNRLDSIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMG 709

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           ARP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK A+ P
Sbjct: 710 ARPMQRLIQDTIRRALADELLFGKLLNGGHVTVDVDESDKVQLSFDKLANPP 761


>gi|119897423|ref|YP_932636.1| ATP-dependent Clp protease ATP-binding subunit clpA [Azoarcus sp.
           BH72]
 gi|119669836|emb|CAL93749.1| probable ATP-dependent Clp protease, ATP-binding subunit clpA
           [Azoarcus sp. BH72]
          Length = 760

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/766 (52%), Positives = 550/766 (71%), Gaps = 13/766 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLLAL+D+  AA V+ +C  +L  L+  L N
Sbjct: 1   MIAQELEVSLHMAFVEARQKRHEFITVEHLLLALLDNPSAAEVLRACAANLDELRRELTN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I N+ + K++    ++ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  FI-NEHTPKVEGSEEIDTQPTLGFQRVIQRAILHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQ Q ++  D VNFISHGI+K  +                 + E             
Sbjct: 120 VYFLQRQNISRLDVVNFISHGIAKTPQQGGGTQGRGAGEQGEQGEQEAEEKQSAG----- 174

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL  Y  +L ++   GK+D L+GR +E+ R IQ LCRR KNNPL VG+ GVGKTAIA
Sbjct: 175 ---ALENYTQNLNQQALVGKIDPLIGREKEVERVIQTLCRRRKNNPLLVGEAGVGKTAIA 231

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VP+IL  A++++LDMG L+AGT+YRGDFE+R+K ++K++    +AIL+I
Sbjct: 232 EGLARRIVEGRVPEILENAQVYALDMGALLAGTKYRGDFEQRLKAVLKQLVENQDAILFI 291

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TTY+EYRQ FEKD AL RRFQK+
Sbjct: 292 DEIHTLIGAGAASGGTLDASNLLKPALSSGQLKCIGATTYNEYRQIFEKDHALSRRFQKV 351

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPS+ + +EI+KG+K  FEEHH ++YS  A+ +A +LS ++   R LPDKAIDVIDE
Sbjct: 352 DVTEPSVSETVEILKGLKSRFEEHHGVKYSASALSSAAELSAKYINDRHLPDKAIDVIDE 411

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P SK++K I + +I++ +A + R I   + S DD + L  LE++L  VV+GQ
Sbjct: 412 AGAAQRILPKSKQKKTIGKNEIEEIVAKIAR-IPPRTVSNDDKAALKTLERDLKNVVFGQ 470

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ +IK++R+GL +P KPIG ++FSGPTGVGKTE+++QLA+ LG++L+RFDMSE
Sbjct: 471 NAAIEALAKAIKMSRSGLGNPAKPIGSFLFSGPTGVGKTEVARQLAYTLGIELVRFDMSE 530

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG+L + + + P+ V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 531 YMERHAVSRLIGAPPGYVGFDQGGLLTEQITKKPHCVLLLDEIEKAHPDIYNILLQVMDH 590

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G++  FRNVI+IMTTNAGA  M K+ IGF + R    +   ++   SPEF NR
Sbjct: 591 GTLTDNNGRQADFRNVIMIMTTNAGAETMQKSVIGFSAKREAGDEMSEIKRMFSPEFRNR 650

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+ I F  L S+II +VV KF+M+LE QL EK +  HFS+E+  WL   G+D  MGARP
Sbjct: 651 LDATISFKALDSEIILRVVDKFLMQLEAQLHEKKVEAHFSDELKAWLAERGFDPLMGARP 710

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           + R+I++ ++  LADE+LFG+L  GG   KV+++ D      + F+
Sbjct: 711 MARLIQDTIRSALADELLFGRLANGG---KVTIDIDDEQKVKLTFD 753


>gi|167585700|ref|ZP_02378088.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           ubonensis Bu]
          Length = 766

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/771 (52%), Positives = 556/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           N   ++  SD      D  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAK----------TNSGEAAKASDANAESEDANAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ IA + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIIAKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKMDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMADIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDAIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDESDKVQLSFDKLANPP 755


>gi|116690538|ref|YP_836161.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           cenocepacia HI2424]
 gi|170733879|ref|YP_001765826.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           cenocepacia MC0-3]
 gi|116648627|gb|ABK09268.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           cenocepacia HI2424]
 gi|169817121|gb|ACA91704.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           cenocepacia MC0-3]
          Length = 766

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/771 (52%), Positives = 559/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K     N ++  + D ++   D      + Q +T 
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTN---NGEAAKSTDANAESEDA-----NAQKET- 170

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 171 -----PLAQFTQNLNQMAKDGRIDPLIGREPEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKMDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMTDIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDSII F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDSIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLLNGGHVTVDVDESDKVQLSFDKLANPP 755


>gi|134296691|ref|YP_001120426.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           vietnamiensis G4]
 gi|134139848|gb|ABO55591.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           vietnamiensis G4]
          Length = 766

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/771 (52%), Positives = 557/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           N   ++  +DG     D  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAK----------TNGGEAAKSTDGNAESEDANAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGREPEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DVSEP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVSEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKMDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMNDIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDAIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVAGGHVTVDVDENDKVQLSFDKLANPP 755


>gi|107023456|ref|YP_621783.1| ATP-dependent Clp protease ATP-binding subunit clpA [Burkholderia
           cenocepacia AU 1054]
 gi|105893645|gb|ABF76810.1| ATP-dependent Clp protease ATP-binding subunit clpA [Burkholderia
           cenocepacia AU 1054]
          Length = 766

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/771 (52%), Positives = 559/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K     N ++  + D ++   D      + Q +T 
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTN---NGEAAKSTDANAESEDA-----NAQKET- 170

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 171 -----PLAQFTQNLNQMAKDGRIDPLIGREPEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKMDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRREAGDEMTDIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDSII F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDSIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLLNGGHVTVDVDESDKVQLSFDKLANPP 755


>gi|221067304|ref|ZP_03543409.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Comamonas
           testosteroni KF-1]
 gi|220712327|gb|EED67695.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Comamonas
           testosteroni KF-1]
          Length = 774

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/750 (52%), Positives = 549/750 (73%), Gaps = 19/750 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLLAL+D+  AA V+ +C  ++  L+++L N
Sbjct: 1   MIAQELEVSLHMAFVEARQQRHEFITVEHLLLALLDNPSAAEVLRACAANIDDLRSSLSN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGI--VTGANILVALFSEPDS 120
           +I  D++ ++     V+ +PT  FQRV+QRA++HVQSTG G   VTGAN+LVA+F E DS
Sbjct: 61  FI-KDNTPQVDGTEEVDTQPTLGFQRVIQRAIMHVQSTGNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRK--EFANFQSKLNVDGSSAGSDGEGFVNDYQAK 178
           HA Y+L +Q +T  D VN+I+HGI K +  E A  +S    +  +AG   E         
Sbjct: 120 HAVYYLHQQGVTRLDVVNYIAHGIKKGEPPEPAKAESPSESEEGAAGERNEKA------- 172

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                   L  + ++L +  K+GK+D L+GR  E+ RTIQILCRR KNNPL VG+ GVGK
Sbjct: 173 ------SPLEQFTLNLNQAAKEGKIDPLIGREYEVERTIQILCRRRKNNPLLVGEAGVGK 226

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A +I +G VPD+L    ++SLDMG L+AGT+YRGDFE+R+K ++K ++   +A
Sbjct: 227 TAIAEGLAWRITEGTVPDVLKEGVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDKPHA 286

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHTL+GAG+ASG ++DASNLLKPALSSG +RCIG+TT++EYR  FEKD AL RR
Sbjct: 287 ILFIDEIHTLIGAGAASGGTLDASNLLKPALSSGQLRCIGATTFTEYRGIFEKDAALSRR 346

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQK+DV EP++ + ++I+KG+K  FEEHH + Y ++A++AA +LS ++   R LPDKAID
Sbjct: 347 FQKVDVVEPTVAETVDILKGLKSRFEEHHSITYEQDALQAAAELSAKYINDRHLPDKAID 406

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDEAGA+Q + P ++R++ I + +I+  +A + R I   + S DD S L  LE++L +V
Sbjct: 407 VIDEAGAAQRIAPEAQRKQTIGKAEIEAIVAKIAR-IPPANVSNDDRSKLQTLERDLKSV 465

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ++A++ LSS++K+AR+GL  P+KPIG ++FSGPTGVGKTE +KQLA+ LGV L+RF
Sbjct: 466 VFGQDKALEVLSSAVKMARSGLGKPDKPIGSFLFSGPTGVGKTEAAKQLAYILGVDLIRF 525

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+SV+LLDEIEK+HPD+ N+LLQ
Sbjct: 526 DMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHSVLLLDEIEKAHPDIFNVLLQ 585

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +G+K  FRNVI+IMTTNAGA  M+KA IGF + R    +   ++   +PE
Sbjct: 586 VMDHGTLTDNNGRKADFRNVIIIMTTNAGAETMNKATIGFTNPREAGDEMGDIKRLFTPE 645

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+I+ F PL   II +VV KF+++LE QL EK +   FS+++   L + G+D  M
Sbjct: 646 FRNRLDAIVSFKPLDEQIILRVVDKFLLQLEQQLAEKKVDVTFSDDLRKHLATKGFDPLM 705

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGG 748
           GARP++R+I++ ++  LADE+LFG+L  GG
Sbjct: 706 GARPMQRLIQDTIRRSLADELLFGRLTNGG 735


>gi|119503236|ref|ZP_01625320.1| hypothetical protein MGP2080_11248 [marine gamma proteobacterium
           HTCC2080]
 gi|119460882|gb|EAW41973.1| hypothetical protein MGP2080_11248 [marine gamma proteobacterium
           HTCC2080]
          Length = 758

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/758 (54%), Positives = 535/758 (70%), Gaps = 16/758 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE VL+ A   A  R HE+ T+EHLLLAL++D+ +  VM +C+VD+  L+ +L+ 
Sbjct: 1   MLSKELETVLNDAFRTARSRRHEFITVEHLLLALLEDAASLTVMTACSVDIDALRGDLVE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID+ +          + +PT  FQRV+QRAV HVQS+G+  VTGANILVA+FSE +S A
Sbjct: 61  FIDSTTPLLGDEEDGRDTQPTLGFQRVLQRAVFHVQSSGKSEVTGANILVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL+ Q ++  D VNFI+HGI+K  E            S  G   EG   + +      
Sbjct: 121 VYFLKSQNVSRLDVVNFITHGIAKDDE------------SEEGPRSEGEFGEEEPAEASE 168

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L  Y  DL E+ K G++D L+GR  E+ R  QIL RR KNNPL VG+ GVGKTAIA
Sbjct: 169 A--PLDTYATDLNEEAKSGQIDPLIGRLAEVERVAQILARRRKNNPLLVGESGVGKTAIA 226

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK IVDG VP+ L GA ++SLD+G L+AGT+YRGDFE+R K ++  ++   NAIL+I
Sbjct: 227 EGLAKMIVDGNVPETLQGAVVYSLDLGALLAGTKYRGDFEKRFKGLLANLKERDNAILFI 286

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DASNLLKP LSSG +RCIGSTTY+EYR  F+KDKAL RRFQKI
Sbjct: 287 DEIHTIIGAGAASGGVMDASNLLKPLLSSGKMRCIGSTTYAEYRGIFDKDKALSRRFQKI 346

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPS++DA +I+KG+K  FE+HH LRYS  A+R A +++ R+ T R LPDKAIDVIDE
Sbjct: 347 DVLEPSVDDAYKILKGLKSRFEDHHGLRYSDRALRVATEMAARYITDRFLPDKAIDVIDE 406

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P+SKR+K I   DI+  +A + R I   + + DD  +L  LE NL  VV+GQ
Sbjct: 407 AGAYQQLLPVSKRKKVIGAGDIESVVAKIAR-IPPKTVTSDDRDLLEKLESNLQMVVFGQ 465

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
            +A+ +L +SIK+ARAGL   +KPIG ++ +GPTGVGKTE++KQLA  LG++L RFDMSE
Sbjct: 466 SKAVTQLVASIKLARAGLRSGDKPIGSFLLAGPTGVGKTEVTKQLALQLGLELTRFDMSE 525

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L D+V ++P+SVVLLDE+EK+HP+V N+LLQ+MD+
Sbjct: 526 YMERHTVSRLIGAPPGYVGFDQGGLLTDAVTKHPHSVVLLDEVEKAHPEVFNLLLQVMDH 585

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVIL+MTTNAGA  +S+  IGF    +     EA+    +PEF NR
Sbjct: 586 GTLTDNNGRKADFRNVILVMTTNAGAENVSRRSIGFTQQDHSTDALEAINRMFTPEFRNR 645

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+IIPF PL  D+I  VV KF+ +L+ QL EK +     EE   WLV  GYD  MGARP
Sbjct: 646 LDAIIPFEPLGEDVILTVVDKFLTELQGQLDEKRVQLEVDEEARLWLVETGYDRTMGARP 705

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKS 760
           + R+I+EH+K PLAD +LFG L KGG  + V+L  D+S
Sbjct: 706 MARVIQEHIKKPLADMVLFGALSKGGTAL-VTLKDDRS 742


>gi|117621540|ref|YP_856388.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117562947|gb|ABK39895.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 750

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/756 (53%), Positives = 542/756 (71%), Gaps = 21/756 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             +++LEK L++A  LA +  HE+ T+EHLLLAL+D+S A   + SC  D+++++  +  
Sbjct: 1   MLNKDLEKTLNEAFKLARDERHEFMTVEHLLLALLDNSSAHEALSSCGADVELMRKEISA 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I   +    ++    E +PT  FQRV+QRAV HVQS+G   V+GAN+LVA+FSE +S A
Sbjct: 61  FISQTTPLIPRDDEDRETQPTLGFQRVLQRAVFHVQSSGNTEVSGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL++ E++  D VNF+SHG+ K        SK +   ++A SD     +D  A     
Sbjct: 121 AYFLKKAEISRLDVVNFLSHGVRK-------DSKPDNSSNNAESD-----DDVSA----- 163

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               + ++  +L + V +G++D L+GR +E+NRTIQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 164 --AQIESFATNLNQLVLEGRIDPLIGRDQELNRTIQVLCRRRKNNPLLVGEAGVGKTAIA 221

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +IV G VP+++ G+ I+SLDMG+L+AGT+YRGDFE+R+K ++K+IE    AIL+I
Sbjct: 222 EGLAYRIVKGDVPEVIAGSTIYSLDMGSLLAGTKYRGDFEKRLKVLLKQIERQEGAILFI 281

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DA+NL+KP LS+G +RC+GSTTY EY Q FEKD+AL RRFQKI
Sbjct: 282 DEIHTIIGAGAASGGQLDAANLIKPLLSNGLLRCVGSTTYQEYSQIFEKDRALARRFQKI 341

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EPS++D   I+ G+K  +E HH +RY+ +AIRAAV+LS ++   R LPDKAIDVIDE
Sbjct: 342 DIVEPSVDDTTRILMGLKSRYEAHHGVRYTVKAIRAAVELSAKYINDRHLPDKAIDVIDE 401

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P SKR+K I  ++I+  +A + R I   S S  D  VL NLE+NL  VV+GQ
Sbjct: 402 AGAGQRLLPASKRKKVINVQEIEAIVAKIAR-IPEKSVSSSDKEVLKNLERNLKMVVFGQ 460

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ L+ SI+++R+GL +  +P+GC++F+GPTGVGKTE+++QL  ALGV++LRFDMSE
Sbjct: 461 DKAIEVLTDSIRLSRSGLGNERRPVGCFLFAGPTGVGKTEVTQQLGKALGVEVLRFDMSE 520

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L DSV ++P+SVVLLDEIEK+HPDV N+LLQ+MD 
Sbjct: 521 YMERHTVSRLIGAPPGYVGFEQGGLLTDSVLKHPHSVVLLDEIEKAHPDVFNLLLQVMDN 580

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVIL+MTTNAG  E  +  IGF            +    SPEF NR
Sbjct: 581 GTLTDNNGRKADFRNVILVMTTNAGVQETQRKSIGFQQQDMSHDAMAVINKTFSPEFRNR 640

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD  I F  L   +I QVV KFI++L++QL  KG+S   SE V +WL   GYD  MGARP
Sbjct: 641 LDHTIWFNHLDMQVIHQVVDKFIVELQVQLDAKGVSLEVSEGVRHWLAEKGYDRAMGARP 700

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           + R+I+EH+K PLA+EILFG L  GGG VKV L  D
Sbjct: 701 MGRVIQEHLKKPLANEILFGSLVDGGG-VKVELIND 735


>gi|54293795|ref|YP_126210.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Legionella
           pneumophila str. Lens]
 gi|53753627|emb|CAH15085.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Legionella
           pneumophila str. Lens]
          Length = 755

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/749 (51%), Positives = 545/749 (72%), Gaps = 14/749 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E+ HE+ T+EHLLL+L+D+  A  V+ +C+ +++ L+ +L+ 
Sbjct: 1   MLNKELEFTLNLAFKEAKEKRHEFMTVEHLLLSLLDNPAAGNVLQACDANIEALRRDLIE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +    ++    E +PT  FQRV+QRAV HVQS G+  VTGAN+L A+FSE +S A
Sbjct: 61  FIDETTPRIPEDELDRETQPTLGFQRVLQRAVFHVQSAGKTEVTGANVLAAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL+ + +T  D +N+ISHG+SK   + N     N++ S         +++     + N
Sbjct: 121 VYFLRRENITRLDVINYISHGVSK---YQNNDMHENMNSS---------MDEDMMTPEGN 168

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
             P L +YC +L  + K+GK+D L+GRHEEI RTIQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 169 ESP-LDSYCTNLNRRAKQGKIDPLIGRHEEIQRTIQVLCRRRKNNPLLVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IVDG +PD + G  ++SLD+G L+AGT+YRGDFE+R+K ++K++     AIL+I
Sbjct: 228 EGLARRIVDGEIPDSIRGCVVYSLDLGALLAGTKYRGDFEKRLKAVLKQLGQQEGAILFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DASNL+KP L++G ++CIGSTTY EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGAASGGVMDASNLVKPLLANGELKCIGSTTYQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+SEP+I++  EI+KG+K   E HH +++S  +++AA +LS ++   R LPDKAIDV+DE
Sbjct: 348 DISEPTIDETFEILKGLKGKLEAHHGVKFSIASLKAAAELSAKYINDRFLPDKAIDVVDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L   +KR+K I+  +I+  +A + R       +RD D+ L NLE++L  +VYGQ
Sbjct: 408 AGAYQNLLTANKRKKIISVTEIESVVAKIARIPIKKVSARDKDT-LRNLERDLKLLVYGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI  L+S+IK+ R+GL +P KP+GC++F+GPTGVGKTE+++QLA  LG++LLRFDMSE
Sbjct: 467 DQAITALASAIKLGRSGLREPQKPVGCFLFAGPTGVGKTEVTRQLANVLGIELLRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME+H VSRLIGAPPGYVG+ QGG+L ++V +NP++V+LLDEIEK+HPDV N+LLQIMD+
Sbjct: 527 YMEKHTVSRLIGAPPGYVGYDQGGLLTEAVTKNPHAVLLLDEIEKAHPDVFNLLLQIMDH 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G++  FR++IL+MT+NAGA E+ +  IGF +  N +   E ++   SPEF NR
Sbjct: 587 GTLTDTNGRQADFRHIILVMTSNAGASELVRNSIGFSTQDNTNDGLEVIKKQFSPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F PL +  I  VV KFIM+L+ QL  KG++F   +    WL+ HGYD  MGARP
Sbjct: 647 LDAIINFAPLDTQTIGLVVDKFIMELDEQLSHKGVTFTVDKSAREWLMEHGYDKAMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV 751
           + R+I+E++K PLADE+LFGKL  GG V 
Sbjct: 707 MARLIQENIKKPLADELLFGKLMHGGHVT 735


>gi|167835725|ref|ZP_02462608.1| ATP-dependent Clp protease ATP-binding subunit clpA [Burkholderia
           thailandensis MSMB43]
          Length = 766

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/771 (52%), Positives = 559/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K    ++ +S    D ++ G D        Q +T 
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKT---SSSESAKPADANAEGEDAS-----TQKET- 170

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 171 -----PLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KIDVTEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R I   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRVLPKSKQKKTIGKSEIEEIISKIAR-IPPQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L+S+IK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALASAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRREVGDEMADIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDATISFRALDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK+A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDEDDKVLLSFDKTATPP 755


>gi|148360535|ref|YP_001251742.1| ATP binding protease component ClpA [Legionella pneumophila str.
           Corby]
 gi|296106399|ref|YP_003618099.1| ATP binding protease component [Legionella pneumophila 2300/99
           Alcoy]
 gi|148282308|gb|ABQ56396.1| ATP binding protease component ClpA [Legionella pneumophila str.
           Corby]
 gi|295648300|gb|ADG24147.1| ATP binding protease component [Legionella pneumophila 2300/99
           Alcoy]
 gi|307609612|emb|CBW99114.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Legionella
           pneumophila 130b]
          Length = 755

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/749 (51%), Positives = 544/749 (72%), Gaps = 14/749 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E+ HE+ T+EHLLL+L+D+  A  V+ +C+ +++ L+ +L+ 
Sbjct: 1   MLNKELEFTLNLAFKEAKEKRHEFMTVEHLLLSLLDNPAAGNVLQACDANIEALRRDLIE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +    ++    E +PT  FQRV+QRAV HVQS G+  VTGAN+L A+FSE +S A
Sbjct: 61  FIDETTPRIPEDELDRETQPTLGFQRVLQRAVFHVQSAGKTEVTGANVLAAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL+ + +T  D +N+ISHG+SK   + N     N++ S         + +     + N
Sbjct: 121 VYFLRRENITRLDVINYISHGVSK---YQNNDMHENMNSS---------MEEDMMTPEGN 168

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
             P L +YC +L  + K+GK+D L+GRHEEI RTIQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 169 ESP-LDSYCTNLNRRAKQGKIDPLIGRHEEIQRTIQVLCRRRKNNPLLVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IVDG +PD + G  ++SLD+G L+AGT+YRGDFE+R+K ++K++     AIL+I
Sbjct: 228 EGLARRIVDGEIPDSIRGCVVYSLDLGALLAGTKYRGDFEKRLKAVLKQLGQQEGAILFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DASNL+KP L++G ++CIGSTTY EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGAASGGVMDASNLVKPLLANGELKCIGSTTYQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+SEP+I++  EI+KG+K   E HH +++S  +++AA +LS ++   R LPDKAIDV+DE
Sbjct: 348 DISEPTIDETFEILKGLKGKLEAHHGVKFSIASLKAAAELSAKYINDRFLPDKAIDVVDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L   +KR+K I+  +I+  +A + R       +RD D+ L NLE++L  +VYGQ
Sbjct: 408 AGAYQNLLTANKRKKIISVTEIESVVAKIARIPIKKVSARDKDT-LRNLERDLKLLVYGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI  L+S+IK+ R+GL +P KP+GC++F+GPTGVGKTE+++QLA  LG++LLRFDMSE
Sbjct: 467 DQAITALASAIKLGRSGLREPQKPVGCFLFAGPTGVGKTEVTRQLANVLGIELLRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME+H VSRLIGAPPGYVG+ QGG+L ++V +NP++V+LLDEIEK+HPDV N+LLQIMD+
Sbjct: 527 YMEKHTVSRLIGAPPGYVGYDQGGLLTEAVTKNPHAVLLLDEIEKAHPDVFNLLLQIMDH 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G++  FR++IL+MT+NAGA E+ +  IGF +  N +   E ++   SPEF NR
Sbjct: 587 GTLTDTNGRQADFRHIILVMTSNAGASEIVRNSIGFSTQDNTNDGLEVIKKQFSPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F PL +  I  VV KFIM+L+ QL  KG++F   +    WL+ HGYD  MGARP
Sbjct: 647 LDAIINFAPLDTQTIGLVVDKFIMELDEQLSHKGVTFTVDKSAREWLMEHGYDKAMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV 751
           + R+I+E++K PLADE+LFGKL  GG V 
Sbjct: 707 MARLIQENIKKPLADELLFGKLMHGGHVT 735


>gi|292492311|ref|YP_003527750.1| ATP-dependent Clp protease ATP-binding subunit clpA [Nitrosococcus
           halophilus Nc4]
 gi|291580906|gb|ADE15363.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Nitrosococcus
           halophilus Nc4]
          Length = 753

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/749 (52%), Positives = 534/749 (71%), Gaps = 13/749 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S +LE  L+QA   A E+ HE+ T+EHLLLA++D+  AA V+ +C  +L+ LK  +  
Sbjct: 1   MLSRDLETSLNQAFKDAREKMHEFLTVEHLLLAMLDNPAAATVLRACGANLEQLKEEITV 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++ N+++  L      + +PT  FQRV+QRAVL VQS+G+  VTGAN+LVA++ E  S A
Sbjct: 61  FL-NETTPLLSTKDGRDTQPTLGFQRVLQRAVLQVQSSGQKEVTGANVLVAIYGEQQSQA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL+ Q +T  D VN+ISHGISK     +        G SAG+  E      +      
Sbjct: 120 VYFLKRQHVTRLDVVNYISHGISKVDPQGS-------SGESAGASEEAEATGVETPGQ-- 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L  Y  +L     +G++D L+GR  E+ RTIQILCRR KNNPL+VG+ GVGKTA+A
Sbjct: 171 --SPLETYATNLNRLAAQGRIDPLIGRRIELERTIQILCRRRKNNPLFVGEAGVGKTALA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G +PD+L    I+SLDMG L+AGT+YRGDFE+R+K I+ +++    AIL+I
Sbjct: 229 EGLARKIVEGDIPDVLQDCTIYSLDMGALLAGTKYRGDFEKRLKGILAQLKKEKGAILFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG  +DASNL+KP L+SG ++CIGSTTY EYR  FEKD+AL RRFQKI
Sbjct: 289 DEIHTVIGAGSASGGVMDASNLIKPVLASGELKCIGSTTYQEYRGIFEKDRALARRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EPS+E+ ++I++G+K   EEHH++R+S+ A+R A +LS R+   R LPDKAIDV+DE
Sbjct: 349 DIPEPSVEETVQILRGLKSRLEEHHKVRFSQAALRTAAELSARYINDRHLPDKAIDVLDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
            GASQ L   S+R+K I  +D++  +A M R I     S  D   L+ LE NL  V++GQ
Sbjct: 409 CGASQQLLAPSRRKKVIGVQDVQTVVAKMAR-IPPKHVSTSDKESLAKLEANLKQVIFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           +EAI+ LSS+IK++R+GL D  +P+G ++F+GPTGVGKTE+++QLA+ LG++L+RFDMSE
Sbjct: 468 DEAIEVLSSAIKMSRSGLGDTGRPVGSFLFAGPTGVGKTEVTRQLAYVLGIELIRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVG+ QGG+L ++V + P++V+LLDEIEK+HPDV N+LLQ+MD+
Sbjct: 528 YMERHTVSRLIGAPPGYVGYDQGGLLTEAVCKTPHAVLLLDEIEKAHPDVFNLLLQVMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVIL+MT+NAGA E+S+  IGF    +     E +R   SPEF NR
Sbjct: 588 GTLTDNNGRKADFRNVILVMTSNAGAQEISRTSIGFTPQDHSTDAMEVIRRTFSPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD++I F  L    I +VV KF+++LEL LQ+K ++   SE    WL  HGYD KMGARP
Sbjct: 648 LDAVIQFSALDGPSIGRVVDKFVLELELLLQDKNVTLEVSEMARAWLAEHGYDEKMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV 751
           + R+I+E +K PLADE+LFGKL  GG VV
Sbjct: 708 MARLIQEKIKRPLADELLFGKLANGGHVV 736


>gi|78067319|ref|YP_370088.1| AAA ATPase, Clp [Burkholderia sp. 383]
 gi|77968064|gb|ABB09444.1| AAA ATPase, Clp [Burkholderia sp. 383]
          Length = 766

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/771 (52%), Positives = 559/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K     N ++  + D ++   D      + Q +T 
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTN---NGEAAKSADANAESEDA-----NAQKET- 170

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 171 -----PLAQFTQNLNQMAKDGRIDPLIGREPEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGVLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKMDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMTDIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDSII F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDSIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDENDKVQLSFDKLANPP 755


>gi|54296839|ref|YP_123208.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Legionella
           pneumophila str. Paris]
 gi|53750624|emb|CAH12031.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Legionella
           pneumophila str. Paris]
          Length = 755

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/749 (51%), Positives = 544/749 (72%), Gaps = 14/749 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E+ HE+ T+EHLLL+L+D+  A  V+ +C+ +++ L+ +L+ 
Sbjct: 1   MLNKELEFTLNLAFKEAKEKRHEFMTVEHLLLSLLDNPAAGNVLQACDANIEALRRDLIE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +    ++    E +PT  FQRV+QRAV HVQS G+  VTGAN+L A+FSE +S A
Sbjct: 61  FIDETTPRIPEDELDRETQPTLGFQRVLQRAVFHVQSAGKTEVTGANVLAAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL+ + +T  D +N+ISHG+SK   + N     N++ S         + +     + N
Sbjct: 121 VYFLRRENITRLDVINYISHGVSK---YQNNDMHENMNSS---------MEEDMMTPEGN 168

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
             P L +YC +L  + K+GK+D L+GRHEEI RTIQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 169 ESP-LDSYCTNLNRRAKQGKIDPLIGRHEEIQRTIQVLCRRRKNNPLLVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IVDG +PD + G  ++SLD+G L+AGT+YRGDFE+R+K ++K++     AIL+I
Sbjct: 228 EGLARRIVDGEIPDSIRGCVVYSLDLGALLAGTKYRGDFEKRLKAVLKQLGQQEGAILFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DASNL+KP L++G ++CIGSTTY EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGAASGGVMDASNLIKPLLANGELKCIGSTTYQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+SEP+I++  EI+KG+K   E HH +++S  +++AA +LS ++   R LPDKAIDV+DE
Sbjct: 348 DISEPTIDETFEILKGLKGKLEAHHGVKFSIPSLKAAAELSAKYINDRFLPDKAIDVVDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L   +KR+K I+  +I+  +A + R       +RD D+ L NLE++L  +VYGQ
Sbjct: 408 AGAYQNLLTANKRKKIISVTEIESVVAKIARIPIKKVSARDKDT-LRNLERDLKLLVYGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI  L+S+IK+ R+GL +P KP+GC++F+GPTGVGKTE+++QLA  LG++LLRFDMSE
Sbjct: 467 DQAITALASAIKLGRSGLREPQKPVGCFLFAGPTGVGKTEVTRQLANVLGIELLRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME+H VSRLIGAPPGYVG+ QGG+L ++V +NP++V+LLDEIEK+HPDV N+LLQIMD+
Sbjct: 527 YMEKHTVSRLIGAPPGYVGYDQGGLLTEAVTKNPHAVLLLDEIEKAHPDVFNLLLQIMDH 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G++  FR++IL+MT+NAGA E+ +  IGF +  N +   E ++   SPEF NR
Sbjct: 587 GTLTDTNGRQADFRHIILVMTSNAGASEIVRNSIGFSTQDNTNDGLEVIKKQFSPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F PL +  I  VV KFIM+L+ QL  KG++F   +    WL+ HGYD  MGARP
Sbjct: 647 LDAIINFAPLDTQTIGLVVDKFIMELDEQLSHKGVTFTVDKSAREWLMEHGYDKAMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV 751
           + R+I+E++K PLADE+LFGKL  GG V 
Sbjct: 707 MARLIQENIKKPLADELLFGKLMHGGHVT 735


>gi|304311207|ref|YP_003810805.1| ATP-dependent clp protease, ATP-binding subunit [gamma
           proteobacterium HdN1]
 gi|301796940|emb|CBL45153.1| ATP-dependent clp protease, ATP-binding subunit [gamma
           proteobacterium HdN1]
          Length = 763

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/757 (52%), Positives = 541/757 (71%), Gaps = 5/757 (0%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S++LE  L+ A   A  + HEY T+EHLLLAL+D+  A+ V+ +C  ++  L+  L +
Sbjct: 1   MLSKDLEVTLNLAFRDARSKRHEYMTVEHLLLALLDNDSASGVLRACGTNIDELRTELNH 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D  +     +    E +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+FSE +S A
Sbjct: 61  FVDETTPLIPASDPDRETQPTLGFQRVLQRAVFHVQSSGKKEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL++Q +   D VN+I+HGISK  + A+    +   G  A  D    + D +   +  
Sbjct: 121 VYFLKKQSVARIDVVNYIAHGISKVSDDASRSPHVQQGGHEASQD----LQDEEQGAESP 176

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L AY  +L E+  +G++D LVGR EEI RT+QILCRR KNNPL VG+PGVGKTAIA
Sbjct: 177 GRSPLDAYASNLNEQALQGRIDPLVGRGEEITRTVQILCRRRKNNPLLVGEPGVGKTAIA 236

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVD  VPD + GA ++SLD+G L+AGT+YRGDFE+R K ++ E++   N+IL+I
Sbjct: 237 EGLAKKIVDKEVPDAIAGAVVYSLDLGALLAGTKYRGDFEKRFKALLGELKKQKNSILFI 296

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DASNLLKP L+SG ++CIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 297 DEIHTIIGAGAASGGVMDASNLLKPLLASGDIKCIGSTTFQEYRGIFEKDRALARRFQKI 356

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPSI++  EI+KG+K  FEEHH L+YS  A+RAA +LS R+   R +PDKAIDVIDE
Sbjct: 357 DVTEPSIDETYEILKGLKTRFEEHHDLKYSNRALRAAAELSARYINDRHMPDKAIDVIDE 416

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
            GA Q L   S+R+K I   DI+  +A + R I   + S DD  +L NLE++L   V+GQ
Sbjct: 417 VGAYQRLLAPSRRKKVIGVTDIEAVVAKIAR-IPPKTVSSDDKEMLRNLERDLRLAVFGQ 475

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           +EAI  LS++IK++RAGLS P+KPIG ++F+GPTGVGKTE+++QLA  +G++L+RFDMSE
Sbjct: 476 DEAIGVLSNAIKMSRAGLSHPDKPIGSFLFAGPTGVGKTEVTRQLAKTMGMELIRFDMSE 535

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L +++ ++P+ V+LLDE+EK+HPDV N+LLQ+MD+
Sbjct: 536 YMERHTVSRLIGAPPGYVGFDQGGLLTEAITKSPHCVLLLDEVEKAHPDVFNLLLQVMDH 595

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVI++MTTNAGA  ++++ IGF +  +      AL+   +PEF NR
Sbjct: 596 GTLTDNNGRKADFRNVIIVMTTNAGAETVARSSIGFTAQDHSSDGMSALKRLFTPEFRNR 655

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F  L +++I+ VV KFI +L+ QL EK +     +    W    GYD  MGARP
Sbjct: 656 LDAIIQFKALDTEVIKGVVDKFITELQAQLDEKKVMLDLDDTARLWFAQKGYDKDMGARP 715

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           + R+I+E +K PLA++ILFG+L   GG V V  + ++
Sbjct: 716 MARLIQEKLKRPLAEKILFGELADHGGTVHVKADENQ 752


>gi|90021332|ref|YP_527159.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Saccharophagus
           degradans 2-40]
 gi|89950932|gb|ABD80947.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Saccharophagus
           degradans 2-40]
          Length = 761

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/762 (52%), Positives = 548/762 (71%), Gaps = 18/762 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE  L+ A   A  + HE+ T+EHLLLAL+D+  A+ V+ +C  DL  L+  L  
Sbjct: 1   MLSKELESTLNAAFRGARTKRHEFMTVEHLLLALLDNESASSVLRACGADLAFLRQELSE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D+ +    ++    E +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+FSE +S A
Sbjct: 61  FVDSTTPLIPEDDDERETQPTLGFQRVLQRAVFHVQSSGKNEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANF-----QSKLNVDGSSAGSDGEGFVNDYQA 177
            ++L++Q +   D VNFI+HGISK    A+        + + D +S  S G+G       
Sbjct: 121 VFYLKQQSVARIDVVNFITHGISKVSGSASHGVEGGHQEQHDDEASGASVGDGQQQ---- 176

Query: 178 KTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG 237
                    L ++  +L E+   G++D LVGR  E+ R +QIL RR KNNPL VG+ GVG
Sbjct: 177 --------PLESFATNLNEQALLGRIDPLVGRDSEVERVVQILARRRKNNPLLVGESGVG 228

Query: 238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN 297
           KTAIAEG AK+IVD  VP+IL  + ++SLDMG+L+AGT+YRGDFE+R K ++ +++    
Sbjct: 229 KTAIAEGLAKKIVDEEVPEILANSVVYSLDMGSLLAGTKYRGDFEKRFKGLLADLKKREG 288

Query: 298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR 357
           AIL+IDEIHT++GAG+ASG  +DASNLLKP L+SG +RCIGSTT+ EYR  F+KD+AL R
Sbjct: 289 AILFIDEIHTIIGAGAASGGVMDASNLLKPLLTSGDLRCIGSTTFQEYRGIFDKDRALSR 348

Query: 358 RFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI 417
           RFQKIDV+EPS++D  +I+KG+K  FE+HH L+Y+  A++AA +L+ ++ + R +PDKAI
Sbjct: 349 RFQKIDVNEPSVDDTYKILKGLKTRFEKHHNLKYTDTALKAAAELAGKYISDRFMPDKAI 408

Query: 418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGT 477
           DVIDEAGA Q LQP SKR+K I  +DI++ +A + R I   S S  D S+L  LE  L  
Sbjct: 409 DVIDEAGAFQQLQPESKRKKQIGVRDIEEIVAKIAR-IPAKSVSSSDKSLLVKLEDTLRM 467

Query: 478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLR 537
            V+GQ EAI  ++S+IK++RAGL++ +KPIG ++F+GPTGVGKTE+ KQLA A+GV+L+R
Sbjct: 468 TVFGQHEAISTITSAIKLSRAGLTNHDKPIGSFLFAGPTGVGKTELCKQLATAMGVELIR 527

Query: 538 FDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL 597
           FDMSEYMERH VSRLIGAPPGYVGF QGG+L D+V ++P+ VVLLDE+EK+HPDV N+LL
Sbjct: 528 FDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVTKHPHCVVLLDELEKAHPDVFNLLL 587

Query: 598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP 657
           Q+MD+G LTD +G+   FRNV+LIMTTNAGA  MS+A +GF    +     EA++   +P
Sbjct: 588 QVMDHGSLTDNNGRAADFRNVVLIMTTNAGAEVMSRASMGFTHQDHSTDGMEAIKKAFTP 647

Query: 658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVK 717
           EF NR+D+II F PLS ++IR VV KF+M+L+ QL +K I+   ++E  +WL  +GYD K
Sbjct: 648 EFRNRMDAIIQFGPLSLEVIRTVVDKFLMELQSQLDDKKITLEVTDEARDWLAINGYDEK 707

Query: 718 MGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           MGARP+ RII+EHVK PLA+ +LFG L + GG V++++  DK
Sbjct: 708 MGARPMARIIQEHVKKPLAEMVLFGALSEKGGTVQIAVVDDK 749


>gi|53718540|ref|YP_107526.1| putative ATP-dependent Clp protease ATP-binding subunit
           [Burkholderia pseudomallei K96243]
 gi|53725848|ref|YP_103844.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei ATCC 23344]
 gi|67642116|ref|ZP_00440877.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           mallei GB8 horse 4]
 gi|121601033|ref|YP_991924.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei SAVP1]
 gi|124385410|ref|YP_001027039.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei NCTC 10229]
 gi|126440168|ref|YP_001058011.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 668]
 gi|126447985|ref|YP_001081688.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei NCTC 10247]
 gi|126452761|ref|YP_001065245.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 1106a]
 gi|167003874|ref|ZP_02269653.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei PRL-20]
 gi|167814614|ref|ZP_02446294.1| ATP-dependent Clp protease ATP-binding subunit clpA [Burkholderia
           pseudomallei 91]
 gi|217419856|ref|ZP_03451362.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 576]
 gi|226194489|ref|ZP_03790087.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei Pakistan 9]
 gi|237811162|ref|YP_002895613.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei MSHR346]
 gi|242314903|ref|ZP_04813919.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 1106b]
 gi|254181504|ref|ZP_04888101.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 1655]
 gi|254197025|ref|ZP_04903449.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei S13]
 gi|254202548|ref|ZP_04908911.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei FMH]
 gi|254207885|ref|ZP_04914235.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei JHU]
 gi|254258515|ref|ZP_04949569.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 1710a]
 gi|52208954|emb|CAH34893.1| putative ATP-dependent Clp protease ATP-binding subunit
           [Burkholderia pseudomallei K96243]
 gi|52429271|gb|AAU49864.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei ATCC 23344]
 gi|121229843|gb|ABM52361.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei SAVP1]
 gi|124293430|gb|ABN02699.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei NCTC 10229]
 gi|126219661|gb|ABN83167.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 668]
 gi|126226403|gb|ABN89943.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 1106a]
 gi|126240855|gb|ABO03948.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei NCTC 10247]
 gi|147746795|gb|EDK53872.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei FMH]
 gi|147751779|gb|EDK58846.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei JHU]
 gi|169653768|gb|EDS86461.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei S13]
 gi|184212042|gb|EDU09085.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 1655]
 gi|217397160|gb|EEC37176.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 576]
 gi|225933574|gb|EEH29563.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei Pakistan 9]
 gi|237502830|gb|ACQ95148.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei MSHR346]
 gi|238523196|gb|EEP86636.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           mallei GB8 horse 4]
 gi|242138142|gb|EES24544.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 1106b]
 gi|243060668|gb|EES42854.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei PRL-20]
 gi|254217204|gb|EET06588.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           pseudomallei 1710a]
          Length = 766

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/772 (52%), Positives = 556/772 (72%), Gaps = 27/772 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEF-ANFQSKLNVDGSSAGSDGEGFVNDYQAKT 179
           HA Y+LQ+Q +T  D VNFISHGI+K     A   +  N +G  AG+  E          
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTSSGEAAKPADANAEGEDAGAQKE---------- 169

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                  L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKT
Sbjct: 170 -----TPLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKT 224

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AI
Sbjct: 225 AIAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAI 284

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRF
Sbjct: 285 LFIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRF 344

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDV
Sbjct: 345 QKIDVTEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDV 404

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV
Sbjct: 405 IDEAGAAQRVLPKSKQKKTIGKSEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVV 463

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ+ AI  L+++IK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFD
Sbjct: 464 FGQDPAIDALAAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFD 523

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+
Sbjct: 524 MSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQV 583

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF
Sbjct: 584 MDHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMADIKRLFTPEF 643

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+ I F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MG
Sbjct: 644 RNRLDATISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMG 703

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           ARP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK+A+ P
Sbjct: 704 ARPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDENDKVLLSFDKTATPP 755


>gi|270159872|ref|ZP_06188528.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Legionella
           longbeachae D-4968]
 gi|289165374|ref|YP_003455512.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Legionella
           longbeachae NSW150]
 gi|269988211|gb|EEZ94466.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Legionella
           longbeachae D-4968]
 gi|288858547|emb|CBJ12428.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Legionella
           longbeachae NSW150]
          Length = 754

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/752 (51%), Positives = 541/752 (71%), Gaps = 21/752 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E+ HE+ T+EHLLL+L+D+  A  V+ +C+ +++ L+ +L+ 
Sbjct: 1   MLNKELEFTLNLAFKEAKEKRHEFMTVEHLLLSLLDNPSAGSVLQACDANIEALRRDLIE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +    ++    E +PT  FQRV+QRAV HVQS G+  VTGAN+L A+FSE +S A
Sbjct: 61  FIDETTPRIPEDEVDRETQPTLGFQRVLQRAVFHVQSAGKTEVTGANVLAAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKE---FANFQSKLNVDGSSAGSDGEGFVNDYQAKT 179
            YFL+ + +T  D +N+ISHG+SK +      N  S  +  G+S G++            
Sbjct: 121 VYFLRRENITRLDVINYISHGVSKYQNNDMHENMNSMEDEMGASEGNES----------- 169

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                  L +YC +L  + K+GK+D L+GRHEEI RTIQ+LCRR KNNPL VG+ GVGKT
Sbjct: 170 ------PLESYCTNLNRRAKQGKIDPLIGRHEEIQRTIQVLCRRRKNNPLLVGEAGVGKT 223

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A++IVDG +PD +    ++SLD+G L+AGT+YRGDFE+R+K ++K++     A+
Sbjct: 224 AIAEGLARRIVDGEIPDAIRDCIVYSLDLGALLAGTKYRGDFEKRLKAVLKQLGQQEGAV 283

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHT++GAG+ASG  +DASNL+KP L++G ++CIGSTTY EYR  FEKD+AL RRF
Sbjct: 284 LFIDEIHTIIGAGAASGGVMDASNLIKPLLANGELKCIGSTTYQEYRGIFEKDRALARRF 343

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKID+ EP++++  EI+KG+K   E+HH ++++  A++AA +LS ++   R LPDKAIDV
Sbjct: 344 QKIDIPEPTVDETFEILKGLKGRLEDHHGVKFTIPALKAAAELSAKYINDRFLPDKAIDV 403

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           +DEAGA Q L   SKR+K I+  +I+  +A + R       +RD D+ L NLE++L  +V
Sbjct: 404 VDEAGAYQNLLTASKRKKIISVTEIESVVAKIARIPIKKVSARDKDT-LRNLERDLKLLV 462

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           YGQ++AI  L+S+IK+ R+GL DP KP+GC++F+GPTGVGKTE+++QLA  LG++LLRFD
Sbjct: 463 YGQDQAITALASAIKLGRSGLRDPQKPVGCFLFAGPTGVGKTEVTRQLANVLGIELLRFD 522

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYME+H VSRLIGAPPGYVG+ QGG+L ++V +NP++V+LLDEIEK+HPDV N+LLQI
Sbjct: 523 MSEYMEKHTVSRLIGAPPGYVGYDQGGLLTEAVTKNPHAVLLLDEIEKAHPDVFNLLLQI 582

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G++  FR++IL+MT+NAGA EM +  IGF    N +   E ++   SPEF
Sbjct: 583 MDHGTLTDTNGRQADFRHIILVMTSNAGAGEMVRNSIGFSQQDNSNDGLEVIKKQFSPEF 642

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+II F PL +  I  VV KFIM+L+ QL  KG++F   +    WL+ HGYD  MG
Sbjct: 643 RNRLDAIINFAPLDAVTIGLVVDKFIMELDEQLSHKGVTFTVDKMAREWLIEHGYDKVMG 702

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           ARP+ R+I+E+VK PLADE+LFGKL  GG V 
Sbjct: 703 ARPMARLIQENVKKPLADELLFGKLIHGGHVT 734


>gi|76809374|ref|YP_332525.1| ATP-dependent Clp protease ATP-binding subunit clpA [Burkholderia
           pseudomallei 1710b]
 gi|76578827|gb|ABA48302.1| ATP-dependent Clp protease ATP-binding subunit clpA [Burkholderia
           pseudomallei 1710b]
          Length = 884

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/773 (52%), Positives = 557/773 (72%), Gaps = 27/773 (3%)

Query: 2   SFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLL 61
           S  ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL 
Sbjct: 118 SMIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLR 177

Query: 62  NYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPD 119
           N+I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E D
Sbjct: 178 NFI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKD 236

Query: 120 SHATYFLQEQEMTLYDAVNFISHGISKRKEF-ANFQSKLNVDGSSAGSDGEGFVNDYQAK 178
           SHA Y+LQ+Q +T  D VNFISHGI+K     A   +  N +G  AG+  E         
Sbjct: 237 SHAVYYLQQQGVTRLDVVNFISHGIAKTSSGEAAKPADANAEGEDAGAQKE--------- 287

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                   L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGK
Sbjct: 288 ------TPLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGK 341

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +A
Sbjct: 342 TAIAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHA 401

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RR
Sbjct: 402 ILFIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRR 461

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAID
Sbjct: 462 FQKIDVTEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAID 521

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +V
Sbjct: 522 VIDEAGAAQRVLPKSKQKKTIGKSEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSV 580

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ+ AI  L+++IK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RF
Sbjct: 581 VFGQDPAIDALAAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRF 640

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ
Sbjct: 641 DMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQ 700

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PE
Sbjct: 701 VMDHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMADIKRLFTPE 760

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+ I F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  M
Sbjct: 761 FRNRLDATISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLM 820

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           GARP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK+A+ P
Sbjct: 821 GARPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDENDKVLLSFDKTATPP 873


>gi|206561068|ref|YP_002231833.1| putative ATP-dependent Clp protease ATP-binding subunit
           [Burkholderia cenocepacia J2315]
 gi|198037110|emb|CAR53031.1| putative ATP-dependent Clp protease ATP-binding subunit
           [Burkholderia cenocepacia J2315]
          Length = 766

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/771 (52%), Positives = 559/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K     N ++  + D ++   D      + Q +T 
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTN---NGEAAKSTDANAESEDA-----NAQKET- 170

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 171 -----PLAQFTQNLNQMAKDGRIDPLIGREPEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKMDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRREMGDEMTDIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDAIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLLNGGHVTVDVDESDKVQLSFDKLANPP 755


>gi|171319747|ref|ZP_02908835.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           ambifaria MEX-5]
 gi|171095019|gb|EDT40042.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           ambifaria MEX-5]
          Length = 766

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/771 (52%), Positives = 556/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           N   ++  +D      D  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAK----------TNGGEAAKSTDANAESEDANAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGREPEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKMDKPIGSFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMTDIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDSII F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDSIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDESDKVQLSFDKLANPP 755


>gi|115352617|ref|YP_774456.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           ambifaria AMMD]
 gi|172061478|ref|YP_001809130.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           ambifaria MC40-6]
 gi|115282605|gb|ABI88122.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           ambifaria AMMD]
 gi|171993995|gb|ACB64914.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           ambifaria MC40-6]
          Length = 766

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/771 (52%), Positives = 556/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           N   ++  +D      D  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAK----------TNGGEAAKSTDANAESEDANAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGREPEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKMDKPIGSFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMTDIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDSII F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDSIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDENDKVQLSFDKLANPP 755


>gi|170697704|ref|ZP_02888792.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           ambifaria IOP40-10]
 gi|170137452|gb|EDT05692.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           ambifaria IOP40-10]
          Length = 766

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/771 (52%), Positives = 556/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           N   ++  +D      D  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAK----------TNGGEAAKSTDANAESEDANAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGREPEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKMDKPIGSFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMTDIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDSII F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDSIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDEDDKVQLSFDKLANPP 755


>gi|257095588|ref|YP_003169229.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257048112|gb|ACV37300.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 752

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/769 (52%), Positives = 550/769 (71%), Gaps = 23/769 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLLAL+D+  AA  + +C  +L+ L+ +L+ 
Sbjct: 1   MIAQELEVSLHMAFVEARQKRHEFITVEHLLLALLDNPSAAEALRACGANLEQLRKDLVR 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I  + +  +     ++ +PT  FQRV+QRA+LHVQS+GR  V GAN+LVA+F E DSHA
Sbjct: 61  FI-GEHTPTVSGEDEIDTQPTLGFQRVIQRAILHVQSSGRKEVNGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFV-NDYQAKTDL 181
            Y+LQ+Q +T  D VNFISHGISK            V  S+  S+ EG   +D Q+    
Sbjct: 120 VYYLQKQGVTRLDVVNFISHGISK------------VPQSAPRSEQEGEPESDQQSAAG- 166

Query: 182 NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
                L +Y ++L     +GK+D L+GR  E+ R IQ LCRR KNNPL VG+ GVGKTAI
Sbjct: 167 ----PLESYTINLNALALQGKIDPLIGRDRELERVIQTLCRRRKNNPLLVGEAGVGKTAI 222

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG A++IV+  +P+IL  A ++ LDMG+L+AGT+YRGDFE+R+K ++K++     AIL+
Sbjct: 223 AEGLARRIVECDIPEILAKANVYCLDMGSLLAGTKYRGDFEQRLKGVLKQLSENPQAILF 282

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHTL+GAGSASG ++DASNLLKPALS+G ++CIG+TTY+EYR  FEKD AL RRFQK
Sbjct: 283 IDEIHTLIGAGSASGGTLDASNLLKPALSTGQLKCIGATTYNEYRGIFEKDHALSRRFQK 342

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           IDV+EPS  +AIEI+KG+K  FE HH ++YS  A+  AV+LSVR  T R LPDKAIDVID
Sbjct: 343 IDVNEPSSAEAIEILKGLKSRFESHHGIKYSAAALTTAVELSVRFITDRHLPDKAIDVID 402

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           EAGA+Q + P S+++K I + DI++ +A + R I +T  S DD + L NL+++L  VV+G
Sbjct: 403 EAGAAQRILPKSRQKKLIGKIDIEEIVAKIAR-IPSTHVSTDDRTNLRNLDRDLKAVVFG 461

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q+ AI  L+ +IK+AR+GL +P KPIG ++FSGPTGVGKTE++KQLA+ LG +L+RFDMS
Sbjct: 462 QDVAIDALARAIKMARSGLGNPTKPIGSFLFSGPTGVGKTEVAKQLAYCLGNELIRFDMS 521

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERHAVSRLIGAPPGYVGF QGG+L ++V + PYSV+LLDEIEK+HPD+ NILLQ+MD
Sbjct: 522 EYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPYSVLLLDEIEKAHPDIYNILLQVMD 581

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
           +G LTD +G+K  FRNV++IMTTNAG   + K  +GF  SR    +   ++   +PEF N
Sbjct: 582 HGTLTDNNGRKADFRNVVIIMTTNAGQEAIQKTTMGFTPSRQAGDEMVEIKRIFTPEFRN 641

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD+ I F  L  D+I +VV KF+M+LE QL EK +   F+  +   L + G+D  +GAR
Sbjct: 642 RLDATISFRALDHDVILRVVDKFLMQLEAQLHEKKVEAVFTTALKEHLAARGFDPLLGAR 701

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIE 770
           P+ R+I++ ++  LADE+LFG+L  GG V  V LN DK+    + FE E
Sbjct: 702 PMARLIQDTIRSSLADELLFGRLANGGHVT-VDLNDDKTVR--LVFEEE 747


>gi|254178978|ref|ZP_04885632.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei ATCC 10399]
 gi|160694892|gb|EDP84900.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           mallei ATCC 10399]
          Length = 766

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/772 (52%), Positives = 555/772 (71%), Gaps = 27/772 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEF-ANFQSKLNVDGSSAGSDGEGFVNDYQAKT 179
           HA Y+LQ+Q +T  D VNFISHGI+K     A   +  N +G  AG+  E          
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTSSGEAAKPADANAEGEDAGAQKE---------- 169

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                  L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKT
Sbjct: 170 -----TPLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKT 224

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AI
Sbjct: 225 AIAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAI 284

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRF
Sbjct: 285 LFIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRF 344

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDV
Sbjct: 345 QKIDVTEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDV 404

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV
Sbjct: 405 IDEAGAAQRVLPKSKQKKTIGKSEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVV 463

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ+ AI  L+++IK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFD
Sbjct: 464 FGQDPAIDALAAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFD 523

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK HPD+ N+LLQ+
Sbjct: 524 MSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKVHPDIFNVLLQV 583

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF
Sbjct: 584 MDHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMADIKRLFTPEF 643

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+ I F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MG
Sbjct: 644 RNRLDATISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMG 703

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           ARP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK+A+ P
Sbjct: 704 ARPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDENDKVLLSFDKTATPP 755


>gi|145299396|ref|YP_001142237.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|142852168|gb|ABO90489.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 750

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/756 (53%), Positives = 542/756 (71%), Gaps = 21/756 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             +++LEK L++A  LA +  HE+ T+EHLLLAL+D+S A   + SC  D+++++  +  
Sbjct: 1   MLNKDLEKTLNEAFKLARDERHEFMTVEHLLLALLDNSSAHEALSSCGADVELMRKEISA 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I   +    ++    E +PT  FQRV+QRAV HVQS+G   V+GAN+LVA+FSE +S A
Sbjct: 61  FIGQTTPLIPRDDEDRETQPTLGFQRVLQRAVFHVQSSGNTEVSGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL++ E++  D VNF+SHG+ K        SK +   ++A SD     +D  A     
Sbjct: 121 AYFLKKAEISRLDVVNFLSHGVRK-------DSKPDNSSNNAESD-----DDVSA----- 163

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               + ++  +L + V +G++D L+GR +E++RTIQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 164 --AQIESFATNLNQLVLEGRIDPLIGRDQELSRTIQVLCRRRKNNPLLVGEAGVGKTAIA 221

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +IV G VP+++ G+ I+SLDMG+L+AGT+YRGDFE+R+K ++K+IE    AIL+I
Sbjct: 222 EGLAYRIVKGDVPEVIAGSTIYSLDMGSLLAGTKYRGDFEKRLKVLLKQIERQEGAILFI 281

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DA+NL+KP LS+G +RC+GSTTY EY Q FEKD+AL RRFQKI
Sbjct: 282 DEIHTIIGAGAASGGQLDAANLIKPLLSNGLLRCVGSTTYQEYSQIFEKDRALARRFQKI 341

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EPS++D   I+ G+K  +E HH +RY+ +AIRAAV+LS ++   R LPDKAIDVIDE
Sbjct: 342 DIVEPSVDDTTRILMGLKSRYESHHGVRYTVKAIRAAVELSAKYINDRHLPDKAIDVIDE 401

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P+SKR+K I   +I+  +A + R I   S S  D  VL NLE+NL  VV+GQ
Sbjct: 402 AGAGQRLLPVSKRKKVINVPEIEAIVAKIAR-IPEKSVSSSDKEVLKNLERNLKMVVFGQ 460

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ L+ +I+++R+GL +  +P+GC++F+GPTGVGKTE+++QL  ALGV++LRFDMSE
Sbjct: 461 DKAIEVLTDAIRLSRSGLGNERRPVGCFLFAGPTGVGKTEVTQQLGKALGVEMLRFDMSE 520

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L DSV ++P+SVVLLDEIEK+HPDV N+LLQ+MD 
Sbjct: 521 YMERHTVSRLIGAPPGYVGFEQGGLLTDSVLKHPHSVVLLDEIEKAHPDVFNLLLQVMDN 580

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVIL+MTTNAG  E  +  IGF            +    SPEF NR
Sbjct: 581 GTLTDNNGRKADFRNVILVMTTNAGVQETQRKSIGFQQQDMSHDAMAVINKTFSPEFRNR 640

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD  I F  L   +I QVV KFI++L++QL  KG+S   SE V +WL   GYD  MGARP
Sbjct: 641 LDHTIWFNHLDMQVIHQVVDKFIVELQVQLDAKGVSLEVSEGVRHWLAEKGYDRAMGARP 700

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           + R+I+EH+K PLA+EILFG L   GGVVKV L  D
Sbjct: 701 MGRVIQEHLKKPLANEILFGSLVD-GGVVKVELVND 735


>gi|293606226|ref|ZP_06688589.1| ATP-dependent Clp protease [Achromobacter piechaudii ATCC 43553]
 gi|292815373|gb|EFF74491.1| ATP-dependent Clp protease [Achromobacter piechaudii ATCC 43553]
          Length = 780

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/774 (52%), Positives = 548/774 (70%), Gaps = 28/774 (3%)

Query: 2   SFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLL 61
           S  S+ LE  LH A V A    HE+ T+EHLLL+L+D++ A  V+ +C  +L  L+ NL 
Sbjct: 10  SVISQELEVSLHMAFVEARSARHEFITVEHLLLSLLDNASAVEVLRACAANLDDLRRNLR 69

Query: 62  NYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQS--TGRGIVTGANILVALFSEPD 119
            ++ ++++  + +G  V+ +PT  FQRV+QRA++HV +  TG+  VTGAN+LVA+F E D
Sbjct: 70  QFV-SENTPVIPSGAEVDTQPTLGFQRVIQRAIMHVSAGGTGKKPVTGANVLVAIFGEKD 128

Query: 120 SHATYFLQEQEMTLYDAVNFISHGISKRK--EFANFQSKLNVDGSSAGSDGEGFVNDYQA 177
           SHA Y+LQ+Q +T  D VNF+SHGI+K+   E A  Q +   +G   G   +        
Sbjct: 129 SHAVYYLQQQGVTRLDVVNFLSHGITKQPQVESAAVQKEQQTNGEEQGESRQS------- 181

Query: 178 KTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG 237
                    L  Y  DL      G++D L+GR  E+ R IQ+LCRR KNNPL VG+ GVG
Sbjct: 182 --------PLDQYATDLNAAALAGRIDPLIGREHEVERVIQVLCRRRKNNPLLVGEAGVG 233

Query: 238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN 297
           KTAIAEG A +I  G VP+IL  A++FSLDMG L+AGT+YRGDFE+R+K ++K+I    +
Sbjct: 234 KTAIAEGLAWRITRGEVPEILQAAQVFSLDMGALLAGTKYRGDFEQRLKGVLKQIRGNPD 293

Query: 298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR 357
           AIL+IDEIHTL+GAGSASG ++DASNLLKPALSSG ++CIG+TTY+EYR  FEKD AL R
Sbjct: 294 AILFIDEIHTLIGAGSASGGTLDASNLLKPALSSGQLKCIGATTYTEYRGVFEKDHALSR 353

Query: 358 RFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI 417
           RFQKIDV EPS+E  ++I++G+K  FEEHH +RYS  A+ AA +LS R    R LPDKAI
Sbjct: 354 RFQKIDVPEPSVEQTVQILRGLKSRFEEHHSVRYSAAALSAAAELSARFINDRHLPDKAI 413

Query: 418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGT 477
           DVIDEAGA+Q L P S+++K I + DI+  ++ + R I   S S DD S L+ L+++L T
Sbjct: 414 DVIDEAGAAQRLLPRSRQKKVIGKVDIENIVSKIAR-IPPQSVSNDDRSKLATLDRDLKT 472

Query: 478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLR 537
           VV+GQ+ AI  LS++IK+AR+GL  P KPIG ++ SGPTGVGKTE+++QLAF LGV+LLR
Sbjct: 473 VVFGQDGAIDALSAAIKMARSGLGKPEKPIGAFLLSGPTGVGKTEVARQLAFTLGVELLR 532

Query: 538 FDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL 597
           FDMSEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPDV NILL
Sbjct: 533 FDMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKQPHCVLLLDEIEKAHPDVFNILL 592

Query: 598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP 657
           Q+MD+G LTD +G+K  FRNVILIMTTNAGA  +++  IGF +SR    +   +R   +P
Sbjct: 593 QVMDHGTLTDNNGRKADFRNVILIMTTNAGAETLNRPSIGFANSRMLGDEMAEIRRMFTP 652

Query: 658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVK 717
           EF NRLD+IIPF  L  ++I +VV KF+M+LE QL E+ +   F+ ++   L   G+D  
Sbjct: 653 EFRNRLDAIIPFAALDREVILRVVDKFLMQLEDQLHERRVEAVFTTKLREHLAKEGFDPL 712

Query: 718 MGARPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           MGARP++R+I++ ++  LADE+LFGKL  GG V        KV+L+ D +   P
Sbjct: 713 MGARPMQRLIQDTIRRALADELLFGKLVDGGSVTVDLDDTGKVTLDFDDNGKPP 766


>gi|186475336|ref|YP_001856806.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           phymatum STM815]
 gi|184191795|gb|ACC69760.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           phymatum STM815]
          Length = 766

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/771 (52%), Positives = 556/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           N   ++  +D     ++  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAK----------TNSSEAAKSTDANAESDEAAAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGREAEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL+ A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   NAIL
Sbjct: 226 IAEGLAWRITRGEVPDILVDAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPNAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++E+R  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEFRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KIDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L  VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKAVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS+SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALSASIKMARAGLGKTDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIYNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M K+ IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKSTIGFTTRRETGDEMADIKRMFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDATISFRSLDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L  D++++ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLMNGGRVTVDVDADDKVQLTFDENSAPP 755


>gi|313201917|ref|YP_004040575.1| ATP-dependent clp protease, ATP-binding subunit clpa [Methylovorus
           sp. MP688]
 gi|312441233|gb|ADQ85339.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylovorus
           sp. MP688]
          Length = 761

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/778 (50%), Positives = 564/778 (72%), Gaps = 21/778 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A ++ HE  T+EHLLLA+ID+  AA V+ SC  +L  L++ L++
Sbjct: 1   MIAQELEVSLHMAFMDARQKRHELITVEHLLLAMIDNPTAADVLRSCGANLDTLRSELVH 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           YI+ + +  ++    V+ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA++ E DSHA
Sbjct: 61  YIE-EHTPIVEGSDEVDTQPTLGFQRVIQRAILHVQSSGKKEVTGANVLVAIYGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            +FL +Q +T  D VNFI+HG++K  +  + +++   +  +  + G              
Sbjct: 120 VFFLHQQGITRLDVVNFIAHGVAKVTDNTSKRAETEQEAEAEAAPGS------------- 166

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL ++ ++L ++V  GK+D L+GR  EI R IQ LCRR KNNPL VG+ GVGKTAIA
Sbjct: 167 ---ALESFTLNLNQQVLAGKIDPLIGRGNEIERVIQTLCRRRKNNPLLVGEAGVGKTAIA 223

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VP++L  A I+SLDMG L+AGT+YRGDFE+R+K ++K++    +A+L+I
Sbjct: 224 EGLARRIVEGNVPEVLANAVIYSLDMGALLAGTKYRGDFEQRLKAVMKKLAEQPDAVLFI 283

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALS+G+++CIG+TTY EYR  FEKD AL RRFQK+
Sbjct: 284 DEIHTLIGAGAASGGTLDASNLLKPALSNGSLKCIGATTYQEYRGIFEKDHALSRRFQKV 343

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EP++ + +EI+KG+K  FE+HH ++Y+  A+  A +L+ ++   R LPDKAIDVIDE
Sbjct: 344 DVVEPTVAETVEILKGLKSRFEQHHSVKYTMAALSTAAELAAKYINDRHLPDKAIDVIDE 403

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P SK++K I  K+I+  IA + R I   + S DD + L  LE++L   V+GQ
Sbjct: 404 AGAAQRILPKSKQKKVIGNKEIEDIIAKVAR-IPPKNISSDDRNALKTLERDLKATVFGQ 462

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ LS++IK+AR+GL   NKPIG ++FSGPTGVGKTE+++QLA+ LG++L+RFDMSE
Sbjct: 463 DKAIEALSAAIKMARSGLGSTNKPIGSFLFSGPTGVGKTEVARQLAYTLGIELIRFDMSE 522

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG++ ++++++PY V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 523 YMERHAVSRLIGAPPGYVGFEQGGLMTEAINKHPYCVLLLDEIEKAHPDIFNILLQVMDH 582

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNV +IMTTNAGA  +SK  IGF   +    D   ++   SPEF NR
Sbjct: 583 GTLTDNNGRKADFRNVTIIMTTNAGAEAISKTGIGFTLGKTAGDDLAEIKRLFSPEFRNR 642

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+ + F PLS +II +VV KF+M+LE QL EK +   F++ +  +L   G+D  MGARP
Sbjct: 643 LDATVSFAPLSQEIIMRVVDKFLMQLEDQLHEKKVEVTFTDALKAYLGKKGFDPLMGARP 702

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           + R+I++ ++  LADE+LFG+L  GG   +V ++ D++ +  + FE  ++ ++ +LET
Sbjct: 703 MARLIQDTIRRGLADELLFGRLANGG---RVEVDIDENDAIQLHFEDGDANNSPALET 757


>gi|319787139|ref|YP_004146614.1| ATP-dependent Clp protease ATP-binding subunit clpA
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317465651|gb|ADV27383.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 760

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/748 (52%), Positives = 535/748 (71%), Gaps = 13/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLLAL+D+  A  V+ +C  D + L+ +L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLALLDNPSAQAVLRACGADAERLRTDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+  S ++L +    + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEA-SVSRLADDDGRDTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN++SHGI+K             D S  G+         +      
Sbjct: 120 VYFLTQQDVTRLDVVNYLSHGIAKLG-----------DESEPGAASPDGEGRAEGGEGEG 168

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ Y  +L +  + GK+D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 169 KADALTEYATNLNDHARAGKIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVDG VP++L  A I+SLD+G L+AGT+YRGDFE+R+K ++  +     AIL+I
Sbjct: 229 EGLAKRIVDGEVPEVLSDAVIYSLDLGALVAGTKYRGDFEKRLKGVLAAVRKIPGAILFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPAL+SG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 289 DEIHTIIGAGSASGGTMDASNLIKPALASGELRCIGSTTFQEYRGIFEKDRALARRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +A EI++G+KP +E HH + Y+ EAI+AAV LSV+H   R LPDKAIDVIDE
Sbjct: 349 DIVEPTVGEAYEILQGLKPRYEAHHGVTYADEAIQAAVDLSVKHIADRLLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P   R++ I  ++I+  +A M R I     +  D  VL +LE+NL  V++GQ
Sbjct: 409 AGARQRLLPEGSRKELIDVEEIETIVAKMAR-IPAKQVTATDKDVLQHLERNLKMVIFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI+ L+S+IK+AR+GL +P+KPIG ++F+GPTGVGKTE+++QLA  LG++L+RFDMSE
Sbjct: 468 DPAIETLASAIKLARSGLGNPDKPIGNFLFAGPTGVGKTEVTRQLALQLGIELVRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H+VSRLIGAPPGYVGF QGG+L + + + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 528 YMEPHSVSRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G+LTD +G++ +F+NV+++MTTNAGA + S+  IGF    +     E +R   SPEF NR
Sbjct: 588 GVLTDTNGREANFKNVVIVMTTNAGAAQASRRSIGFTRQDHSTDAMEVIRRSFSPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+++ F  L  D I +VV KF+++LE+QL EK ++   S     WL  HG+D  MGARP
Sbjct: 648 LDAVVQFQALGFDHILRVVDKFLIELEMQLNEKHVAMTASPNAREWLAQHGFDPLMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I++ +K PLADE+LFGKL  GG V
Sbjct: 708 MARVIQDRIKRPLADELLFGKLVNGGRV 735


>gi|253999943|ref|YP_003052006.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylovorus
           sp. SIP3-4]
 gi|253986622|gb|ACT51479.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylovorus
           sp. SIP3-4]
          Length = 761

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/778 (50%), Positives = 563/778 (72%), Gaps = 21/778 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A ++ HE  T+EHLLLA+ID+  AA V+ SC  +L  L++ L++
Sbjct: 1   MIAQELEVSLHMAFMDARQKRHELITVEHLLLAMIDNPTAADVLRSCGANLDTLRSELVH 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           YI+ + +  ++    V+ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA++ E DSHA
Sbjct: 61  YIE-EHTPIVEGSDEVDTQPTLGFQRVIQRAILHVQSSGKKEVTGANVLVAIYGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            +FL +Q +T  D VNFI+HG++K  +  + +++   +  +  + G              
Sbjct: 120 VFFLHQQGITRLDVVNFIAHGVAKVTDNTSKRAETEQEAEAEAAPGS------------- 166

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL ++ ++L ++V  GK+D L+GR  EI R IQ LCRR KNNPL VG+ GVGKTAIA
Sbjct: 167 ---ALESFTLNLNQQVLAGKIDPLIGRGNEIERVIQTLCRRRKNNPLLVGEAGVGKTAIA 223

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VP++L  A I+SLDMG L+AGT+YRGDFE+R+K ++K++    +A+L+I
Sbjct: 224 EGLARRIVEGNVPEVLANAVIYSLDMGALLAGTKYRGDFEQRLKAVMKKLAEQPDAVLFI 283

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALS+G+++CIG+TTY EYR  FEKD AL RRFQK+
Sbjct: 284 DEIHTLIGAGAASGGTLDASNLLKPALSNGSLKCIGATTYQEYRGIFEKDHALSRRFQKV 343

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EP++ + +EI+KG+K  FE+HH ++Y+  A+  A +L+ ++   R LPDKAIDVIDE
Sbjct: 344 DVVEPTVAETVEILKGLKSRFEQHHSVKYTMAALSTAAELAAKYINDRHLPDKAIDVIDE 403

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P SK++K I  K+I+  IA + R I   + S DD + L  LE++L   V+GQ
Sbjct: 404 AGAAQRILPKSKQKKVIGNKEIEDIIAKVAR-IPPKNISSDDRNALKTLERDLKATVFGQ 462

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ LS++IK+AR+GL   NKPIG ++FSGPTGVGKTE+++QLA+ LG++L+RFDMSE
Sbjct: 463 DKAIEALSAAIKMARSGLGSTNKPIGSFLFSGPTGVGKTEVARQLAYTLGIELIRFDMSE 522

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG++ ++++++PY V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 523 YMERHAVSRLIGAPPGYVGFEQGGLMTEAINKHPYCVLLLDEIEKAHPDIFNILLQVMDH 582

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNV +IMTTNAGA  +SK  IGF   +    D   ++   SPEF NR
Sbjct: 583 GTLTDNNGRKADFRNVTIIMTTNAGAEAISKTGIGFTLGKTAGDDLAEIKRLFSPEFRNR 642

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+ + F PLS +II +VV KF+M+LE QL EK +   F++ +  +L   G+D  MGARP
Sbjct: 643 LDATVSFAPLSQEIIMRVVDKFLMQLEDQLHEKKVEVTFTDALKAYLGKKGFDPLMGARP 702

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           + R+I++ ++  LADE+LFG+L  GG   +V ++ D++ +  + FE  ++ ++  LET
Sbjct: 703 MARLIQDTIRRGLADELLFGRLANGG---RVEVDIDENDAIQLHFEDGDANNSPELET 757


>gi|83720277|ref|YP_441319.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           thailandensis E264]
 gi|257140006|ref|ZP_05588268.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           thailandensis E264]
 gi|83654102|gb|ABC38165.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Burkholderia
           thailandensis E264]
          Length = 766

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/771 (52%), Positives = 558/771 (72%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K    +  ++    D ++ G D        Q +T 
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKT---SGGEAAKPADANAEGEDASA-----QKET- 170

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 171 -----PLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRVLPKSKQKKTIGKSEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKMDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRREVGDEMADIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDATISFRALDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK+A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDENDKVLLSFDKTATPP 755


>gi|319944073|ref|ZP_08018352.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Lautropia
           mirabilis ATCC 51599]
 gi|319742650|gb|EFV95058.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Lautropia
           mirabilis ATCC 51599]
          Length = 771

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/751 (52%), Positives = 543/751 (72%), Gaps = 17/751 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLL+L+D+  AA V+ +C  ++  L+ +L  
Sbjct: 1   MIAQELEVSLHMAFVEARQQRHEFITVEHLLLSLLDNPSAAEVLRACAANIDELRKSLTG 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  +++  +     ++ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-KENTPVVPGTEEIDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+L +Q +T  D VN+ISHGI+K    A  Q     +   A ++G G         D
Sbjct: 120 HAVYYLHQQGITRLDVVNYISHGIAK----AQQQQPGKDEPQEATAEGGG---------D 166

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            N   AL  Y  +L    ++G++D L+GR  E+ R IQ+L RR KNNPL VG+ GVGKTA
Sbjct: 167 ANPQGALEQYTTNLNAAAREGRIDPLIGRESELERVIQVLVRRRKNNPLLVGEAGVGKTA 226

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +IV G  P++L  A ++SLDMG L+AGT+YRGDFE+R+K ++K++ +   AIL
Sbjct: 227 IAEGLAWRIVQGDAPEVLKDATVYSLDMGALLAGTKYRGDFEQRLKTVLKQLRADRQAIL 286

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAGSASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 287 FIDEIHTLIGAGSASGGTLDASNLLKPALSSGELKCIGATTFTEYRGIFEKDHALSRRFQ 346

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP++E  ++I++G+K YFEEHH +RY+  A+ AA +LS ++ T R LPDKAIDVI
Sbjct: 347 KIDVVEPTVEQTVQILRGLKSYFEEHHGIRYTGAALTAAAELSAKYITDRHLPDKAIDVI 406

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P  K ++ I + DI+  ++ + R I  TS S DD S L  LE++L  VV+
Sbjct: 407 DEAGAAQRVLPRDKAKEVIGKADIEAIVSKIAR-IPPTSVSSDDRSKLQYLERDLKNVVF 465

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ +I+ L+++IK+AR+GL+ P KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 466 GQDSSIEALAAAIKMARSGLARPEKPIGSFLFSGPTGVGKTEVARQLAFTLGIELVRFDM 525

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P++V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 526 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKKPHAVLLLDEIEKAHPDIFNILLQVM 585

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNV+LIMTTNAGA ++ +  IGF  +R    +   ++   SPEF 
Sbjct: 586 DHGTLTDNNGRKADFRNVVLIMTTNAGAADLQRRSIGFSDTREPGDEMAEIKRLFSPEFR 645

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F PL  +II +VV KF+M+LE  L EK +   F++    +L   G+D  MGA
Sbjct: 646 NRLDAIISFRPLDEEIILRVVDKFLMQLEETLHEKRVEVIFTDAFRKYLAREGFDPLMGA 705

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           RP++R+I++ V+  LADE+LFG+L+ GG V 
Sbjct: 706 RPMQRLIQDTVRKALADELLFGRLQHGGRVT 736


>gi|217969670|ref|YP_002354904.1| ATP-dependent Clp protease ATP-binding subunit clpA [Thauera sp.
           MZ1T]
 gi|217506997|gb|ACK54008.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Thauera sp.
           MZ1T]
          Length = 757

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/766 (51%), Positives = 558/766 (72%), Gaps = 16/766 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLLAL+D+  AA V+ +C  ++  L+  L  
Sbjct: 1   MIAQELEVSLHMAFVEARQKRHEFITVEHLLLALLDNPSAAQVLKACAANIDELRRELTG 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I+ + + +++    ++ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  FIE-EHTPRIEGTDEIDTQPTLGFQRVIQRAILHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y+LQ+Q ++  D VNFISHGI+K     N             S+ E    + + K+   
Sbjct: 120 VYYLQKQNISRLDVVNFISHGIAKAPPQGN--------PPQGRSEPEQGEQEQEEKSSGG 171

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL +Y  +L ++   GK+D L+GR +E+ R IQ LCRR KNNPL VG+ GVGKTAIA
Sbjct: 172 ---ALESYTQNLNQQALVGKIDPLIGREKEVERVIQTLCRRRKNNPLLVGEAGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VP+IL  A++F+LDMG L+AGT+YRGDFE+R+K ++K++    NAIL+I
Sbjct: 229 EGLARRIVEGRVPEILENAQVFALDMGALLAGTKYRGDFEQRLKAVLKQLIENPNAILFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TTY+E+RQ FEKD AL RRFQKI
Sbjct: 289 DEIHTLIGAGAASGGTLDASNLLKPALSSGQLKCIGATTYNEFRQIFEKDHALSRRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPS+ + +EI+KG+K  FEEHH ++YS  A+ +A +LS ++   R LPDKAIDVIDE
Sbjct: 349 DVVEPSVAETVEILKGLKSRFEEHHGIKYSSSALSSAAELSAKYINDRHLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P SK++K I + +I++ +A + R I   + S DD + L  LE++L  VV+GQ
Sbjct: 409 AGAAQRILPKSKQKKTIGKNEIEEIVAKIAR-IPPRTVSNDDKAALKTLERDLKNVVFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ +IK++R+GL +P KPIG ++FSGPTGVGKTE+++QLA+ LG++L+RFDMSE
Sbjct: 468 NAAIEALAKAIKMSRSGLGNPQKPIGSFLFSGPTGVGKTEVARQLAYTLGIELVRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG+L + + + P+SV+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 528 YMERHAVSRLIGAPPGYVGFDQGGLLTEQITKKPHSVLLLDEIEKAHPDIYNILLQVMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G++  FRNVI+IMTTNAGA  M K+ IGF + R    +   ++   +PEF NR
Sbjct: 588 GTLTDNNGRQADFRNVIIIMTTNAGAEAMQKSVIGFSAKREPGDEMGDIKRLFTPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD++I F  L +++I +VV KF+M+LE QL EK +  HFS+E+  WL   G+D  MGARP
Sbjct: 648 LDAMISFKALDNEVILRVVDKFLMQLEAQLHEKKVEAHFSDELKAWLAEKGFDPLMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           + R+I++ ++  LADE+LFG+L  GG   KV+++ D+     + FE
Sbjct: 708 MARLIQDTIRSALADELLFGRLVNGG---KVTIDLDEDDKVKLVFE 750


>gi|77165886|ref|YP_344411.1| ATP-dependent Clp protease [Nitrosococcus oceani ATCC 19707]
 gi|76884200|gb|ABA58881.1| ATP-dependent Clp protease [Nitrosococcus oceani ATCC 19707]
          Length = 754

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/750 (52%), Positives = 532/750 (70%), Gaps = 15/750 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S +LE  L+ A   A ER HE+ T+EHLL A++D+  AA V+ +C  +L+ LK  +  
Sbjct: 1   MLSRDLETSLNHAFKDARERMHEFLTVEHLLFAMLDNPAAAAVLRACGANLEQLKQEITV 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++ N+++  L      + +PT  FQRV+QRAVL VQS+G+  VTGAN+LVA++ E  S A
Sbjct: 61  FL-NETTPLLSTEDGRDTQPTLGFQRVLQRAVLQVQSSGQKEVTGANVLVAIYGEQQSQA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQ-AKTDL 181
            YFL+ Q MT  D VN+ISHGISK            VD   +G D  G   + + A  + 
Sbjct: 120 VYFLKRQHMTRLDIVNYISHGISK------------VDPQGSGGDSAGAPEEAETAGAET 167

Query: 182 NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
           +    L  Y  +L     +G++D L+GR  E+ RTIQILCRR KNNPL+VG+ GVGKTA+
Sbjct: 168 SGQNPLETYATNLNRLAAQGRIDPLIGRSLELERTIQILCRRRKNNPLFVGEAGVGKTAL 227

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG A +I +G +PDIL    I+SLDMG L+AGT+YRGDFE+R+K I+ +++   +AIL+
Sbjct: 228 AEGLAWKISEGDIPDILRDCTIYSLDMGTLLAGTKYRGDFEKRLKGILSQLKKEKSAILF 287

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHT++GAGSASG  +DASNL+KPAL+SG ++CIGSTTY EYR  FEKD+AL RRFQK
Sbjct: 288 IDEIHTVIGAGSASGGVMDASNLIKPALASGELKCIGSTTYQEYRNIFEKDRALARRFQK 347

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           ID+ EPS+E+ ++I++G+KP  E HH+LR+S+ A+R A +LS R+   R LPDKAIDV+D
Sbjct: 348 IDIPEPSVEETVQILRGLKPRLEAHHKLRFSQAALRTAAELSARYINDRHLPDKAIDVLD 407

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           E GASQ L   S+R+K I  +D++  +A M R I     S  D   L+ LE NL  V++G
Sbjct: 408 ECGASQQLLTPSRRKKVIGVQDVQTVVAKMAR-IPPKHVSASDKESLAKLEANLKRVIFG 466

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q++AI+ L ++IK++R+GL D ++P+G ++FSGPTGVGKTE+++QLA  LG++L+RFDMS
Sbjct: 467 QDKAIEALGAAIKMSRSGLGDTDRPVGSFLFSGPTGVGKTEVTRQLAHILGIELIRFDMS 526

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERH VSRLIGAPPGYVG+ QGG+L +++ +NP++V+LLDEIEK+HPDV N+LLQ+MD
Sbjct: 527 EYMERHTVSRLIGAPPGYVGYDQGGLLTEAICKNPHAVLLLDEIEKAHPDVFNLLLQVMD 586

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
           +G LTD +G+K  FRNVILIMT+NAGA E+S+  IGF    +     E +R   SPEF N
Sbjct: 587 HGTLTDNNGRKADFRNVILIMTSNAGAQEISRTSIGFTLQDHSSDAMEVIRRTFSPEFRN 646

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD II F  L +  I +VV KFI +LE  LQ+K ++   SE    WL  HGYD KMGAR
Sbjct: 647 RLDDIIQFQSLDAPAISRVVDKFIFELEFLLQDKNVTLEVSETARAWLAKHGYDEKMGAR 706

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           P+ R+I+E +K PLA+E+LFGKL K G V 
Sbjct: 707 PMARLIQERIKRPLAEELLFGKLAKEGHVA 736


>gi|331004965|ref|ZP_08328375.1| ATP-dependent Clp protease ATP-binding subunit ClpA [gamma
           proteobacterium IMCC1989]
 gi|330421207|gb|EGG95463.1| ATP-dependent Clp protease ATP-binding subunit ClpA [gamma
           proteobacterium IMCC1989]
          Length = 758

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/749 (52%), Positives = 533/749 (71%), Gaps = 10/749 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE+ L+ A   A  + HE+ T+EHLLLAL+D+  A+ V+ +C  D+  L+  L+ 
Sbjct: 1   MLSKELEQTLNDAFTHARSKRHEFMTVEHLLLALLDNDSASSVLKACGSDVSSLRTELIE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D  +     +    E +PT  FQRV+QRAV HVQS+G+  V+GAN+LVALFSE +S A
Sbjct: 61  FVDTTTPLFAVSEEERETQPTLGFQRVLQRAVFHVQSSGKQEVSGANVLVALFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL+ Q +   D VN+I+HGISK  +  N      VD +    +      D  A +  N
Sbjct: 121 VYFLKVQSIARIDVVNYITHGISKVGD-NNVSQGDEVDSADTTENA-----DNAAASGTN 174

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L +Y  +L E   +GK+D L+GR  E+ R  QIL RR KNNPL VG+ GVGKTAIA
Sbjct: 175 ---PLESYATNLNELALEGKIDPLIGRDSEVERVGQILSRRRKNNPLLVGESGVGKTAIA 231

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AKQIVDG VP++L  + ++SLDMG L+AGT+YRGDFE+R+K ++ E++   ++IL+I
Sbjct: 232 EGLAKQIVDGKVPEVLENSVVYSLDMGALLAGTKYRGDFEKRLKALLAELKKREDSILFI 291

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ SG  +DASNLLKP LSSG +RCIGSTT+ EYR  F+KD+AL RRFQK+
Sbjct: 292 DEIHTIIGAGATSGGVMDASNLLKPLLSSGEMRCIGSTTFQEYRGIFDKDRALSRRFQKV 351

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPS++D  +I+KG+K  FEEHH ++Y+  A+R+A +L+ R+   R +PDKAIDVIDE
Sbjct: 352 DVNEPSVDDTYKILKGLKSRFEEHHHVKYTDTALRSAAELAGRYINDRFMPDKAIDVIDE 411

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q LQP SKR+K +   DI+  +A + R I   + S  D   L  L+ NL   V+GQ
Sbjct: 412 AGAFQQLQPASKRKKQLGVHDIENIVAKIAR-IPAKTISSSDKDQLRKLDANLKMTVFGQ 470

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           +E I  L++SIK++RAGL    KPIG ++FSGPTGVGKTE+ +QL+ A+GV+L+RFDMSE
Sbjct: 471 DEGIDALTTSIKLSRAGLGAEEKPIGSFLFSGPTGVGKTELCRQLSDAMGVELIRFDMSE 530

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L ++V +NP+ VVLLDEIEK+HP+V N+LLQ+MD+
Sbjct: 531 YMERHTVSRLIGAPPGYVGFDQGGLLTEAVTKNPHCVVLLDEIEKAHPEVFNLLLQVMDH 590

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNV+LIMTTNAGA EMS++ IGF    +    KEAL+   +PEF NR
Sbjct: 591 GTLTDNNGRKADFRNVVLIMTTNAGAEEMSRSSIGFSHQDHSSDGKEALKKMFTPEFRNR 650

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LDSII F  LS D+++ VV KF+++L+ QL EK +  + ++E   WL  +GYD KMGARP
Sbjct: 651 LDSIIQFSALSKDVVKTVVDKFLVQLQTQLDEKRVHLNVTDEARAWLAENGYDEKMGARP 710

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV 751
           + R+I+E +K PLA+ +LFG+L  GG V 
Sbjct: 711 MARLIQEKLKKPLAEMVLFGELSNGGDVT 739


>gi|312795292|ref|YP_004028214.1| ATP-dependent clp protease ATP-binding subunit clpA [Burkholderia
           rhizoxinica HKI 454]
 gi|312167067|emb|CBW74070.1| ATP-dependent clp protease ATP-binding subunit clpA [Burkholderia
           rhizoxinica HKI 454]
          Length = 772

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/790 (51%), Positives = 567/790 (71%), Gaps = 28/790 (3%)

Query: 2   SFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLL 61
           S  ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL 
Sbjct: 6   SMIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLR 65

Query: 62  NYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPD 119
           N+I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E D
Sbjct: 66  NFI-HDNTPIVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSSGKKEVTGANVLVAIFGEKD 124

Query: 120 SHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAG---SDGEGFVNDYQ 176
           SHA Y+LQ+Q +T  D VNFISHGI+K             D + AG   +DG    +D  
Sbjct: 125 SHAVYYLQQQGVTRLDVVNFISHGIAK---------TAGPDVAKAGEPPADG----DDAS 171

Query: 177 AKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGV 236
           A+ +      L+ +  +L ++ + GK+D L+GR  E+ R +Q+LCRR KNNPL VG+ GV
Sbjct: 172 AQKET----PLAQFTQNLNQQARDGKIDPLIGREPEVERMVQVLCRRRKNNPLMVGEAGV 227

Query: 237 GKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYA 296
           GKTAI EG A +IV G VPDIL  A++FSLD+G L+AGT+YRGDFE+R+K ++KE+    
Sbjct: 228 GKTAIVEGLAWRIVRGEVPDILADAQVFSLDLGALLAGTKYRGDFEQRLKTVLKELRDRP 287

Query: 297 NAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALV 356
           +AIL+IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++E+R  FEKD AL 
Sbjct: 288 HAILFIDEIHTLIGAGAASGGTLDASNLLKPALSSGQLKCIGATTFTEFRGIFEKDAALS 347

Query: 357 RRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKA 416
           RRFQKIDV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKA
Sbjct: 348 RRFQKIDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKA 407

Query: 417 IDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLG 476
           IDVIDEAGA+Q + P SK++K I + +I+  I+ + R +   S S+DD S L  L+++L 
Sbjct: 408 IDVIDEAGAAQRILPRSKQKKTIGKTEIEDIISKIAR-VPAQSVSQDDRSKLQTLDRDLK 466

Query: 477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLL 536
           +VV+GQ+ AI  L+++IK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF +G++L+
Sbjct: 467 SVVFGQDPAIDALAAAIKMARAGLGKTDKPIGAFLFSGPTGVGKTEVARQLAFTMGIELV 526

Query: 537 RFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNIL 596
           RFDMSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+L
Sbjct: 527 RFDMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVL 586

Query: 597 LQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLS 656
           LQ+MD+G LTD +G+K  FRNVI+IMTTNAGA  M+KA IGF + R    +   ++   +
Sbjct: 587 LQVMDHGTLTDNNGRKSDFRNVIIIMTTNAGAEAMNKATIGFTTRRETGDEMADIKRMFT 646

Query: 657 PEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDV 716
           PEF NRLD+II F  L  +II +VV KF+M+LE QL EK +   F++ +   L  HG+D 
Sbjct: 647 PEFRNRLDAIISFRSLDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDP 706

Query: 717 KMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNI 776
            MGARP++R+I++ ++  LADE+LFGKL  GG   +V++N D +    + F+ EN+    
Sbjct: 707 LMGARPMQRLIQDTIRRALADELLFGKLMNGG---RVTVNVDDNDKVQLTFD-ENAAPRN 762

Query: 777 SLETEEKEVE 786
               E  EVE
Sbjct: 763 PTNPETAEVE 772


>gi|161523957|ref|YP_001578969.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           multivorans ATCC 17616]
 gi|189351282|ref|YP_001946910.1| ATP-dependent Clp protease ATP-binding subunit [Burkholderia
           multivorans ATCC 17616]
 gi|221199251|ref|ZP_03572295.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           multivorans CGD2M]
 gi|221205847|ref|ZP_03578862.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           multivorans CGD2]
 gi|221211473|ref|ZP_03584452.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           multivorans CGD1]
 gi|160341386|gb|ABX14472.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           multivorans ATCC 17616]
 gi|189335304|dbj|BAG44374.1| ATP-dependent Clp protease ATP-binding subunit [Burkholderia
           multivorans ATCC 17616]
 gi|221168834|gb|EEE01302.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           multivorans CGD1]
 gi|221174685|gb|EEE07117.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           multivorans CGD2]
 gi|221180536|gb|EEE12939.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Burkholderia
           multivorans CGD2M]
          Length = 766

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/771 (52%), Positives = 555/771 (71%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           N   ++   D     +D  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAK----------TNSGEAAKSGDPSAESDDANAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGREPEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L++SIK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAASIKMARAGLGKMDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKATIGFTTRRETGDEMADIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDAIISFRALDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK  + P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVNGGRVTVDVDENDKVQLSFDKLPNPP 755


>gi|82703366|ref|YP_412932.1| ATPase with chaperone activity [Nitrosospira multiformis ATCC
           25196]
 gi|82411431|gb|ABB75540.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Nitrosospira
           multiformis ATCC 25196]
          Length = 752

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/770 (51%), Positives = 556/770 (72%), Gaps = 25/770 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V + ++ HE+ T+EHLLLAL+D+  AA V+ +C+VD+  L+  L  
Sbjct: 1   MIAQELEVSLHMAFVESRQKRHEFITVEHLLLALLDNPTAAEVLRACSVDMDDLRRLLTE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++  ++     +G  V+ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  HVTENTPTVGGSG-EVDTQPTLGFQRVIQRAILHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL ++ +T  D VN+ISHGISK  +           G++A ++ EG       + ++N
Sbjct: 120 VYFLHQKGVTRLDVVNYISHGISKVPQ-----------GTNAKTESEG-----DTEQEMN 163

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL +Y V+L  +   GK+D L+GR  E+ R IQ LCRR KNNPL VG+ GVGKTAIA
Sbjct: 164 AGGALESYAVNLNAQALAGKIDPLIGRERELERLIQTLCRRRKNNPLLVGEAGVGKTAIA 223

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++I++  VP+IL   ++++LDMG L+AGT+YRGDFE+R+K ++K++   +NAIL+I
Sbjct: 224 EGLARRIIENDVPEILAHHQVYALDMGALLAGTKYRGDFEQRLKAVLKQLLESSNAILFI 283

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKP L++G ++CIG+TTYSEYR  FEKD AL RRFQKI
Sbjct: 284 DEIHTLIGAGAASGGTLDASNLLKPILNTGQLKCIGATTYSEYRGIFEKDHALSRRFQKI 343

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPS+++ + I++G+K  +E HH ++Y+  A+  A +LS R    R LPDKAIDVIDE
Sbjct: 344 DVLEPSVDETVSILRGLKARYEAHHGVKYTATALTTAAELSARFINDRHLPDKAIDVIDE 403

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P SK+RK I+  +I+  IA + R I   + S DD + L  L+++L  VV+GQ
Sbjct: 404 AGAAQRVLPKSKQRKVISRHEIEVIIAKIAR-IPAQNISSDDRNTLKTLDRDLKAVVFGQ 462

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI  L++SIK+AR+GL +P KP+G ++FSGPTGVGKTE+++QLA+ALG+ L RFDMSE
Sbjct: 463 DKAINALTASIKMARSGLGNPQKPVGSFLFSGPTGVGKTEVARQLAYALGIHLHRFDMSE 522

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG+L +++ + PYSV+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 523 YMERHAVSRLIGAPPGYVGFDQGGLLTEAIIKQPYSVLLLDEIEKAHPDIFNILLQVMDH 582

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNV++IMTTNAGA  +SKA +GF  +     +   ++   +PEF NR
Sbjct: 583 GTLTDNNGRKADFRNVVIIMTTNAGAEALSKATMGFTKAAQAGDEMADIKRMFTPEFRNR 642

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F PL  ++I +VV KF+M+LE QLQEK +   F++ +  +L ++G D  MGARP
Sbjct: 643 LDAIISFAPLEREVILRVVDKFLMQLEAQLQEKKVDAIFTDALREYLANNGVDPLMGARP 702

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSPI 765
           + R+I++ ++  LADE+LFG+L  GG V        KV L  ++ A++ I
Sbjct: 703 MARLIQDTIRSALADELLFGRLANGGRVTVDIDTDNKVKLQFEEEAATAI 752


>gi|329894887|ref|ZP_08270686.1| ATP-dependent Clp protease ATP-binding subunit ClpA [gamma
           proteobacterium IMCC3088]
 gi|328922616|gb|EGG29951.1| ATP-dependent Clp protease ATP-binding subunit ClpA [gamma
           proteobacterium IMCC3088]
          Length = 764

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/778 (51%), Positives = 547/778 (70%), Gaps = 27/778 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L++A   A  + HEY T+EHLLLA++D+ DAA+V+  C  D + L+ +L+ 
Sbjct: 1   MLNKALELSLNEAFRSAQSKQHEYLTVEHLLLAMLDNPDAALVLKHCGADSEALRADLVE 60

Query: 63  YIDNDS---SNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPD 119
           +ID+ +    +   + F  +  PT  FQRV+QRAV HVQS+G+  V+GANILVA+FSE +
Sbjct: 61  FIDSTTPLMEDSASDQF--DTHPTLGFQRVIQRAVFHVQSSGKDEVSGANILVAIFSEQE 118

Query: 120 SHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKT 179
           S A Y+L+ Q ++  D VN+I+HG+SK ++  N + ++N   +S  S+  G  N      
Sbjct: 119 SQAVYYLKTQNISRLDVVNYITHGVSKIED--NAEPEINQTNTSDSSEESGEGN------ 170

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                  L+ +  +L  K  +G +D L+GR +E+ R  Q+L RR KNNPL VG+ GVGKT
Sbjct: 171 ------PLTNFATNLNVKAGEGDIDPLIGRADEVERLAQVLARRRKNNPLLVGESGVGKT 224

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AI EG AK I DG  P++L  + ++SLDMG L+AGT+YRGDFE+R K ++KE+  +  AI
Sbjct: 225 AIVEGLAKLIHDGDAPEMLAQSTVYSLDMGALLAGTKYRGDFEKRFKGLLKELSKHEGAI 284

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHT++GAG+ASG  +DASNLLKP L+SG +RC+GSTTY+EYR  F+KDKAL RRF
Sbjct: 285 LFIDEIHTIIGAGAASGGVMDASNLLKPLLTSGKLRCVGSTTYAEYRGIFDKDKALSRRF 344

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV+EPS +DA +I+KG+K  FEEHH++RY+ +A+R A  L+ R+ T R LPDKAIDV
Sbjct: 345 QKIDVTEPSPDDAYKILKGLKSRFEEHHKVRYTDKALRVATDLAARYITDRFLPDKAIDV 404

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA Q L P SKR+K I   DI+  +A + R I   S SRDD S L  LE NL  VV
Sbjct: 405 IDEAGAYQQLLPKSKRKKQIGVSDIEAIVAKIAR-IPPKSVSRDDKSTLEKLESNLKMVV 463

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ++A+ +LSS+IK+ARAGL   +KPIG ++ +GPTGVGKTE+++QLA  LG++L+RFD
Sbjct: 464 FGQDKAVSELSSAIKLARAGLKSEHKPIGSFLLAGPTGVGKTEVTRQLATMLGLELIRFD 523

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERH VSRLIGAPPGYVGF QGG+L D+V ++P++VVLLDEIEK+HP+V N+LLQ+
Sbjct: 524 MSEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVTKHPHAVVLLDEIEKAHPEVFNLLLQV 583

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G+K  FRNVIL+MTTNAGA  +S+  IGF    +     EA+    +PEF
Sbjct: 584 MDHGSLTDNNGRKADFRNVILVMTTNAGAERISRRSIGFTQQDHRTDGMEAINRLFTPEF 643

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLDSI+ F PL  D+I  VV KF+ +L+ QL +K +     E+   WLV  GYD+ MG
Sbjct: 644 RNRLDSIVEFEPLGEDVILTVVDKFLTELQGQLDDKRVQLQVDEDARLWLVEKGYDMHMG 703

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVVKV-------SLNPDKSASSPIFFEIE 770
           ARP+ R+I+E++K PLA+ +LFG L   GG V V       +L  D  +S P   E+E
Sbjct: 704 ARPMARVIQEYIKKPLAELVLFGSLSAAGGTVHVRVSDTGDTLTLDVESSQPQEQELE 761


>gi|163856971|ref|YP_001631269.1| ATP-dependent Clp protease ATP-binding [Bordetella petrii DSM
           12804]
 gi|163260699|emb|CAP43001.1| ATP-dependent clp protease ATP-binding [Bordetella petrii]
          Length = 775

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/772 (52%), Positives = 556/772 (72%), Gaps = 25/772 (3%)

Query: 2   SFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLL 61
           S  S+ LE  LH A V A    HE+ T+EHLLL+L+D++ A  V+ +C  +L  L+ NL 
Sbjct: 6   SVISQELEVSLHMAFVEARSARHEFITVEHLLLSLLDNASAVEVLRACAANLDDLRRNLR 65

Query: 62  NYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQS--TGRGIVTGANILVALFSEPD 119
            ++ ++++  +  G  V+ +PT  FQRV+QRA++HV +  TG+  VTGAN+LVA+F E D
Sbjct: 66  QFV-SENTPVIPTGAEVDTQPTLGFQRVIQRAIMHVSAGGTGKKPVTGANVLVAIFGEKD 124

Query: 120 SHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKT 179
           SHA Y+LQ+Q +T  D VNF+SHGI+K+ +          + ++A  +  G     +++ 
Sbjct: 125 SHAVYYLQQQGVTRLDVVNFLSHGITKQPQ---------EESAAAPKEQPGLEEPSESRQ 175

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                  L  Y  DL      G++D L+GR  E+ R IQ+LCRR KNNPL VG+ GVGKT
Sbjct: 176 S-----PLDQYANDLNAAALAGRIDPLIGREHEVERVIQVLCRRRKNNPLLVGEAGVGKT 230

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A +I  G VP+IL GA +++LDMG L+AGT+YRGDFE+R+K ++K+I    +AI
Sbjct: 231 AIAEGLAWRITRGEVPEILQGAHVYALDMGALLAGTKYRGDFEQRLKGVLKQIRGNPDAI 290

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHTL+GAGSASG ++DASNLLKPALSSG ++CIG+TTY+E+R  FEKD AL RRF
Sbjct: 291 LFIDEIHTLIGAGSASGGTLDASNLLKPALSSGQLKCIGATTYTEFRGVFEKDHALSRRF 350

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDVSEPS+E  ++I++G+K  FEEHH +RYS  A+ AA +LS R+   R LPDKAIDV
Sbjct: 351 QKIDVSEPSVEQTVQILRGLKSRFEEHHNVRYSAAALSAAAELSARYINDRHLPDKAIDV 410

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA+Q L P S+++K I + DI+  ++ + R I   S S DD S L+ L+++L TVV
Sbjct: 411 IDEAGAAQRLLPRSRQKKLIGKIDIENIVSKIAR-IPPQSVSNDDRSKLATLDRDLKTVV 469

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ+ AI+ LS++IK+AR+GL  P++PIG ++FSGPTGVGKTE+++QLAF +GV+LLRFD
Sbjct: 470 FGQDTAIEALSAAIKMARSGLGKPDRPIGSFLFSGPTGVGKTEVARQLAFIMGVELLRFD 529

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPDV NILLQ+
Sbjct: 530 MSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKQPHCVLLLDEIEKAHPDVFNILLQV 589

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G+K  FRNVI+IMTTNAGA  +++  IGF +SR    +   +R   +PEF
Sbjct: 590 MDHGTLTDNNGRKADFRNVIIIMTTNAGAETLNRPAIGFSNSRVVGDEMAEIRRMFTPEF 649

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+IIPF PLS +II +VV KF+M+LE QL E+ +   F++ +   L   G+D  MG
Sbjct: 650 RNRLDAIIPFAPLSREIILRVVDKFLMQLEDQLHERRVEAVFTDGLREHLAKEGFDPLMG 709

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           ARP++R+I++ ++  LADE+LFGKL  GG V        KV L+ D +  SP
Sbjct: 710 ARPMQRLIQDTIRRALADELLFGKLADGGTVTVDLDEAGKVRLSFDGAGKSP 761


>gi|58582176|ref|YP_201192.1| ATP-dependent Clp protease subunit [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58426770|gb|AAW75807.1| ATP-dependent Clp protease subunit [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 760

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/748 (52%), Positives = 535/748 (71%), Gaps = 14/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLL+L+D+  A  V+ +C  D   L  +L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLSLLDNPSAQAVLKACGADQVRLHTDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN+ISHGI+K          L  DG    +      +  +      
Sbjct: 120 VYFLNQQDITRLDIVNYISHGIAK----------LGEDGEQPSA--PDGESKGEGGEGEV 167

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ +  +L E+ + G++D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 168 KGDALAEFATNLNEQARNGRIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IVD  VP++L  A IFSLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 228 EGLARRIVDNDVPEVLADAVIFSLDLGALVAGTKYRGDFEKRLKSVLAALKKVPNAVLFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPALSSG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGTMDASNLIKPALSSGELRCIGSTTFQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+KP +E HH + Y+ +A++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 348 DIVEPTVGETFEILQGLKPKYEAHHGVTYADDALQAAVDLSVKHIGDRLLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P   R++ I  ++I+  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 408 AGARQRLLPEGMRKELIDIEEIETIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ SIK+AR+GL++P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 NLAIETLAGSIKLARSGLANPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 527 YMEAHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           GILTD +G++ +F+NVIL+MTTNAGA + S+  IGF    +     E++R   +PEF NR
Sbjct: 587 GILTDTNGREANFKNVILVMTTNAGATQASRRSIGFTKQDHSTDAMESIRRGFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F PL  D I +VV KFI++LE+ LQEK +S   +    +WL  HG+D  MGARP
Sbjct: 647 LDAIVQFQPLGFDHILRVVDKFIIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I+E +K PLADE+LFGKL  GG V
Sbjct: 707 MSRVIQEKIKRPLADELLFGKLVDGGRV 734


>gi|84624069|ref|YP_451441.1| ATP-dependent Clp protease subunit [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|84368009|dbj|BAE69167.1| ATP-dependent Clp protease subunit [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 760

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/748 (52%), Positives = 535/748 (71%), Gaps = 14/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLL+L+D+  A  V+ +C  D   L  +L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLSLLDNPSAQAVLKACGADQVRLHTDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN+ISHGI+K          L  DG    +      +  +      
Sbjct: 120 VYFLNQQDITRLDIVNYISHGIAK----------LGEDGEQPSA--PDGESKGEGGEGEV 167

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ +  +L E+ + G++D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 168 KGDALAEFAANLNEQARNGRIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IVD  VP++L  A IFSLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 228 EGLARRIVDNDVPEVLADAVIFSLDLGALVAGTKYRGDFEKRLKSVLAALKKVPNAVLFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPALSSG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGTMDASNLIKPALSSGELRCIGSTTFQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+KP +E HH + Y+ +A++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 348 DIVEPTVGETFEILQGLKPKYEAHHGVTYADDALQAAVDLSVKHIGDRLLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P   R++ I  ++I+  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 408 AGARQRLLPEGMRKELIDIEEIETIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ SIK+AR+GL++P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 NLAIETLAGSIKLARSGLANPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 527 YMEAHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           GILTD +G++ +F+NVIL+MTTNAGA + S+  IGF    +     E++R   +PEF NR
Sbjct: 587 GILTDTNGREANFKNVILVMTTNAGATQASRRSIGFTKQDHSTDAMESIRRGFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F PL  D I +VV KFI++LE+ LQEK +S   +    +WL  HG+D  MGARP
Sbjct: 647 LDAIVQFQPLGFDHILRVVDKFIIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I+E +K PLADE+LFGKL  GG V
Sbjct: 707 MSRVIQEKIKRPLADELLFGKLVDGGRV 734


>gi|94311824|ref|YP_585034.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Cupriavidus
           metallidurans CH34]
 gi|93355676|gb|ABF09765.1| ATPase and specificity subunit of ClpA-ClpP ATP-dependent serine
           protease, chaperone activity [Cupriavidus metallidurans
           CH34]
          Length = 765

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/758 (53%), Positives = 552/758 (72%), Gaps = 21/758 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ +L N
Sbjct: 1   MIAQELEVSLHMAFVEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRTSLKN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-ADNTPVVPGTDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI  RK+ A  +   + DG++ G  G+G  +       
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGI--RKDQA--EPAKHGDGNAEGEGGDGKES------- 168

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L  Y  +L    K GK+D L+GR  E+ R +Q+LCRR KNNPL  G+ GVGKTA
Sbjct: 169 -----PLEQYTQNLNTLAKAGKIDPLIGRESEVERVVQVLCRRRKNNPLLTGEAGVGKTA 223

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A ++SLDMG L+AGT+YRGDFE+R+K ++K ++   NAIL
Sbjct: 224 IAEGLAWRITKGEVPDILEKAVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDNPNAIL 283

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 284 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGQLKCIGATTFTEYRGIFEKDAALSRRFQ 343

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EPS++  ++I++G+K  FEEHH ++Y+  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 344 KIDVVEPSVDQTVQILRGLKSRFEEHHGVKYAASALTAAAELSARFITDRHLPDKAIDVI 403

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I+  ++ + R I   S ++DD S L  LE++L +VV+
Sbjct: 404 DEAGAAQRILPKSKQKKTIGKAEIEDIVSRIAR-IPPQSVNQDDRSKLQTLERDLKSVVF 462

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L+S+IK++RAGL   +KPIG ++FSGPTGVGKTE++KQLAF +G++LLRFDM
Sbjct: 463 GQDPAIEALASAIKMSRAGLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFIMGIELLRFDM 522

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 523 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNILLQVM 582

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G++  FRNVI+IMTTNAGA  M++A IGF ++R    +   ++   +PEF 
Sbjct: 583 DHGSLTDNNGRRADFRNVIIIMTTNAGAETMNRATIGFTTAREQGDEMADIKRMFTPEFR 642

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F  L  +II +VV KF+M+LE QL EK +   FSE++  +L   G+D  MGA
Sbjct: 643 NRLDAMISFRSLDEEIILRVVDKFLMQLEEQLHEKKVDASFSEKLRKYLAKKGFDPLMGA 702

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           RP++R+I++ ++  LADE+LFGKL  GG V  V L+ D
Sbjct: 703 RPMQRLIQDMIRKALADELLFGKLVSGGKVA-VDLDDD 739


>gi|289208441|ref|YP_003460507.1| ATP-dependent Clp protease ATP-binding subunit clpA
           [Thioalkalivibrio sp. K90mix]
 gi|288944072|gb|ADC71771.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Thioalkalivibrio sp. K90mix]
          Length = 755

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/749 (52%), Positives = 532/749 (71%), Gaps = 12/749 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
              + LE  L+     A E+ HE+ T+EHLL+AL  +  AA V+ +C  DL  +++ L  
Sbjct: 1   MLDKELEFSLNMVFKEAREKRHEFVTVEHLLMALAQNPSAATVLRACGGDLDRIRDELEV 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           YID ++     N  R E +PT  FQRV+QRAV HVQS+GR  V+GAN+LVALF E DS A
Sbjct: 61  YIDENTPRIPPNDSR-ETQPTLGFQRVLQRAVFHVQSSGRKEVSGANVLVALFGEQDSQA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L +Q ++  D VNFISHGISK  E      +L    +      E    + + KT+  
Sbjct: 120 LYVLGQQNISRLDVVNFISHGISKVGE-----DELGGQQNPNDPQPEPVEGEREEKTN-- 172

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL  Y  +L EK +K ++D L+GR  EI RTIQILCRR KNNPL VG+ GVGKTAIA
Sbjct: 173 ---ALHLYATNLNEKARKDEIDPLIGRDHEIERTIQILCRRRKNNPLLVGEAGVGKTAIA 229

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IVD  VP+ +  A +++LD+G L+AGT+YRGDFE+R+K ++ +++    A+L+I
Sbjct: 230 EGLARRIVDEQVPEAIESATVYALDLGALVAGTKYRGDFEKRLKGVLAQLKKEPGAVLFI 289

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DASNL+KP L+SG ++CIGSTTY EYR  FEKD+AL RRFQKI
Sbjct: 290 DEIHTIIGAGAASGGVMDASNLIKPMLASGELKCIGSTTYQEYRGIFEKDRALARRFQKI 349

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           +V EP++++  +I++G+K  FE HH +R+++ A+RAA +L+ R+ T R LPDKAID+IDE
Sbjct: 350 EVPEPTVDETEQILRGLKSRFEAHHNVRFTRPALRAAAELADRYITDRFLPDKAIDLIDE 409

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGAS+ L P+S+R+K I  +DI+  +A + R I   S S  D   L NLE+NL   V+GQ
Sbjct: 410 AGASRQLLPMSQRKKTIGVQDIETIVAKIAR-IPPKSVSSSDKETLRNLERNLKMTVFGQ 468

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           +EAI  L++SIK+AR+GL D +KPIG ++F+GPTGVGKTE+++QLA  LG+ L RFDMSE
Sbjct: 469 DEAIGTLATSIKMARSGLGDMDKPIGSFLFAGPTGVGKTEVTRQLAQQLGIHLARFDMSE 528

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVG+ +GG+L D++ ++P+SV+LLDEIEK+HPDV N+LLQ+MD+
Sbjct: 529 YMERHTVSRLIGAPPGYVGYDEGGLLTDAILKHPHSVLLLDEIEKAHPDVFNVLLQVMDH 588

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+++ FRNVIL+MTTNAGA + S+  +GF    +     EA++   +PEF NR
Sbjct: 589 GTLTDANGREVDFRNVILVMTTNAGAEQASRPSVGFTQQDHSSDSTEAIKRTFTPEFRNR 648

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+ I F PL    I  VV KF+ +L+ QL EK +      +   WL  HGYDVKMGARP
Sbjct: 649 LDATIQFGPLDEATILNVVDKFLTQLQAQLDEKKVHLTVEPDARAWLAEHGYDVKMGARP 708

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV 751
           + R ++EH+K PLADE+LFG+L +GG VV
Sbjct: 709 MARTLQEHIKKPLADELLFGRLAQGGEVV 737


>gi|167569070|ref|ZP_02361944.1| ATP-dependent Clp protease ATP-binding subunit clpA [Burkholderia
           oklahomensis C6786]
          Length = 766

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/771 (52%), Positives = 554/771 (71%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K               SS+ S      +      +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKT--------------SSSESAKPADASAEADDAN 165

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 166 TQKETPLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KIDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRVLPKSKQKKTIGKSEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L+++IK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKASIGFTTRRETGDEMVDIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDAIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK+A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDESDKVQLSFDKTATPP 755


>gi|323527131|ref|YP_004229284.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           sp. CCGE1001]
 gi|323384133|gb|ADX56224.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           sp. CCGE1001]
          Length = 765

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/786 (51%), Positives = 561/786 (71%), Gaps = 25/786 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAG--SDGEGFVNDYQAK 178
           HA Y+LQ+Q +T  D VNFISHGI+K              GS A   SD     ++  A+
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAK------------TSGSDAAKASDANAESDEAAAQ 167

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
            +      L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGK
Sbjct: 168 KET----PLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGK 223

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +A
Sbjct: 224 TAIAEGLAWRITRGEVPDILADAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHA 283

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RR
Sbjct: 284 ILFIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRR 343

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQK+DV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAID
Sbjct: 344 FQKVDVTEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAID 403

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +V
Sbjct: 404 VIDEAGAAQRILPKSKQKKTIGKNEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSV 462

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ+ AI  LS++IK+ARAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RF
Sbjct: 463 VFGQDPAIDALSAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVAKQLAFTLGIELIRF 522

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ
Sbjct: 523 DMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIYNVLLQ 582

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +G+K  FRNVI+IMTTNAGA  M K+ IGF + R    +   ++   +PE
Sbjct: 583 VMDHGTLTDNNGRKADFRNVIIIMTTNAGAEAMGKSVIGFTNRRETGDEMVDIKRMFTPE 642

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F++ +   L  HG+D  M
Sbjct: 643 FRNRLDATISFRALDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDPLM 702

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISL 778
           GARP++R+I++ ++  LADE+LFGKL  GG   +VS++ D      + F+   +  N + 
Sbjct: 703 GARPMQRLIQDTIRRALADELLFGKLMNGG---RVSVDVDAEDKVQLTFDEHPAPRNPNP 759

Query: 779 ETEEKE 784
           E  E E
Sbjct: 760 EAVEVE 765


>gi|118594452|ref|ZP_01551799.1| ATPase with chaperone activity [Methylophilales bacterium HTCC2181]
 gi|118440230|gb|EAV46857.1| ATPase with chaperone activity [Methylophilales bacterium HTCC2181]
          Length = 751

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/748 (52%), Positives = 544/748 (72%), Gaps = 19/748 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A ++ HE  T+EHLLLA++D+  A+ V+ SC  +++ L+ +L +
Sbjct: 1   MIAQELEVSLHMAFMDARQKRHELITVEHLLLAMLDNPSASDVLKSCGANIEKLRIDLSD 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I+ + +  +     V+ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  HIE-EHTPIVDGSDEVDTQPTLGFQRVIQRAMLHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL ++ +   D VNFI+HGISK  E                ++ EG  ++ + +   N
Sbjct: 120 VYFLHQEGVARLDIVNFIAHGISKVAE---------------SNENEGITSEAEPEIKSN 164

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L  Y ++L + V +GK+D L+GR  E+ R IQILCRR KNNPL VG+ GVGKTAIA
Sbjct: 165 --KGLETYTINLNKLVAQGKIDPLIGRDAEVERLIQILCRRRKNNPLLVGEAGVGKTAIA 222

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IV+   P+IL G  I+SLD+G LIAGT+YRGDFE+R+K ++K +    NAIL+I
Sbjct: 223 EGLAKKIVENETPEILQGMVIYSLDLGALIAGTKYRGDFEQRLKDVLKLLAEQDNAILFI 282

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNLLKPAL++G ++CIG+TTY EYR  FEKD AL RRFQKI
Sbjct: 283 DEIHTIIGAGSASGGTLDASNLLKPALANGNLKCIGATTYQEYRTVFEKDHALARRFQKI 342

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EP++   I I+KG+K +FE+HH +++S  A+ +A +LS +    ++LPDKAIDVIDE
Sbjct: 343 DVEEPNVSTTISILKGLKSHFEKHHNVKFSSSALISAAELSAKFINDKQLPDKAIDVIDE 402

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P +K++K I  K+I+  IA M + I   + ++DD + L  LE++L  V++GQ
Sbjct: 403 AGAAQRILPKNKQKKLIGSKEIENVIAKMAK-IPAQNVNKDDRNALQTLERDLKAVIFGQ 461

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
            +AI+ LSS+IK+AR+GL   NKPIG ++FSGPTGVGKTE+++QLA+ LG++L+R DMSE
Sbjct: 462 NKAIESLSSAIKMARSGLGSDNKPIGSFLFSGPTGVGKTEVARQLAYILGIELVRIDMSE 521

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH+VS+LIGAPPGYVGF QGGIL +SV++NP+SV+LLDEIEK+HPDV NILLQ+MD 
Sbjct: 522 YMERHSVSKLIGAPPGYVGFDQGGILTESVNKNPHSVLLLDEIEKAHPDVFNILLQVMDN 581

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNV LIMTTNAGA  +SKA  GF  ++    ++E ++   SPEF NR
Sbjct: 582 GFLTDSNGRKTDFRNVTLIMTTNAGAEALSKASFGFTQTKQTGDEQEDIKKLFSPEFRNR 641

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LDSI+ F  L SD+I +VV KF+++LE QL +K +   F+ ++  +L   G+D +MGARP
Sbjct: 642 LDSIVSFTALDSDVILKVVDKFLIQLENQLHDKKVDATFTPKLKEFLAQKGFDPQMGARP 701

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I++ ++  LADE+LFGKL  GG +
Sbjct: 702 MSRLIQDTIRKALADELLFGKLTNGGEI 729


>gi|330829986|ref|YP_004392938.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Aeromonas
           veronii B565]
 gi|328805122|gb|AEB50321.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Aeromonas
           veronii B565]
          Length = 751

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/756 (52%), Positives = 540/756 (71%), Gaps = 20/756 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             +++LEK L++A  LA +  HE+ T+EHLLLAL+D+S A   + SC  D++ ++  +  
Sbjct: 1   MLNKDLEKTLNEAFKLARDERHEFMTVEHLLLALLDNSSAHEALSSCGADVEQMRKEIRA 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I   +    ++    E +PT  FQRV+QRAV HVQS+G   V+GAN+LVA+FSE +S A
Sbjct: 61  FITQTTPLIPRDDEDRETQPTLGFQRVLQRAVFHVQSSGNTEVSGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL++ E++  D VNF+SHG+ K        SK ++ GS+   + +  V+  Q      
Sbjct: 121 AYFLKKAEISRLDVVNFLSHGVRK-------DSKPDL-GSNNNPESDDDVSTAQ------ 166

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               + ++  +L + V +G++D L+GR +E+NRTIQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 167 ----IESFATNLNQLVLEGRIDPLIGRDQELNRTIQVLCRRRKNNPLLVGEAGVGKTAIA 222

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +IV G VP+++ G+ I+SLDMG+L+AGT+YRGDFE+R+K ++K+IE    AIL+I
Sbjct: 223 EGLAYRIVKGDVPEVIAGSTIYSLDMGSLLAGTKYRGDFEKRLKVLLKQIERQEGAILFI 282

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DA+NL+KP LS+G +RC+GSTTY EY Q FEKD+AL RRFQKI
Sbjct: 283 DEIHTIIGAGAASGGQLDAANLIKPLLSNGLLRCVGSTTYQEYAQIFEKDRALARRFQKI 342

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP+I+D   I+ G+K  +E HH +RY+ +AIRAA +LS ++   R LPDKAIDVIDE
Sbjct: 343 DIVEPTIDDTTRILMGLKSRYEAHHGVRYTAKAIRAAAELSAKYINDRHLPDKAIDVIDE 402

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P SKR+K I  ++I+  +A + R I   S S  D  VL NLE+NL  VV+GQ
Sbjct: 403 AGAGQRLLPASKRKKVINVQEIESIVAKIAR-IPEKSVSSSDKEVLKNLERNLKMVVFGQ 461

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ L+ +I+++R+GL +  +P+GC++F+GPTGVGKTE+++QL  ALGV++LRFDMSE
Sbjct: 462 DKAIEVLTDAIRLSRSGLGNERRPVGCFLFAGPTGVGKTEVTQQLGKALGVEMLRFDMSE 521

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L D+V ++P+SVVLLDEIEK+HPDV N+LLQ+MD 
Sbjct: 522 YMERHTVSRLIGAPPGYVGFEQGGLLTDAVIKHPHSVVLLDEIEKAHPDVFNLLLQVMDN 581

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVIL+MTTNAG  E  +  IGF            +    SPEF NR
Sbjct: 582 GTLTDNNGRKADFRNVILVMTTNAGVQETQRKSIGFQQQDLSHDAMAVINKTFSPEFRNR 641

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD  I F  L   +I QVV KFI++L++QL  KG+S   SE   +WL   GYD  MGARP
Sbjct: 642 LDHTIWFNHLDMTVIHQVVDKFIVELQVQLDAKGVSLEVSERARHWLAEKGYDRAMGARP 701

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD 758
           + R+I+EH+K PLA+EILFG L   GG+VKV L  D
Sbjct: 702 MGRVIQEHLKKPLANEILFGSLVD-GGIVKVELVND 736


>gi|167561847|ref|ZP_02354763.1| ATP-dependent Clp protease ATP-binding subunit clpA [Burkholderia
           oklahomensis EO147]
          Length = 766

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/771 (52%), Positives = 554/771 (71%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K               SS+ S      +      +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKT--------------SSSESVKPADASAEADDAN 165

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 166 TQKETPLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAYRITRGEVPDILANAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KIDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRVLPKSKQKKTIGKSEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L+++IK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKASIGFTTRRETGDEMVDIKRLFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  L  +II +VV KF+++LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDAIISFRSLDEEIIMRVVDKFLIQLEEQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V        KV L+ DK+A+ P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVNGGHVTVDVDESDKVQLSFDKTATPP 755


>gi|254468529|ref|ZP_05081935.1| ATP-dependent Clp protease ATP-binding subunit ClpA [beta
           proteobacterium KB13]
 gi|207087339|gb|EDZ64622.1| ATP-dependent Clp protease ATP-binding subunit ClpA [beta
           proteobacterium KB13]
          Length = 750

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/740 (53%), Positives = 546/740 (73%), Gaps = 24/740 (3%)

Query: 15  ALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKN 74
           A + A ++ HE  T+EHLL+A++D+  A  V+ +C  +   LK +LLN+I+  +   + N
Sbjct: 2   AFMDARQKRHELITVEHLLVAMLDNPSAQEVLKACGANFDSLKKDLLNHIEEHTP--IVN 59

Query: 75  G-FRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTL 133
           G   V+ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+F E DSHA YFL +Q +  
Sbjct: 60  GENEVDTQPTLGFQRVIQRAMLHVQSSGKKEVTGANVLVAIFGEKDSHAVYFLHQQGIAR 119

Query: 134 YDAVNFISHGISKRKEFANFQSKLN--VDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYC 191
            D VNFI+HGI K  +  N   +++  +D  +   + +                 L +Y 
Sbjct: 120 LDVVNFIAHGIEKELDKENEADEVDEKIDQKTQNKESD-----------------LESYA 162

Query: 192 VDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVD 251
           ++L + V  GK+D ++GR  EI R  QILCRR KNNPL VGD GVGKTAIAEG AK+IVD
Sbjct: 163 LNLNKVVLDGKIDPVIGRENEIERVAQILCRRRKNNPLLVGDAGVGKTAIAEGLAKKIVD 222

Query: 252 GMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGA 311
           G +P++L    I+SLD+G LIAGT+YRGDFE+R+K ++K++    NAIL+IDEIHT++GA
Sbjct: 223 GDIPEVLKDTAIYSLDLGALIAGTKYRGDFEQRLKNVLKQLSKKPNAILFIDEIHTIIGA 282

Query: 312 GSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIED 371
           GSASG ++DASNLLKPAL+ G +RCIG+TT++EYR  FEKD AL RRFQKIDV EPSI  
Sbjct: 283 GSASGGTLDASNLLKPALAKGELRCIGATTFNEYRTVFEKDHALTRRFQKIDVDEPSIPV 342

Query: 372 AIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQP 431
           +IEI+KG+K  FE HH++++   A+ +AV+LS ++ T RKLPDKAIDVIDEAGA Q + P
Sbjct: 343 SIEILKGLKKSFESHHKIKFLNNALISAVELSAKYITDRKLPDKAIDVIDEAGALQKILP 402

Query: 432 LSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSS 491
            +K++K I+ K+I++ I+ + + I + + ++DD S+L NL+++L  +++GQ+EAI KLS+
Sbjct: 403 KTKQKKTISSKEIEEVISKIAK-IPSKNINQDDLSMLRNLDRDLKAIIFGQDEAINKLST 461

Query: 492 SIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSR 551
           +IK+AR+GL   NKPIG ++FSGPTGVGKTE++KQLA+ LG++L+R DMSE+MERHAVS+
Sbjct: 462 AIKMARSGLLSDNKPIGSFMFSGPTGVGKTEVAKQLAYTLGIELIRIDMSEFMERHAVSK 521

Query: 552 LIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGK 611
           LIGAPPGYVGF QGG L +S+++NPY+V+LLDEIEK+HPDV NILLQIMD G LTD +G+
Sbjct: 522 LIGAPPGYVGFDQGGTLTESINKNPYAVLLLDEIEKAHPDVHNILLQIMDNGFLTDSNGR 581

Query: 612 KISFRNVILIMTTNAGALEMSKARIGFGSSRNDDAD-KEALRNFLSPEFLNRLDSIIPFF 670
           KI FRNV LIMTTN GA  +SK+ +GF +      D K+ +    SPEF NR+D+I+ F 
Sbjct: 582 KIDFRNVTLIMTTNVGAESLSKSSLGFIADDQTVFDEKKEINKAFSPEFRNRIDAIVSFA 641

Query: 671 PLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEH 730
           PL ++ I +VV KF+++LE QL +K +   FS+ + N+L  +G+D+KMGARP+ R+I++ 
Sbjct: 642 PLENETILKVVDKFLIQLENQLHDKKVEVTFSDNLKNYLAKNGFDIKMGARPMSRLIQDT 701

Query: 731 VKVPLADEILFGKLKKGGGV 750
           ++  LADE+LFGKL  GG V
Sbjct: 702 IRKALADELLFGKLVNGGDV 721


>gi|307730768|ref|YP_003907992.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           sp. CCGE1003]
 gi|307585303|gb|ADN58701.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           sp. CCGE1003]
          Length = 765

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/784 (51%), Positives = 562/784 (71%), Gaps = 21/784 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           + D + A SD     ++  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTS---------SSDAAKA-SDANAESDEAAAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAWRITRGEVPDILADAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKNEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS++IK+ARAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALSAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVAKQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIYNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M K+ IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAEAMGKSVIGFTNRRETGDEMVDIKRMFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDATISFRALDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RP++R+I++ ++  LADE+LFGKL  GG   +VS++ D      + F+   +  N + E 
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLMNGG---RVSVDVDAEDKVQLTFDEHPAPRNPNPEA 761

Query: 781 EEKE 784
            E E
Sbjct: 762 VEVE 765


>gi|91784979|ref|YP_560185.1| putative ATP-dependent Clp protease ATP- binding subunit
           [Burkholderia xenovorans LB400]
 gi|91688933|gb|ABE32133.1| Putative ATP-dependent Clp protease ATP- binding subunit
           [Burkholderia xenovorans LB400]
          Length = 765

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/784 (51%), Positives = 563/784 (71%), Gaps = 21/784 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           + D + A SD     ++  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTS---------STDAAKA-SDANAESDEAAAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAWRITRGEVPDILADAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKNEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS++IK+ARAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALSAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVAKQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIYNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M K+ IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAEAMGKSVIGFTNRRETGDEMVDIKRMFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD++I F  L  +II +VV KF+M+LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDAVISFRSLDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RP++R+I++ ++  LADE+LFGKL  GG   +V+++ D      + F+   +  N + E 
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLMNGG---RVTVDVDAEDKVQLTFDEHPAPRNPNPEA 761

Query: 781 EEKE 784
            E E
Sbjct: 762 VEVE 765


>gi|170693566|ref|ZP_02884724.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           graminis C4D1M]
 gi|170141348|gb|EDT09518.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           graminis C4D1M]
          Length = 765

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/784 (51%), Positives = 562/784 (71%), Gaps = 21/784 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           + D + A SD     ++  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTS---------SSDAAKA-SDANAESDEAAAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAWRITRGEVPDILADAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKNEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS++IK+ARAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALSAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVAKQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIYNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M K+ IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAEAMGKSVIGFTNRRETGDEMVDIKRMFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDATISFRALDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RP++R+I++ ++  LADE+LFGKL  GG   +VS++ D      + F+   +  N + E 
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLMNGG---RVSVDVDAEDKVQLTFDEHPAPRNPNPEA 761

Query: 781 EEKE 784
            E E
Sbjct: 762 VEVE 765


>gi|309781482|ref|ZP_07676218.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Ralstonia sp.
           5_7_47FAA]
 gi|308919895|gb|EFP65556.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Ralstonia sp.
           5_7_47FAA]
          Length = 762

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/751 (52%), Positives = 542/751 (72%), Gaps = 20/751 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ +L N
Sbjct: 1   MIAQELEVSLHMAFVEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRTHLKN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-ADNTPVVPGTDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI K +     Q + N +G                   
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIRKDQAEPAKQGEGNPEGEGGDGKES----------- 168

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L  +  +L    K GK+D L+GR +E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 169 -----PLEQFTQNLNALAKAGKIDPLIGREQEVERVVQVLCRRRKNNPLLVGEAGVGKTA 223

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  + ++SLDMG L+AGT+YRGDFE+R+K ++K ++   NAIL
Sbjct: 224 IAEGLAWRITKGEVPDILAKSVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDNPNAIL 283

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSGA++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 284 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGALKCIGATTFTEYRGIFEKDAALSRRFQ 343

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP+++  ++I++G+K  FEEHH ++Y+  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 344 KIDVVEPTVDQTVQILRGLKSRFEEHHGVKYASSALTAAAELSARFITDRHLPDKAIDVI 403

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I+  ++ + R +   S S+DD S L  LE++L +VV+
Sbjct: 404 DEAGAAQRILPKSKQKKTIGKGEIEVIVSRIAR-VPPQSVSQDDRSKLQTLERDLKSVVF 462

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L+S+IK++RAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 463 GQDPAIDALASAIKMSRAGLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFILGIELIRFDM 522

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 523 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNILLQVM 582

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M+KA IGF ++R    +   ++   +PEF 
Sbjct: 583 DHGALTDNNGRKADFRNVIIIMTTNAGAETMNKATIGFTTAREQGDEMADIKRMFTPEFR 642

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F+E++  +L   G+D  MGA
Sbjct: 643 NRLDATISFRSLDEEIIMRVVDKFLMQLEEQLHEKKVDAIFTEKLRRFLAKKGFDPLMGA 702

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           RP++R+I++ ++  LADE+LFGKL  GG VV
Sbjct: 703 RPMQRLIQDLIRKALADELLFGKLVNGGKVV 733


>gi|187929803|ref|YP_001900290.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Ralstonia
           pickettii 12J]
 gi|187726693|gb|ACD27858.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Ralstonia
           pickettii 12J]
          Length = 762

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/751 (52%), Positives = 542/751 (72%), Gaps = 20/751 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ +L N
Sbjct: 1   MIAQELEVSLHMAFVEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRTHLKN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-ADNTPVVPGTDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI K +     Q + N +G                   
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIRKDQAEPAKQGEGNPEGEGGDGKES----------- 168

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L  +  +L    K GK+D L+GR +E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 169 -----PLEQFTQNLNALAKAGKIDPLIGREQEVERVVQVLCRRRKNNPLLVGEAGVGKTA 223

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  + ++SLDMG L+AGT+YRGDFE+R+K ++K ++   NAIL
Sbjct: 224 IAEGLAWRITKGEVPDILAKSVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDNPNAIL 283

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSGA++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 284 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGALKCIGATTFTEYRGIFEKDAALSRRFQ 343

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP+++  ++I++G+K  FEEHH ++Y+  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 344 KIDVVEPTVDQTVQILRGLKSRFEEHHGVKYASSALTAAAELSARFITDRHLPDKAIDVI 403

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I+  ++ + R +   S S+DD S L  LE++L +VV+
Sbjct: 404 DEAGAAQRILPKSKQKKTIGKGEIEDIVSRIAR-VPPQSVSQDDRSKLQTLERDLKSVVF 462

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L+S+IK++RAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 463 GQDPAIDALASAIKMSRAGLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFILGIELIRFDM 522

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 523 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNILLQVM 582

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M+KA IGF ++R    +   ++   +PEF 
Sbjct: 583 DHGALTDNNGRKADFRNVIIIMTTNAGAETMNKATIGFTTAREQGDEMADIKRMFTPEFR 642

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F+E++  +L   G+D  MGA
Sbjct: 643 NRLDATISFRSLDEEIIMRVVDKFLMQLEEQLHEKKVDAIFTEKLRRFLAKKGFDPLMGA 702

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           RP++R+I++ ++  LADE+LFGKL  GG V+
Sbjct: 703 RPMQRLIQDLIRKALADELLFGKLVNGGKVI 733


>gi|194290612|ref|YP_002006519.1| ATP-dependent specificity subunit of clpa-clpp serine protease
           [Cupriavidus taiwanensis LMG 19424]
 gi|193224447|emb|CAQ70458.1| ATP-dependent specificity subunit of clpA-clpP serine protease
           [Cupriavidus taiwanensis LMG 19424]
          Length = 764

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/752 (53%), Positives = 539/752 (71%), Gaps = 22/752 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ +L N
Sbjct: 1   MIAQELEVSLHMAFVEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRTSLKN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-ADNTPVVPGTDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISK-RKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKT 179
           HA Y+LQ+Q +T  D VNFISHGI K + E A             G +            
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIRKDQSEPAKHGDAAGEGEGGDGKES----------- 168

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                  L  Y  +L    K GK+D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKT
Sbjct: 169 ------PLEQYTQNLNALAKAGKIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKT 222

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A +I    VPDIL  A ++SLDMG L+AGT+YRGDFE+R+K ++K ++   NAI
Sbjct: 223 AIAEGLAWRITKNEVPDILEKATVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDNPNAI 282

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRF
Sbjct: 283 LFIDEIHTLIGAGAASGGTLDASNLLKPALSSGQLKCIGATTFTEYRGIFEKDAALSRRF 342

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV EPS++  ++I++G+K  FEEHH ++Y+  A+ AA +LS R  T R LPDKAIDV
Sbjct: 343 QKIDVVEPSVDQTVQILRGLKSRFEEHHGVKYASSALTAAAELSARFITDRHLPDKAIDV 402

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA+Q + P SK++K I + +I+  ++ + R I   S ++DD S L  LE++L +VV
Sbjct: 403 IDEAGAAQRILPKSKQKKTIGKGEIEDIVSRIAR-IPPQSVNQDDRSKLQTLERDLKSVV 461

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ+ AI+ L+S+IK++RAGL   +KPIG ++FSGPTGVGKTE++KQLAF +G++LLRFD
Sbjct: 462 FGQDPAIEALASAIKMSRAGLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFIMGIELLRFD 521

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ NILLQ+
Sbjct: 522 MSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNILLQV 581

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G++  FRNVI+IMTTNAGA  M++A IGF SSR    +   ++   +PEF
Sbjct: 582 MDHGSLTDNNGRRADFRNVIIIMTTNAGAETMNRATIGFTSSREQGDEMADIKRMFTPEF 641

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+ I F  L  +II +VV KF+M+LE QL EK +   FSE++  +L   G+D  MG
Sbjct: 642 RNRLDATISFRSLDEEIILRVVDKFLMQLEEQLHEKKVEASFSEKLRKFLAHKGFDPLMG 701

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           ARP++R+I++ ++  LADE+LFG+L  GG VV
Sbjct: 702 ARPMQRLIQDMIRKALADELLFGRLVSGGKVV 733


>gi|241663929|ref|YP_002982289.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Ralstonia
           pickettii 12D]
 gi|240865956|gb|ACS63617.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Ralstonia
           pickettii 12D]
          Length = 762

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/751 (52%), Positives = 542/751 (72%), Gaps = 20/751 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ +L N
Sbjct: 1   MIAQELEVSLHMAFVEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRTHLKN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-ADNTPVVPGTDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI K +     Q + N +G                   
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIRKDQAEPAKQGEGNPEGEGGDGKES----------- 168

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L  +  +L    K GK+D L+GR +E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 169 -----PLEQFTQNLNALAKAGKIDPLIGREQEVERVVQVLCRRRKNNPLLVGEAGVGKTA 223

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  + ++SLDMG L+AGT+YRGDFE+R+K ++K ++   NAIL
Sbjct: 224 IAEGLAWRITKGEVPDILAKSVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDNPNAIL 283

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSGA++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 284 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGALKCIGATTFTEYRGIFEKDAALSRRFQ 343

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EP+++  ++I++G+K  FEEHH ++Y+  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 344 KIDVVEPTVDQTVQILRGLKSRFEEHHGVKYASSALTAAAELSARFITDRHLPDKAIDVI 403

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I+  ++ + R +   S S+DD S L  LE++L +VV+
Sbjct: 404 DEAGAAQRILPKSKQKKTIGKGEIEDIVSRIAR-VPPQSVSQDDRSKLQTLERDLKSVVF 462

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L+S+IK++RAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 463 GQDPAIDALASAIKMSRAGLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFILGIELIRFDM 522

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 523 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNILLQVM 582

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M+KA IGF ++R    +   ++   +PEF 
Sbjct: 583 DHGALTDNNGRKADFRNVIIIMTTNAGAETMNKATIGFTTAREQGDEMADIKRMFTPEFR 642

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F+E++  +L   G+D  MGA
Sbjct: 643 NRLDATISFRSLDEEIIMRVVDKFLMQLEEQLHEKKVDAIFTEKLRRFLAKKGFDPLMGA 702

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           RP++R+I++ ++  LADE+LFGKL  GG VV
Sbjct: 703 RPMQRLIQDLIRKALADELLFGKLVNGGKVV 733


>gi|33601004|ref|NP_888564.1| ATP-dependent Clp protease ATP-binding [Bordetella bronchiseptica
           RB50]
 gi|33575439|emb|CAE32517.1| ATP-dependent clp protease ATP-binding [Bordetella bronchiseptica
           RB50]
          Length = 782

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/790 (51%), Positives = 563/790 (71%), Gaps = 23/790 (2%)

Query: 2   SFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLL 61
           S  S+ LE  LH A V A    HE+ T+EHLLL+L+D++ A  V+ +C  +L  L+ NL 
Sbjct: 12  SVISQELEVSLHMAFVEARSARHEFITVEHLLLSLLDNASAVEVLRACAANLDDLRRNLR 71

Query: 62  NYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQS--TGRGIVTGANILVALFSEPD 119
            ++  +++  + +G  V+ +PT  FQRV+QRA++HV +  TG+  VTGAN+LVA+F E D
Sbjct: 72  QFV-TENTPVIPSGAEVDTQPTLGFQRVIQRAIMHVSAGGTGKKPVTGANVLVAIFGEKD 130

Query: 120 SHATYFLQEQEMTLYDAVNFISHGISKR--KEFANFQSKLNVDGSSAGSDGEGFVNDYQA 177
           SHA Y+LQ+Q +T  D VNF+SHGI+K+  +E +    +    G   G++          
Sbjct: 131 SHAVYYLQQQGVTRLDVVNFLSHGITKQPQEESSALPKEQQASGEEPGAESRQ------- 183

Query: 178 KTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG 237
                    L  Y  DL      G++D L+GR  E+ R IQ+LCRR KNNPL VG+ GVG
Sbjct: 184 -------SPLDQYANDLNAAALAGRIDPLIGREHEVERVIQVLCRRRKNNPLLVGEAGVG 236

Query: 238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN 297
           KTAIAEG A +I  G VP++L  A++F+LDMG L+AGT+YRGDFE+R+K ++K+I    +
Sbjct: 237 KTAIAEGLAWRITRGEVPEVLQTAQVFALDMGALLAGTKYRGDFEQRLKGVLKQIRGNPD 296

Query: 298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR 357
           AIL+IDEIHTL+GAGSASG ++DASNLLKPALSSG ++CIG+TTY+E+R  FEKD AL R
Sbjct: 297 AILFIDEIHTLIGAGSASGGTLDASNLLKPALSSGQLKCIGATTYTEFRGVFEKDHALSR 356

Query: 358 RFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI 417
           RFQKIDV EPS+E  ++I++G+K  FEEHH +RYS  A+ AA +LS R+   R LPDKAI
Sbjct: 357 RFQKIDVPEPSVEQTVQILRGLKSRFEEHHNVRYSAAALSAAAELSARYINDRHLPDKAI 416

Query: 418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGT 477
           DVIDEAGA+Q L P S+++K I + +I+  ++ + R I   S S DD S L+ L+++L T
Sbjct: 417 DVIDEAGAAQRLLPRSRQKKVIGKGEIEHIVSKIAR-IPPQSVSNDDRSKLATLDRDLKT 475

Query: 478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLR 537
           VV+GQ+EAI  L+++IK+AR+GL  P+KPIG ++FSGPTGVGKTE+++QLAF +G++LLR
Sbjct: 476 VVFGQDEAIGALTAAIKMARSGLGKPDKPIGAFLFSGPTGVGKTEVARQLAFTMGIELLR 535

Query: 538 FDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL 597
           FDMSEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ NILL
Sbjct: 536 FDMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKQPHCVLLLDEIEKAHPDIFNILL 595

Query: 598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP 657
           Q+MD+G LTD +G+K  FRNVILIMTTNAGA  +++  IGF + R    +   +R   +P
Sbjct: 596 QVMDHGTLTDNNGRKADFRNVILIMTTNAGAETLNRPAIGFANERVAGDEMAEIRRMFTP 655

Query: 658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVK 717
           EF NRLD+IIPF  LS +II +VV KF+M+LE QL E+ ++  F+E++ + L   G+D  
Sbjct: 656 EFRNRLDAIIPFSALSREIILRVVDKFLMQLEDQLHERRVAAVFTEKLRDHLAKEGFDPL 715

Query: 718 MGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNIS 777
           MGARP++R+I++ ++  LADE+LFGKL  GG    V+++ D +    + FE     S+ +
Sbjct: 716 MGARPMQRLIQDTIRRALADELLFGKLVDGG---NVTVDLDDAGKVVLGFEAPGKPSSNA 772

Query: 778 LETEEKEVED 787
            + +E E+ D
Sbjct: 773 ADKQEVELID 782


>gi|237749125|ref|ZP_04579605.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Oxalobacter
           formigenes OXCC13]
 gi|229380487|gb|EEO30578.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Oxalobacter
           formigenes OXCC13]
          Length = 771

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/752 (52%), Positives = 545/752 (72%), Gaps = 18/752 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  +E+ T+EHLLLAL+D+  A+ V+ +CN D+  LK  L +
Sbjct: 1   MIAQELEVSLHMAFVEARQARYEFITVEHLLLALLDNPSASEVLKACNADIPALKKMLSD 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           ++ +D++  +     V+ +PT  FQRV+QRA++HVQS   G+  VTGAN+LVA+F E DS
Sbjct: 61  FV-SDNTPIVPGTAEVDTQPTLGFQRVIQRAIMHVQSASNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGS-DGEGFVNDYQAKT 179
           HA Y+L +Q +T  D VN+ISHG+ K     N QS++      A    GE  V    +  
Sbjct: 120 HAVYYLHQQGVTRLDVVNYISHGVRK-----NVQSEMPKQAEGAEEMQGEAGVAGKDSPL 174

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
           DL        Y ++L ++   GK+D L+GR EEI+R IQ+LCRR KNNPL VG+ GVGKT
Sbjct: 175 DL--------YTLNLNKQAASGKIDPLIGREEEIDRVIQVLCRRRKNNPLLVGEAGVGKT 226

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           A+AEG A +I    VPD+L  A +++LDMG L+AGT+YRGDFE+R+K ++K++    N+I
Sbjct: 227 ALAEGLAWRITQNSVPDVLHDAVVYALDMGALLAGTKYRGDFEQRLKAVLKQLSDNPNSI 286

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHT++GAGSASG ++DASNLLKPALS G ++CIG+TT++EYR  FEKD AL RRF
Sbjct: 287 LFIDEIHTIIGAGSASGGTLDASNLLKPALSGGQLKCIGATTFTEYRGVFEKDHALARRF 346

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV+EP++E  ++I++G+K  FEEHH+++YS  A+ +A +LS R    R+LPDKAIDV
Sbjct: 347 QKIDVNEPTVEQTVQILRGLKSRFEEHHKVKYSVSALISAAELSARFINDRQLPDKAIDV 406

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA+Q + P SK++K I + +I+  I+ + R I   S ++DD S L NL+++L +VV
Sbjct: 407 IDEAGAAQRILPKSKQKKTIGKAEIEDIISKIAR-IPAQSVNQDDRSKLQNLDRDLKSVV 465

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ+ AI  LS+SIK+ARAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG+ L+RFD
Sbjct: 466 FGQDAAIDALSASIKMARAGLGKTDKPIGAFLFSGPTGVGKTEVAKQLAFTLGIDLIRFD 525

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERHAVSR+IGAPPGYVGF QGG+L +++ + P++V+LLDEIEK+HPD+ +ILLQ+
Sbjct: 526 MSEYMERHAVSRMIGAPPGYVGFDQGGLLTEAITKKPHAVLLLDEIEKAHPDIFSILLQV 585

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G+K  FRNVI+IMTTNAGA  + K+ IGF + +    +   ++   +PEF
Sbjct: 586 MDHGTLTDNNGRKADFRNVIIIMTTNAGAESLQKSSIGFTNQKEKGDEMVDIKRMFTPEF 645

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD II F  L+ DII +VV KF+M+LE QL EK +   F+E +  +L   G+D  MG
Sbjct: 646 RNRLDGIISFSALNEDIILRVVDKFLMQLEEQLHEKKVEAIFTEALRKFLAKKGFDPLMG 705

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           ARP+ R+I++ ++  LADE+LFGKL  GG V+
Sbjct: 706 ARPMLRLIQDLIRKALADELLFGKLVAGGSVI 737


>gi|73542437|ref|YP_296957.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Ralstonia
           eutropha JMP134]
 gi|72119850|gb|AAZ62113.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Ralstonia
           eutropha JMP134]
          Length = 765

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/752 (52%), Positives = 539/752 (71%), Gaps = 22/752 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ +L N
Sbjct: 1   MIAQELEVSLHMAFVEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRTSLKN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-ADNTPVVPGTDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISK-RKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKT 179
           HA Y+LQ+Q +T  D VNFISHGI K + E A             G +            
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIRKDQSEPAKHGDGTGEGEGGDGKES----------- 168

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                  L  Y  +L    K GK+D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKT
Sbjct: 169 ------PLEQYTQNLNALAKAGKIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKT 222

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A +I    VPDIL  A ++SLDMG L+AGT+YRGDFE+R+K ++K ++   NAI
Sbjct: 223 AIAEGLAWRITKNEVPDILEKATVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDNPNAI 282

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRF
Sbjct: 283 LFIDEIHTLIGAGAASGGTLDASNLLKPALSSGQLKCIGATTFTEYRGIFEKDAALSRRF 342

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDV EPS++  ++I++G+K  FEEHH ++Y+  A+ AA +LS R  T R LPDKAIDV
Sbjct: 343 QKIDVVEPSVDQTVQILRGLKSRFEEHHGVKYASSALTAAAELSARFITDRHLPDKAIDV 402

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA+Q + P SK++K I + +I+  ++ + R I   S ++DD S L  LE++L +VV
Sbjct: 403 IDEAGAAQRILPKSKQKKTIGKSEIEDIVSRIAR-IPPQSVNQDDRSKLQTLERDLKSVV 461

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ+ AI+ L+S+IK++RAGL   +KPIG ++FSGPTGVGKTE++KQLAF +G++LLRFD
Sbjct: 462 FGQDPAIEALASAIKMSRAGLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFIMGIELLRFD 521

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ NILLQ+
Sbjct: 522 MSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNILLQV 581

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G++  FRNVI+IMTTNAGA  M++A IGF +SR    +   ++   +PEF
Sbjct: 582 MDHGSLTDNNGRRADFRNVIIIMTTNAGAETMNRATIGFTTSRQQGDEMADIKRMFTPEF 641

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F+E++  +L   G+D  MG
Sbjct: 642 RNRLDATISFRSLDEEIILRVVDKFLMQLEEQLHEKKVEASFTEKLRKFLARKGFDPLMG 701

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           ARP++R+I++ ++  LADE+LFGKL  GG VV
Sbjct: 702 ARPMQRLIQDMIRKALADELLFGKLVSGGKVV 733


>gi|209517458|ref|ZP_03266299.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           sp. H160]
 gi|209502112|gb|EEA02127.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           sp. H160]
          Length = 765

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/784 (51%), Positives = 562/784 (71%), Gaps = 21/784 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           + D + A SD     ++  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTS---------SSDAAKA-SDANAESDEAAAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAWRITRGEVPDILADAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KIDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKNEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS++IK+ARAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALSAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVAKQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M KA IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAEAMGKAVIGFTNRREAGDEMVDIKRMFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDATISFRALDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RP++R+I++ ++  LADE+LFGKL  GG   +V+++ D      + F+   +  N + E 
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLMNGG---RVTVDVDADDKVQLTFDEHPAPRNPNPEA 761

Query: 781 EEKE 784
            E E
Sbjct: 762 VEIE 765


>gi|300113414|ref|YP_003759989.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Nitrosococcus
           watsonii C-113]
 gi|299539351|gb|ADJ27668.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Nitrosococcus
           watsonii C-113]
          Length = 753

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/749 (52%), Positives = 529/749 (70%), Gaps = 13/749 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S +LE  L+ A   A E+ HE+ T+EHLL A++D+  AA V+ +C  +L+ LK  +  
Sbjct: 1   MLSRDLETSLNHAFKNAREKMHEFLTVEHLLFAMLDNPAAATVLRACGANLEQLKQEITV 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++ N+++  L      + +PT  FQRV+QRAVL VQS+G+  VTGAN+LVA++ E  S A
Sbjct: 61  FL-NETTPLLSAEDGRDTQPTLGFQRVLQRAVLQVQSSGQKEVTGANVLVAIYGEQQSQA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL+ Q MT  D VN+ISHGISK     +       DG SAG+  E       A  + +
Sbjct: 120 VYFLKRQHMTRLDVVNYISHGISKVDPQGS-------DGDSAGASEEA----ETAGAETS 168

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L  Y  +L     +G++D L+GR  E+ RTIQILCRR KNNPL+VG+ GVGKTA+A
Sbjct: 169 GQNPLETYATNLNRLAAQGRIDPLIGRSLELERTIQILCRRRKNNPLFVGEAGVGKTALA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +I +G +PD+L    I+SLDMG L+AGT+YRGDFE+R+K I+ +++    AIL+I
Sbjct: 229 EGLAWKISEGNIPDVLQDCTIYSLDMGTLLAGTKYRGDFEKRLKGILSQLKKEKAAILFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG  +DASNL+KPAL+SG ++CIGSTTY EYR  FEKD+AL RRFQKI
Sbjct: 289 DEIHTVIGAGSASGGVMDASNLIKPALASGELKCIGSTTYQEYRNIFEKDRALARRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EPS+E+ ++I+ G+KP  E HH+LR+S+ A+R A +LS R+   R LPDKAIDV+DE
Sbjct: 349 DIPEPSVEETVQILHGLKPRLEAHHKLRFSQTALRTAAELSARYINDRHLPDKAIDVLDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
            GASQ L   SKR+K I  +D++  +A M R I     S  D   L+ LE NL  V++GQ
Sbjct: 409 CGASQQLLAPSKRKKVIGVQDVQTIVAKMAR-IPPKHISASDKESLAKLETNLKRVIFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ LS++IK++R+GL D ++P+G ++FSGPTGVGKTE+++QLA  L ++L+RFDMSE
Sbjct: 468 DKAIEALSAAIKMSRSGLGDTDRPVGSFLFSGPTGVGKTEVTRQLAHILSIELIRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVG+ QGG+L +++ +NP++V+LLDEIEK+HPDV N+LLQ+MD+
Sbjct: 528 YMERHTVSRLIGAPPGYVGYDQGGLLTEAICKNPHAVLLLDEIEKAHPDVFNLLLQVMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVIL+MT+NAGA E+S+  IGF    +     E +R   SPEF NR
Sbjct: 588 GTLTDNNGRKADFRNVILVMTSNAGAQEISRTSIGFTLQDHSSDAMEVIRRTFSPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD II F  L +  I  VV KFI +LE  LQ+K ++   SE    WL  HGYD KMGARP
Sbjct: 648 LDDIIQFQSLDAPAISSVVDKFIFELEFLLQDKNVTLEVSETARAWLAKHGYDEKMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVV 751
           + R+I+E +K PLA+E+LFGKL K G V 
Sbjct: 708 MARLIQERIKRPLAEELLFGKLAKEGHVA 736


>gi|299065939|emb|CBJ37120.1| ATP-dependent Clp protease ATP-binding subunit clpA [Ralstonia
           solanacearum CMR15]
          Length = 762

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/767 (52%), Positives = 555/767 (72%), Gaps = 23/767 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ +L N
Sbjct: 1   MIAQELEVSLHMAFVEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRTHLKN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-ADNTPVVPGTDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI K +     +   + D +  G  G+G  +       
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIRKDQA----EPAKHGDSNPEGEAGDGKES------- 168

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L  +  +L    K GK+D L+GR +E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 169 -----PLEQFTQNLNALAKAGKIDPLIGREQEVERVVQVLCRRRKNNPLLVGEAGVGKTA 223

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  + ++SLDMG L+AGT+YRGDFE+R+K ++K ++   NAIL
Sbjct: 224 IAEGLAWRITKGEVPDILARSVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDNPNAIL 283

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSGA++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 284 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGALKCIGATTFTEYRGIFEKDAALSRRFQ 343

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EPSI+  ++I++G+K  FEEHH +RY+  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 344 KIDVVEPSIDQTVQILRGLKSRFEEHHGVRYAASALTAAAELSARFITDRHLPDKAIDVI 403

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I+  ++ + R +   S S+DD S L  LE++L +VV+
Sbjct: 404 DEAGAAQRILPKSKQKKTIGKGEIEDIVSRIAR-VPPQSVSQDDRSKLQTLERDLKSVVF 462

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L+S+IK++RAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 463 GQDPAIDALASAIKMSRAGLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFILGIELIRFDM 522

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 523 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKRPHCVLLLDEIEKAHPDIFNILLQVM 582

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI++MTTNAGA  M+KA IGF ++R    +   ++   +PEF 
Sbjct: 583 DHGSLTDNNGRKADFRNVIIVMTTNAGAETMNKATIGFTTAREQGDEMADIKRMFTPEFR 642

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  DII +VV KF+M+LE QL EK +   F+E++  +L   G+D  MGA
Sbjct: 643 NRLDATISFRSLDEDIILRVVDKFLMQLEEQLHEKKVDAVFTEKLRRFLAKKGFDPLMGA 702

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFF 767
           RP++R+I++ ++  LADE+LFGKL  GG   KV+++ D++ +  + F
Sbjct: 703 RPMQRLIQDLIRKALADELLFGKLVNGG---KVAVDLDEADAVKLEF 746


>gi|187925139|ref|YP_001896781.1| ATP-dependent Clp protease ATP-binding subunit clpA [Burkholderia
           phytofirmans PsJN]
 gi|187716333|gb|ACD17557.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           phytofirmans PsJN]
          Length = 765

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/784 (51%), Positives = 562/784 (71%), Gaps = 21/784 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           + D + A SD     ++  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTS---------STDAAKA-SDANAESDEAAAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAWRITRGEVPDILADAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKNEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS++IK+ARAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALSAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVAKQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIYNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M K+ IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAEAMGKSVIGFTNRRETGDEMVDIKRMFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDATISFRSLDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RP++R+I++ ++  LADE+LFGKL  GG   +VS++ D      + F+   +  N + E 
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLMNGG---RVSVDVDAEDKVQLTFDEHPAPRNPNPEA 761

Query: 781 EEKE 784
            E E
Sbjct: 762 VEIE 765


>gi|254521944|ref|ZP_05133999.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Stenotrophomonas sp. SKA14]
 gi|219719535|gb|EED38060.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Stenotrophomonas sp. SKA14]
          Length = 761

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/748 (52%), Positives = 541/748 (72%), Gaps = 13/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE  + Q    A E  HE+ T+EHLLLAL+D+  A  V+ +C  D + L+  L  
Sbjct: 1   MFSKDLEHTIGQCYKRAREARHEFMTVEHLLLALLDNPSAQAVLKACGADAERLRQELEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y+L +Q++T  D VN++SHGI+K  E     S      SS+  +G     + + K D  
Sbjct: 120 VYYLNQQDVTRLDVVNYLSHGIAKLGEEGEQPS------SSSEGEGRIEGGEGEPKGD-- 171

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ +  +L E+ + G++D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 172 ---ALTEFASNLNEQARAGRIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VPD+L  A I+SLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 229 EGLARRIVEGSVPDVLADAVIYSLDLGALVAGTKYRGDFEKRLKSVLTALKKVPNAVLFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPAL+SG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 289 DEIHTIIGAGSASGGTMDASNLIKPALASGELRCIGSTTFQEYRGIFEKDRALARRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+K  +E HH + YS EA++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 349 DIVEPTVGETYEILQGLKSKYELHHGVTYSDEALQAAVDLSVKHIGDRLLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P  +R++ I  ++++  +A M R I T   S  D  VL +LE+NL  V++GQ
Sbjct: 409 AGARQRLLPEGQRKELIDVEEVEAIVAKMAR-IPTKQVSATDKDVLQHLERNLKMVIFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI+ LSS+IK+AR+GL +P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 468 DPAIETLSSAIKLARSGLGNPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDEIEK+HPD+ NILLQ+MD 
Sbjct: 528 YMEPHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEIEKAHPDIFNILLQVMDR 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G+LTD +G++ +F+NV+L+MTTNAGA + S+  IGF    +     E +R   +PEF NR
Sbjct: 588 GVLTDTNGREANFKNVVLVMTTNAGAAQASRRSIGFTKQDHATDAMETIRRAFTPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+++ F  L  + I +VV KF+++LE+ LQ+K +S   +    +WL  HG+D  MGARP
Sbjct: 648 LDAVVQFQALGFEHILRVVDKFLIELEMLLQDKQVSLSATPTARDWLAHHGFDPLMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I++ +K PLADE+LFGKL  GG V
Sbjct: 708 MARVIQDKIKRPLADELLFGKLVNGGKV 735


>gi|194365701|ref|YP_002028311.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Stenotrophomonas maltophilia R551-3]
 gi|194348505|gb|ACF51628.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Stenotrophomonas maltophilia R551-3]
          Length = 761

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/748 (52%), Positives = 540/748 (72%), Gaps = 13/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE  + Q    A E  HE+ T+EHLLLAL+D+  A  V+ +C  D + L+  L  
Sbjct: 1   MFSKDLEHTIGQCYKRAREARHEFMTVEHLLLALLDNPSAQAVLKACGADAERLRQELEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y+L +Q++T  D VN++SHGI+K  E    Q   + +G S    GEG     + K D  
Sbjct: 120 VYYLNQQDVTRLDVVNYLSHGIAKLGEEGE-QPSSSSEGESRIEGGEG-----EPKGD-- 171

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ +  +L E+ + G++D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 172 ---ALTEFASNLNEQARAGRIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+G VP++L  A I+SLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 229 EGLARRIVEGSVPEVLSDAVIYSLDLGALVAGTKYRGDFEKRLKGVLTALKKVPNAVLFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPAL+SG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 289 DEIHTIIGAGSASGGTMDASNLIKPALASGELRCIGSTTFQEYRGIFEKDRALARRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+K  +E HH + YS EA++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 349 DIVEPTVGETYEILQGLKSKYELHHGVTYSDEALQAAVDLSVKHIGDRLLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P  +R++ I  ++++  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 409 AGARQRLLPEGQRKELIDVEEVEAIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI  L+S+IK+AR+GL +P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 468 DPAIDTLASAIKLARSGLGNPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDEIEK+HPD+ NILLQ+MD 
Sbjct: 528 YMEPHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEIEKAHPDIFNILLQVMDR 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G+LTD +G++ +F+NV+L+MTTNAGA + S+  IGF    +     E +R   +PEF NR
Sbjct: 588 GVLTDTNGREANFKNVVLVMTTNAGAAQASRRSIGFTKQDHATDAMETIRRSFTPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+++ F  L  + I +VV KF+++LE+ LQ+K +S   +    +WL  HG+D  MGARP
Sbjct: 648 LDAVVQFQALGFEHILRVVDKFLIELEMLLQDKHVSLSATPTARDWLAHHGFDPLMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I++ +K PLADE+LFGKL  GG V
Sbjct: 708 MARVIQDKIKRPLADELLFGKLVNGGRV 735


>gi|296157171|ref|ZP_06840007.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           sp. Ch1-1]
 gi|295892507|gb|EFG72289.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           sp. Ch1-1]
          Length = 765

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/784 (51%), Positives = 562/784 (71%), Gaps = 21/784 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           + D + A SD     ++  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTS---------STDAAKA-SDANAESDEAAAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAWRITRGEVPDILADAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKNEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS++IK+ARAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALSAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVAKQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIYNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M K+ IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAEAMGKSVIGFTNRRETGDEMVDIKRMFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDATISFRALDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RP++R+I++ ++  LADE+LFGKL  GG   +V+++ D      + F+   +  N + E 
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLMNGG---RVTVDVDAEDKVQLTFDEHPAPRNPNPEA 761

Query: 781 EEKE 784
            E E
Sbjct: 762 VEVE 765


>gi|163802084|ref|ZP_02195980.1| ATP-dependent Clp protease ATP-binding subunit [Vibrio sp. AND4]
 gi|159174225|gb|EDP59033.1| ATP-dependent Clp protease ATP-binding subunit [Vibrio sp. AND4]
          Length = 756

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/757 (52%), Positives = 537/757 (70%), Gaps = 15/757 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A ++ HE+ T+EHLLLAL+++  A   +L+C  DL  L+N L  
Sbjct: 1   MLNKELESSLNGAFARARDKRHEFMTVEHLLLALLENDAAKEALLACKADLNALRNELDI 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +    ++    E +PT SFQRV+QRAV HVQS+GR  VTGAN+LVA+FSE +SHA
Sbjct: 61  FIDQTTPLIPESDETRETQPTLSFQRVLQRAVFHVQSSGRSEVTGANVLVAIFSEQESHA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L++ +++  D VNFISHGI+K        S  N D SS+ S G       +   D+N
Sbjct: 121 AYLLKKNDISRLDIVNFISHGITK-------ASGSNEDASSSDSFGS------ETPEDVN 167

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L ++  +L +  K G +D L+GR +E+ RTIQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 168 PEERLDSFATNLNQVAKAGNIDPLIGRDKELERTIQVLCRRRKNNPLLVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +IV+G VP+++  + I+SLD+G+L+AGT+YRGDFE+R K ++K++E   +AIL+I
Sbjct: 228 EGLAWRIVEGQVPEVIQNSVIYSLDIGSLLAGTKYRGDFEKRFKSVLKQLEKEEDAILFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  VDA+NL+KP LSSG +RCIGSTTY EY   FEK++AL RRFQKI
Sbjct: 288 DEIHTIIGAGAASGGQVDAANLIKPLLSSGKLRCIGSTTYQEYSNIFEKERALSRRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPS++D  +I+ G+KP +E HH++RY+ +A+RAAV+LS ++   R LPDKAIDVIDE
Sbjct: 348 DVVEPSLDDTTKILIGLKPKYEAHHEVRYTNKALRAAVELSAKYINERHLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA   L P S+R+K +   DI+  +A M R I   S S  D  +L  L+  +  +V+GQ
Sbjct: 408 AGARSRLAPASRRKKTVGVADIESMVARMAR-IPEKSVSSSDKDILKKLDDKMKMLVFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI  LS +IK++RAGL   NKP+G ++F+GPTGVGKTE++ QL+  LG++LLRFDMSE
Sbjct: 467 DTAIDALSEAIKLSRAGLGVDNKPVGSFLFAGPTGVGKTEVTVQLSKLLGIELLRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           Y ERH+VSRLIGAPPGYVG+ QGG+L D+V ++P+SVVLLDEIEK+HPD+ N+LLQ+MD 
Sbjct: 527 YGERHSVSRLIGAPPGYVGYDQGGLLTDAVLKHPHSVVLLDEIEKAHPDIFNLLLQVMDN 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRN+IL+MTTNAG  E  K  IG     N       ++   +PEF NR
Sbjct: 587 GTLTDNNGRKADFRNIILVMTTNAGVAETEKKSIGLIQQDNSHDAMAEIKKVFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F  L  D+I QVV KFI++L++QL  +G+S   S++  +WL   GYD  MGARP
Sbjct: 647 LDNIIWFNSLDEDVIHQVVDKFIVELQVQLDARGVSMEVSQDARHWLAHKGYDKAMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           + R+I+E +K PLA+E+LFG L   GG VKVSL  D+
Sbjct: 707 MGRVIQEQLKKPLANELLFGSLVD-GGTVKVSLVKDE 742


>gi|33597160|ref|NP_884803.1| ATP-dependent Clp protease ATP-binding [Bordetella parapertussis
           12822]
 gi|33566611|emb|CAE37869.1| ATP-dependent clp protease ATP-binding [Bordetella parapertussis]
          Length = 782

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/790 (51%), Positives = 562/790 (71%), Gaps = 23/790 (2%)

Query: 2   SFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLL 61
           S  S+ LE  LH A V      HE+ T+EHLLL+L+D++ A  V+ +C  +L  L+ NL 
Sbjct: 12  SVISQELEVSLHMAFVETRSARHEFITVEHLLLSLLDNASAVEVLRACAANLDDLRRNLR 71

Query: 62  NYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQS--TGRGIVTGANILVALFSEPD 119
            ++  +++  + +G  V+ +PT  FQRV+QRA++HV +  TG+  VTGAN+LVA+F E D
Sbjct: 72  QFV-TENTPVIPSGAEVDTQPTLGFQRVIQRAIMHVSAGGTGKKPVTGANVLVAIFGEKD 130

Query: 120 SHATYFLQEQEMTLYDAVNFISHGISKR--KEFANFQSKLNVDGSSAGSDGEGFVNDYQA 177
           SHA Y+LQ+Q +T  D VNF+SHGI+K+  +E +    +    G   G++          
Sbjct: 131 SHAVYYLQQQGVTRLDVVNFLSHGITKQPQEESSALPKEQQASGEEPGAESRQ------- 183

Query: 178 KTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG 237
                    L  Y  DL      G++D L+GR  E+ R IQ+LCRR KNNPL VG+ GVG
Sbjct: 184 -------SPLDQYANDLNAAALAGRIDPLIGREHEVERVIQVLCRRRKNNPLLVGEAGVG 236

Query: 238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN 297
           KTAIAEG A +I  G VP++L  A++F+LDMG L+AGT+YRGDFE+R+K ++K+I    +
Sbjct: 237 KTAIAEGLAWRITRGEVPEVLQTAQVFALDMGALLAGTKYRGDFEQRLKGVLKQIRGNPD 296

Query: 298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR 357
           AIL+IDEIHTL+GAGSASG ++DASNLLKPALSSG ++CIG+TTY+E+R  FEKD AL R
Sbjct: 297 AILFIDEIHTLIGAGSASGGTLDASNLLKPALSSGQLKCIGATTYTEFRGVFEKDHALSR 356

Query: 358 RFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI 417
           RFQKIDV EPS+E  ++I++G+K  FEEHH +RYS  A+ AA +LS R+   R LPDKAI
Sbjct: 357 RFQKIDVPEPSVEQTVQILRGLKSRFEEHHNVRYSAAALSAAAELSARYINDRHLPDKAI 416

Query: 418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGT 477
           DVIDEAGA+Q L P S+++K I + +I+  ++ + R I   S S DD S L+ L+++L T
Sbjct: 417 DVIDEAGAAQRLLPRSRQKKVIGKGEIEHIVSKIAR-IPPQSVSNDDRSKLATLDRDLKT 475

Query: 478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLR 537
           VV+GQ+EAI  L+++IK+AR+GL  P+KPIG ++FSGPTGVGKTE+++QLAF +G++LLR
Sbjct: 476 VVFGQDEAISALTAAIKMARSGLGKPDKPIGAFLFSGPTGVGKTEVARQLAFTMGIELLR 535

Query: 538 FDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL 597
           FDMSEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ NILL
Sbjct: 536 FDMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKQPHCVLLLDEIEKAHPDIFNILL 595

Query: 598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP 657
           Q+MD+G LTD +G+K  FRNVILIMTTNAGA  +++  IGF + R    +   +R   +P
Sbjct: 596 QVMDHGTLTDNNGRKADFRNVILIMTTNAGAETLNRPAIGFANERVAGDEMAEIRRMFTP 655

Query: 658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVK 717
           EF NRLD+IIPF  LS +II +VV KF+M+LE QL E+ ++  F+E++ + L   G+D  
Sbjct: 656 EFRNRLDAIIPFSALSREIILRVVDKFLMQLEDQLHERRVAAVFTEKLRDHLAKEGFDPL 715

Query: 718 MGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNIS 777
           MGARP++R+I++ ++  LADE+LFGKL  GG    V+++ D +    + FE     S+ +
Sbjct: 716 MGARPMQRLIQDTIRRALADELLFGKLVDGG---NVTVDLDDAGKVVLGFEAPGKPSSNA 772

Query: 778 LETEEKEVED 787
            + +E E+ D
Sbjct: 773 ADKQEVELID 782


>gi|119476168|ref|ZP_01616520.1| ATP-binding protease component ClpA [marine gamma proteobacterium
           HTCC2143]
 gi|119450795|gb|EAW32029.1| ATP-binding protease component ClpA [marine gamma proteobacterium
           HTCC2143]
          Length = 759

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/751 (52%), Positives = 541/751 (72%), Gaps = 12/751 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S +LE+ L+QA   A  + HE+ T+EHLLLAL+D++ AA V+++C  DL  L+ +L++
Sbjct: 1   MLSNDLEQTLNQAFKGARTKRHEFMTVEHLLLALVDNALAADVLVACGADLSQLRADLVD 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D+ +    +     + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+FSE +S A
Sbjct: 61  FVDSTTPLIPEQDSERDTQPTLGFQRVLQRAVFHVQSSGKSEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL++Q +   D VN+++HGISK        ++  +D + + SD E    +   KT L+
Sbjct: 121 VYFLKQQSVARLDVVNYLTHGISK----VAGHTEPGLDHNESRSDDES-SGETPEKTPLD 175

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
                 ++  +L E+ +KG +D L+GR +E+ R  QIL RR KNNPL VG+ GVGKTAIA
Sbjct: 176 ------SFATNLNEEARKGHIDPLIGRSQEVERVAQILARRRKNNPLLVGESGVGKTAIA 229

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK IVDG VPD+L    ++SLD+G+L+AGT+YRGDFE+R K ++ +++   N+IL+I
Sbjct: 230 EGLAKMIVDGDVPDVLKEGVVYSLDLGSLLAGTKYRGDFEKRFKGLLADLQERDNSILFI 289

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DASNLLKP LSSG +RCIGSTT+ EYR  F+KDKAL RRFQKI
Sbjct: 290 DEIHTIIGAGAASGGVMDASNLLKPLLSSGKLRCIGSTTFQEYRGIFDKDKALSRRFQKI 349

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPS+E+   I+KG+K  FE+HH LRY+ +++ AA +LS R+   R LPDKAIDVIDE
Sbjct: 350 DVLEPSVEETYRILKGLKSRFEDHHDLRYNDKSLHAAAELSERYINDRFLPDKAIDVIDE 409

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q LQP SKR+K I   DI+  I+ + R I   S S +D   L  LE NL  VV+GQ
Sbjct: 410 AGAFQRLQPPSKRKKVIGVTDIEAVISKIAR-IPPKSVSTNDKESLKKLEDNLKMVVFGQ 468

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI  L+++IK+ARAGL    KPIG ++ +GPTGVGKTE++ QLA  LG++L+RFDMSE
Sbjct: 469 DKAISTLATAIKMARAGLKAVEKPIGSFLLAGPTGVGKTEVTNQLAKILGLELIRFDMSE 528

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L +SV ++P+SVVLLDEIEK+HP+V N+LLQ+MD+
Sbjct: 529 YMERHTVSRLIGAPPGYVGFDQGGLLTESVTKHPHSVVLLDEIEKAHPEVFNLLLQVMDH 588

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVI IMTTNAGA  +S+  +GF    N     EA+    +PEF NR
Sbjct: 589 GTLTDNNGRKADFRNVIFIMTTNAGAESVSRRSMGFTEQDNTTDAMEAINRLFTPEFRNR 648

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F  L  DI+  VV KF+++L+ QL +K ++ + S+E   WLV  GYD  MGARP
Sbjct: 649 LDAIVQFDALPEDIVLTVVDKFLVELQGQLDDKRVTLNISDEARLWLVRKGYDKNMGARP 708

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKV 753
           + R+I++++K PLA+++LFG L K GG+V +
Sbjct: 709 MTRVIQDYIKKPLAEKVLFGTLSKNGGIVDI 739


>gi|17547183|ref|NP_520585.1| ATP-dependent protease ATP-binding specificity subunit [Ralstonia
           solanacearum GMI1000]
 gi|17429485|emb|CAD16171.1| probable atp-dependent protease (atp-binding specificity subunit)
           protein [Ralstonia solanacearum GMI1000]
          Length = 762

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/779 (52%), Positives = 558/779 (71%), Gaps = 29/779 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ +L N
Sbjct: 1   MIAQELEVSLHMAFVEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRTHLKN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-ADNTPVVPGTDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI  RK+ A  +   + D +  G  G+G  +       
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGI--RKDQA--EPAKHGDSNPEGEAGDGKES------- 168

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L  +  +L    K GK+D L+GR +E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 169 -----PLEQFTQNLNALAKAGKIDPLIGREQEVERVVQVLCRRRKNNPLLVGEAGVGKTA 223

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  + ++SLDMG L+AGT+YRGDFE+R+K ++K ++   NAIL
Sbjct: 224 IAEGLAWRITKGEVPDILARSVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDNPNAIL 283

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSGA++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 284 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGALKCIGATTFTEYRGIFEKDAALSRRFQ 343

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EPSI+  ++I++G+K  FEEHH ++Y+  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 344 KIDVVEPSIDQTVQILRGLKSRFEEHHGVKYAASALTAAAELSARFITDRHLPDKAIDVI 403

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I+  ++ + R +   S S+DD S L  LE++L +VV+
Sbjct: 404 DEAGAAQRILPKSKQKKTIGKGEIEDIVSRIAR-VPPQSVSQDDRSKLQTLERDLKSVVF 462

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L+S+IK++RAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 463 GQDPAIDALASAIKMSRAGLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFILGIELIRFDM 522

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 523 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKKPHCVLLLDEIEKAHPDIFNILLQVM 582

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI++MTTNAGA  M+KA IGF ++R    +   ++   +PEF 
Sbjct: 583 DHGSLTDNNGRKADFRNVIIVMTTNAGAETMNKATIGFTTTREQGDEMADIKRMFTPEFR 642

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  DII +VV KF+M+LE QL EK +   F+E++  +L   G+D  MGA
Sbjct: 643 NRLDATISFRSLDEDIILRVVDKFLMQLEEQLHEKKVDAVFTEKLRRFLAKKGFDPLMGA 702

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGV---------VKVSLNPDKSASSPIFFEIE 770
           RP++R+I++ ++  LADE+LFGKL  GG V         VK+  + +++  +P   E E
Sbjct: 703 RPMQRLIQDMIRKALADELLFGKLVNGGKVAVDLDDADAVKLEFSENEAPPAPAQEEAE 761


>gi|171058347|ref|YP_001790696.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Leptothrix
           cholodnii SP-6]
 gi|170775792|gb|ACB33931.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Leptothrix
           cholodnii SP-6]
          Length = 766

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/777 (50%), Positives = 548/777 (70%), Gaps = 40/777 (5%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLLAL+D+  A+ V+ +C  +++ L+ +L  
Sbjct: 1   MIAQELEVSLHMAFVEARQQRHEFITVEHLLLALLDNPSASEVLRACAANIEDLRKSLAQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGI--VTGANILVALFSEPDS 120
           +I  ++   +     V+ +PT  FQRV+QRA++HVQSTG G   VTGAN+LVA+F E DS
Sbjct: 61  FIKENTPT-VGGTDEVDTQPTLGFQRVIQRAIMHVQSTGNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGI--------SKRKEFANFQSKLNVDGSSAGSDGEGFV 172
           HA Y+L +Q +T  D VNFI+HGI        +K  E ++       +G S GS      
Sbjct: 120 HAVYYLHQQGVTRLDVVNFIAHGIKKSDPPEPTKSNESSSSSDGEKEEGDSKGS------ 173

Query: 173 NDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVG 232
                         L  Y  +L +  ++G++D L+GR  E+ R IQ+LCRR KNNPL VG
Sbjct: 174 -------------PLDQYTQNLNQAAREGRIDPLIGREHEVERVIQVLCRRRKNNPLLVG 220

Query: 233 DPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEI 292
           + GVGKTAIAEG A +I +G VP++L  + ++SLDMG L+AGT+YRGDFE+R+K ++K++
Sbjct: 221 EAGVGKTAIAEGLAWRITEGDVPEVLADSTVYSLDMGALLAGTKYRGDFEQRLKGVLKQL 280

Query: 293 ESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKD 352
           + + +AIL+IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD
Sbjct: 281 KEHPHAILFIDEIHTLIGAGAASGGTLDASNLLKPALSSGQIKCIGATTFTEYRGIFEKD 340

Query: 353 KALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKL 412
            AL RRFQK+DV+EP++E  +EI+KG+K  FEEHH ++Y   A++AA +LS +    R L
Sbjct: 341 AALSRRFQKVDVAEPTVEQTVEILKGLKSRFEEHHSVKYELGALQAAAELSAKFINDRHL 400

Query: 413 PDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLE 472
           PDKAIDVIDEAGA+Q + P SK++K IT  +++  +A + R I   S S DD S L +L+
Sbjct: 401 PDKAIDVIDEAGAAQRILPKSKQKKKITRAEVEDIVAKIAR-IPPASVSSDDRSKLKSLD 459

Query: 473 KNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALG 532
           ++L +VV+GQ+ AI  LS +IK+AR+GL  P KPIG ++FSGPTGVGKTE++KQLA+ LG
Sbjct: 460 RDLKSVVFGQDGAIDALSGAIKMARSGLGKPEKPIGAFLFSGPTGVGKTEVAKQLAYILG 519

Query: 533 VQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDV 592
           + L+RFDMSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPDV
Sbjct: 520 IDLIRFDMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDV 579

Query: 593 LNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALR 652
            N+LLQ+MD+G LTD +G+K  FRNVI++MTTNAGA  M KA IGF S R    +   ++
Sbjct: 580 FNVLLQVMDHGTLTDNNGRKADFRNVIIVMTTNAGAETMQKATIGFTSHRETGDEMGDIK 639

Query: 653 NFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSH 712
              +PEF NRLD+I+ F  L  +II +VV KF+++LE QL EK +   F++ +   L   
Sbjct: 640 RMFTPEFRNRLDAIVSFRALDEEIIMRVVDKFLLQLEGQLGEKKVDVTFTDAIRKHLAKK 699

Query: 713 GYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGG---------GVVKVSLNPDKS 760
           G+D  MGARP++R+I++ ++  LADE+LFG+L  GG         GVV++ + P KS
Sbjct: 700 GFDPLMGARPMQRLIQDTIRRALADELLFGRLTDGGRLTVDIDSEGVVQLDIEPRKS 756


>gi|254786020|ref|YP_003073449.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Teredinibacter
           turnerae T7901]
 gi|237685501|gb|ACR12765.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Teredinibacter
           turnerae T7901]
          Length = 766

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/744 (52%), Positives = 533/744 (71%), Gaps = 15/744 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE  L+ A   A  + HE+ T+EHLLLAL+D+  AA V+ +C  DL +L+ +L  
Sbjct: 1   MLSKELEATLNNAFKGARSKRHEFMTVEHLLLALLDNESAASVLRACGADLGILRRDLSE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D  +    +     E +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+FSE +S A
Sbjct: 61  FVDTTTPLIPETDKERETQPTLGFQRVLQRAVFHVQSSGKNEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSD--GEGFVNDYQAKTD 180
            Y+L++Q +   D VNFI+HGISK            V GS+  +D   E    +     +
Sbjct: 121 VYYLKQQSIARIDVVNFITHGISK------------VSGSNPHADHGSEQMDEEVTGTGE 168

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L ++  +L E+ +KG++D LVGR  E+ R IQIL RR KNNPL VG+ GVGKTA
Sbjct: 169 GGQTNPLESFATNLNEQAQKGRIDPLVGRDYEVERVIQILARRRKNNPLLVGESGVGKTA 228

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG AK+I+D  VP++L  + ++SLD+G+L+AGT+YRGDFE+R K ++ E++    A+L
Sbjct: 229 IAEGLAKKIIDKEVPEVLENSVVYSLDLGSLLAGTKYRGDFEKRFKGLLAELKKREGAVL 288

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ASG  +DASNLLKP L+SG +RCIGSTT+ EYR  F+KD+AL RRFQ
Sbjct: 289 FIDEIHTIIGAGAASGGVMDASNLLKPLLTSGDLRCIGSTTFQEYRGIFDKDRALSRRFQ 348

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EPS++D  +I+KG+K  FE+HH L+Y+  A+++A +L+ ++ + R +PDKAIDVI
Sbjct: 349 KIDVNEPSVDDTYKILKGLKSRFEKHHNLKYTDTALKSASELAAKYISDRFMPDKAIDVI 408

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA Q LQP SKR+K I  KDI+  IA + R +   + +  D  +LS LE  L   V+
Sbjct: 409 DEAGAYQQLQPESKRKKIIGVKDIENIIAKIAR-VPAKTVTSSDKELLSKLEDTLRMTVF 467

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQEEAI  +SS+IK+ RAGL++ +KPIG ++F+GPTGVGKTE+ KQLA A+GV+L+RFDM
Sbjct: 468 GQEEAISAISSAIKLNRAGLTNHDKPIGSFLFAGPTGVGKTELCKQLASAMGVELVRFDM 527

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D+V + P+ VVLLDEIEK+HPDV N+LLQ+M
Sbjct: 528 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVTKQPHCVVLLDEIEKAHPDVFNLLLQVM 587

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+   FRN++LIMTTNAGA  MS+  IGF    +     EA++   +PEF 
Sbjct: 588 DHGTLTDNNGRAADFRNIVLIMTTNAGAETMSRTSIGFTQQDHTTDGMEAIKRAFTPEFR 647

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDSII F  LS ++++ VV KF+M+L+ QL +K I+   ++E   WL  +GYD KMGA
Sbjct: 648 NRLDSIIQFGSLSLEVVKTVVDKFLMELQHQLDDKKITLEVTDEAREWLAVNGYDEKMGA 707

Query: 721 RPLERIIKEHVKVPLADEILFGKL 744
           RP+ RII++ VK PLA+ +LFG+L
Sbjct: 708 RPMARIIQDMVKKPLAEMLLFGEL 731


>gi|295677448|ref|YP_003605972.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           sp. CCGE1002]
 gi|295437291|gb|ADG16461.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           sp. CCGE1002]
          Length = 765

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/784 (51%), Positives = 562/784 (71%), Gaps = 21/784 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K           + D + A SD     ++  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTS---------SSDAAKA-SDANAESDEAAAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A+++SLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAWRITRGEVPDILADAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EP++E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKNEIEEIISKIAR-VPAQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  LS++IK+ARAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALSAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVAKQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M K+ IGF + R    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAEAMGKSVIGFTNRREAGDEMVDIKRMFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F++ +   L  HG+D  MGA
Sbjct: 645 NRLDATISFRALDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RP++R+I++ ++  LADE+LFGKL  GG   +V+++ D      + F+   +  N + E 
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLMNGG---RVTVDVDADDKVQLTFDEHPAPRNPNPEA 761

Query: 781 EEKE 784
            E E
Sbjct: 762 VEVE 765


>gi|166712084|ref|ZP_02243291.1| ATP-dependent Clp protease subunit [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 760

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/748 (52%), Positives = 535/748 (71%), Gaps = 14/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE+ + Q    A E  HE+ T+EHLLL+L+D+  A  V+ +C  D   L  +L  
Sbjct: 1   MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLSLLDNPSAQAVLKACGADQVRLHTDLEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL +Q++T  D VN++SHGI+K          L  DG    +      +  +      
Sbjct: 120 VYFLNQQDITRLDIVNYLSHGIAK----------LGEDGEQPSA--PDGESKGEGGEGEV 167

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ +  +L E+ + G++D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 168 KGDALAEFATNLNEQARNGRIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVD  VP++L  A IFSLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 228 EGLAKRIVDNDVPEVLADAVIFSLDLGALVAGTKYRGDFEKRLKSVLAALKKVPNAVLFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPALSSG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGTMDASNLIKPALSSGELRCIGSTTFQEYRGIFEKDRALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+KP +E HH + Y+ +A++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 348 DIVEPTVGETFEILQGLKPKYEAHHGVTYADDALQAAVDLSVKHIGDRLLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P   R++ I  ++I+  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 408 AGARQRLLPEGVRKELIDIEEIEIIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
             AI+ L+ SIK+AR+GL++P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 NPAIETLAGSIKLARSGLANPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDE+EK+HPD+ NILLQ+MD 
Sbjct: 527 YMEAHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDR 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           GILTD +G++ +F+NVIL+MTTNAGA + S+  IGF    +     E++R   +PEF NR
Sbjct: 587 GILTDTNGREANFKNVILVMTTNAGATQASRRSIGFTKQDHSTDAMESIRRGFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+I+ F PL  D I +VV KFI++LE+ LQEK +S   +    +WL  HG+D  MGARP
Sbjct: 647 LDAIVQFQPLGFDHILRVVDKFIIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I+E VK PLADE+LFGKL  GG V
Sbjct: 707 MSRVIQEKVKRPLADELLFGKLVDGGRV 734


>gi|258621689|ref|ZP_05716720.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Vibrio
           mimicus VM573]
 gi|262171822|ref|ZP_06039500.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Vibrio mimicus
           MB-451]
 gi|258585920|gb|EEW10638.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Vibrio
           mimicus VM573]
 gi|261892898|gb|EEY38884.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Vibrio mimicus
           MB-451]
          Length = 755

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/759 (52%), Positives = 539/759 (71%), Gaps = 16/759 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A ++ HE+ T+EHLLLAL+++  A   +L+C  D+ VL+  L  
Sbjct: 1   MLNKELESSLNGAFARARDKRHEFMTVEHLLLALLENDAAREALLACQADIDVLRRELDT 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +    KN    E +PT SFQRV+QRAV HVQS+GR  VTGAN+LVA+FSE +SHA
Sbjct: 61  FIDQTTPLIPKNDETRETQPTLSFQRVLQRAVFHVQSSGRSEVTGANVLVAIFSEQESHA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L++ +++  D VNFISHGI+K        S  N D SS     + F ND  +  +++
Sbjct: 121 AYLLKKNDISRLDIVNFISHGITK-------ASNQNEDSSS-----DSFGND--SSEEVS 166

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L ++  +L +  K+G++D L+GR +E+ RTIQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 167 ADERLESFATNLNQLAKQGQIDPLIGRDKELERTIQVLCRRRKNNPLLVGEAGVGKTAIA 226

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +IV+G VP+++  + I+SLD+G+L+AGT+YRGDFE+R K I+K++E   +AIL+I
Sbjct: 227 EGLAWRIVEGNVPEVIQRSVIYSLDIGSLLAGTKYRGDFEKRFKSILKQLEKEKDAILFI 286

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  VDA+NL+KP LSSG +RCIGSTTY EY   FEK++AL RRFQKI
Sbjct: 287 DEIHTIIGAGAASGGQVDAANLIKPLLSSGKLRCIGSTTYQEYSNIFEKERALSRRFQKI 346

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EPS++D  +I+ G+K  +E HH +RY+ +A+RAAV+LS ++   R LPDKAIDVIDE
Sbjct: 347 DIVEPSLDDTTKILMGLKTKYEAHHDVRYTNKALRAAVELSAKYINERHLPDKAIDVIDE 406

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA   L P S+R+K +   +I+  +A M R I   S S  D  +L NL+K +  +V+GQ
Sbjct: 407 AGARARLMPASRRKKTVGVAEIESMVAKMAR-IPEKSVSSSDKDILKNLDKQMKMLVFGQ 465

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI  L+ SIK+ RAGL   +KP+G ++F+GPTGVGKTE++ QL+  LG++LLRFDMSE
Sbjct: 466 DTAIDVLTESIKLTRAGLGAEHKPVGSFLFAGPTGVGKTEVTLQLSKLLGIELLRFDMSE 525

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           Y ERH+VSRLIGAPPGYVG+ QGG+L D+V ++P+SVVLLDEIEK+HPD+ N+LLQ+MD 
Sbjct: 526 YGERHSVSRLIGAPPGYVGYDQGGLLTDAVIKHPHSVVLLDEIEKAHPDIFNLLLQVMDN 585

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVIL+MTTNAG  E  K  IG     N       ++   +PEF NR
Sbjct: 586 GTLTDNNGRKADFRNVILVMTTNAGVAETVKKSIGLIQQDNSHDAMSEIKKVFTPEFRNR 645

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD II F  L   +I QVV KFI++L+ QL  +G+S   SE+  +WL   GYD +MGARP
Sbjct: 646 LDHIIWFNSLDERVIHQVVDKFIVELQAQLDARGVSLEVSEDARHWLAVKGYDREMGARP 705

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSA 761
           + R+I+E +K PLA+E+LFG L   GG VKVSL+ D+ A
Sbjct: 706 MGRVIQEQLKKPLANELLFGSL-VNGGTVKVSLSDDRLA 743


>gi|300690671|ref|YP_003751666.1| ATP-dependent Clp protease ATP-binding subunit clpA [Ralstonia
           solanacearum PSI07]
 gi|299077731|emb|CBJ50369.2| ATP-dependent Clp protease ATP-binding subunit clpA [Ralstonia
           solanacearum PSI07]
          Length = 762

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/751 (53%), Positives = 547/751 (72%), Gaps = 20/751 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ +L N
Sbjct: 1   MIAQELEVSLHMAFVEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRTHLKN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-ADNTPVVPGTDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI K +     +   + D +  G  G+G  +       
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIRKDQA----EPAKHGDSNPEGEAGDGKES------- 168

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L  +  +L    K GK+D L+GR +E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 169 -----PLEQFTQNLNALAKAGKIDPLIGREQEVERVVQVLCRRRKNNPLLVGEAGVGKTA 223

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  + ++SLDMG L+AGT+YRGDFE+R+K ++K ++   NAIL
Sbjct: 224 IAEGLAWRITKGEVPDILARSVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDNPNAIL 283

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSGA++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 284 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGALKCIGATTFTEYRGIFEKDAALSRRFQ 343

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EPS++  ++I++G+K  FEEHH +RY+  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 344 KIDVVEPSVDQTVQILRGLKSRFEEHHGVRYAAAALTAAAELSARFITDRHLPDKAIDVI 403

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ ++ + R +   S S+DD S L  LE++L +VV+
Sbjct: 404 DEAGAAQRILPKSKQKKTIGKGEIEEIVSRIAR-VPPQSVSQDDRSKLQTLERDLKSVVF 462

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQE AI  L+S+IK++RAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 463 GQEPAIDALASAIKMSRAGLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFILGIELIRFDM 522

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 523 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKKPHCVLLLDEIEKAHPDIFNILLQVM 582

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M+KA IGF ++R    +   ++   +PEF 
Sbjct: 583 DHGALTDNNGRKADFRNVIIIMTTNAGAETMNKATIGFTTAREQGDEMADIKRMFTPEFR 642

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F+E++  +L   G+D  MGA
Sbjct: 643 NRLDATISFRSLDEEIILRVVDKFLMQLEEQLHEKKVDAIFTEKLRRFLAKKGFDPLMGA 702

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           RP++R+I++ ++  LADE+LFGKL  GG VV
Sbjct: 703 RPMQRLIQDLIRKALADELLFGKLVNGGKVV 733


>gi|300310731|ref|YP_003774823.1| ATP-dependent protease ATP-binding specificity subunit
           [Herbaspirillum seropedicae SmR1]
 gi|300073516|gb|ADJ62915.1| ATP-dependent protease (ATP-binding specificity subunit) protein
           [Herbaspirillum seropedicae SmR1]
          Length = 767

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/751 (52%), Positives = 540/751 (71%), Gaps = 18/751 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  HE+ T+EHLLLAL+D+  AA V+ +C+V++  L+  L N
Sbjct: 1   MIAQELEVSLHMAFVEARQSRHEFITVEHLLLALLDNPSAAEVLRACSVNIDDLRKTLTN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQS   G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-TDNTPTVPGTNEVDTQPTLGFQRVIQRAIMHVQSASNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+L +Q +T  D VNFISHG+ K ++          D   A    E    D QA+  
Sbjct: 120 HAVYYLHQQGVTRLDVVNFISHGVRKDQQ---------ADPQKAPEGAE----DVQAEGQ 166

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
               P L  +  +L +   +GK+D L+GR  E+ R IQ LCRR KNNPL VG+ GVGKTA
Sbjct: 167 QKESP-LDQFTQNLNKAAAEGKIDPLIGRESEVERVIQTLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A ++  G VP+IL  A ++SLDMG L+AGT+YRGDFE+R+K ++K+++   N IL
Sbjct: 226 IAEGLAWRVTQGDVPEILKNAVVYSLDMGALLAGTKYRGDFEQRLKAVLKQLKDSPNGIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAGSASG ++DASNLLKPALSSG ++CIG+TTY+E+R  FEKD AL RRFQ
Sbjct: 286 FIDEIHTIIGAGSASGGTLDASNLLKPALSSGQLKCIGATTYTEFRGVFEKDHALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV+EP++E  ++I++G+K  FEEHH ++YS  A+ +A +L+ R    R LPDKAIDVI
Sbjct: 346 KIDVNEPTVEQTVQILRGLKSKFEEHHGVKYSASALTSAAELAARFINDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R I   S ++DD + L  ++++L  VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKPEIEEIISKIAR-IPPQSVNQDDRAKLQTIDRDLKNVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ LSS+IK+ARAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 465 GQDPAIEALSSAIKMARAGLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFILGIELVRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V++ P++V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVNKKPHAVLLLDEIEKAHPDIFNILLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  + K  IGF   +    +   ++   +PEF 
Sbjct: 585 DHGTLTDNNGRKTDFRNVIIIMTTNAGAESLQKRTIGFTEKKEAGDEMADIKRMFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F PL  +II +VV KF+M+LE QL EK +   FS+ +  +L   G+D  MGA
Sbjct: 645 NRLDAIISFRPLDEEIILRVVDKFLMQLEEQLHEKKVEAVFSDSLRKFLGKKGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           RP+ R+I++ ++  LADE+LFGKL  GG V 
Sbjct: 705 RPMSRLIQDLIRKALADELLFGKLVSGGRVT 735


>gi|315179861|gb|ADT86775.1| ATP-dependent Clp protease ATP-binding subunit [Vibrio furnissii
           NCTC 11218]
          Length = 755

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/757 (51%), Positives = 536/757 (70%), Gaps = 16/757 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A ++ HE+ T+EHLLLAL+++  A   +L+C  D+ +L+  L  
Sbjct: 1   MLNKELESSLNGAFARARDKRHEFMTVEHLLLALLENDAAKEALLACQADIDILRRELDT 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +    +N    E +PT SFQRV+QRAV HVQS+GR  VTGAN+LVA+FSE +SHA
Sbjct: 61  FIDQTTPLIPENDETRETQPTLSFQRVLQRAVFHVQSSGRSEVTGANVLVAIFSEQESHA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L++ +++  D VN+ISHGI+K               SS+G +        ++  +++
Sbjct: 121 AYLLKKNDISRLDIVNYISHGITK--------------ASSSGDESSPDSFGTESGEEIS 166

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L ++  +L    K+G++D L+GR +E+ RTIQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 167 ADERLESFATNLNNLAKQGQIDPLIGRDKELERTIQVLCRRRKNNPLLVGEAGVGKTAIA 226

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +IV+G VP+++  + I+SLD+G+L+AGT+YRGDFE+R K I+K++E   +AIL+I
Sbjct: 227 EGLAWRIVEGQVPEVIQDSVIYSLDIGSLLAGTKYRGDFEKRFKSILKQLEKEKDAILFI 286

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  VDA+NL+KP LSSG +RCIGSTTY EY   FEK++AL RRFQKI
Sbjct: 287 DEIHTIIGAGAASGGQVDAANLIKPLLSSGKLRCIGSTTYQEYSNIFEKERALSRRFQKI 346

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EPS++D  +I+ G+KP +E HH +RY+KEA+RAAV+LS ++   R LPDKAIDVIDE
Sbjct: 347 DIVEPSLDDTTKILMGLKPKYEAHHDVRYTKEALRAAVELSAKYINERHLPDKAIDVIDE 406

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA   L P S+R+K +   DI+  +A M R I   S S  D  +L NL++ +  +V+GQ
Sbjct: 407 AGARVRLLPASRRKKTVGVADIEAMVAKMAR-IPEKSVSSSDKDILKNLDQKMKMLVFGQ 465

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI  LS SIK+ RAGL   N+P+G ++F+GPTGVGKTE++ QL+  LG++LLRFDMSE
Sbjct: 466 DNAIDVLSESIKLTRAGLGSDNRPVGSFLFAGPTGVGKTEVTVQLSKLLGIELLRFDMSE 525

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           Y ERH+VSRLIGAPPGYVGF QGG+L D+V ++P+SVVLLDEIEK+HPD+ N+LLQ+MD 
Sbjct: 526 YGERHSVSRLIGAPPGYVGFDQGGLLTDAVIKHPHSVVLLDEIEKAHPDIFNLLLQVMDN 585

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVIL+MTTNAG  E  K  IG     +       ++   +PEF NR
Sbjct: 586 GTLTDNNGRKADFRNVILVMTTNAGVAETVKKSIGMIQQDHSHDAMAEIKKVFTPEFRNR 645

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD II F  L   +I QVV KFI++L++QL  +G+S   SE+  +WL   GYD  MGARP
Sbjct: 646 LDHIIWFNALDERVIHQVVDKFIVELQVQLDARGVSLEVSEDARHWLAVRGYDRDMGARP 705

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           + R+I+E +K PLA+E+LFG L   GG VKV+LN D+
Sbjct: 706 MGRVIQEQLKKPLANELLFGSLVD-GGTVKVNLNDDQ 741


>gi|88703372|ref|ZP_01101088.1| ATP-dependent clp protease, ATP-binding subunit ClpA
           [Congregibacter litoralis KT71]
 gi|88702086|gb|EAQ99189.1| ATP-dependent clp protease, ATP-binding subunit ClpA
           [Congregibacter litoralis KT71]
          Length = 765

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/770 (52%), Positives = 543/770 (70%), Gaps = 13/770 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE+ L+ A   A  R HE+ T+EHLLLAL+D++DA  V+ +C  +L  L+ +L+ 
Sbjct: 1   MLSKELEQTLNDAFRSARSRRHEFMTVEHLLLALLDNNDAIRVLKACGAELSALRGDLVE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID+ +    +     E +PT  FQRV+QRAV HVQS+GR  V+GAN+LVA+FSE +S A
Sbjct: 61  FIDSTTPLIPEEEQERETQPTLGFQRVLQRAVFHVQSSGRSEVSGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL+ Q ++  D VN+I+HGISK  E  +  +       + G+  EG  N         
Sbjct: 121 VYFLKTQSVSRLDVVNYITHGISKVDEGEDSGASEPEGERTEGAAEEGESN--------- 171

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L ++  +L E+ ++G++D L+GR  E+ R IQ+L RR KNNPL VG+ GVGKTAIA
Sbjct: 172 ---PLDSFATNLNEEAREGRIDPLIGRSAEVERVIQVLARRRKNNPLLVGESGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK I DG VP++L GA ++SLD+G+L+AGT+YRGDFE+R K ++ E++    A+L+I
Sbjct: 229 EGLAKLIEDGDVPEMLKGAEVYSLDLGSLLAGTKYRGDFEKRFKGLLAELKRREGAVLFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DASNLLKP L+SG +RCIGSTT+ EYR  F+KDKAL RRFQKI
Sbjct: 289 DEIHTIIGAGAASGGVMDASNLLKPLLTSGRLRCIGSTTFQEYRGIFDKDKALSRRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPS +DA +I+KG+K  FEEHH LRY+ +A+R A  LS R+ T R LPDKAIDVIDE
Sbjct: 349 DVMEPSTDDAYKILKGLKSRFEEHHGLRYTDQALRVATDLSARYITDRFLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q LQ  SKR+K + + D++  +A + R I   S +R+D  VL  LE NL  VV+GQ
Sbjct: 409 AGAFQQLQAPSKRKKVVGKHDVEAVVAKIAR-IPPKSVNRNDKDVLLKLESNLKMVVFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++A+  LS+SIK+ARAGL   +KPIG ++ +GPTGVGKTE+++QLA  LG++L+RFDMSE
Sbjct: 468 DDAVSSLSTSIKMARAGLRGGDKPIGSFLLAGPTGVGKTEVTRQLAKILGLELIRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L D+  ++P++VVLLDEIEK+HP+V N+LLQ+MD+
Sbjct: 528 YMERHTVSRLIGAPPGYVGFDQGGLLTDAATKHPHAVVLLDEIEKAHPEVFNLLLQVMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRN+IL+MTTNAGA  +S+  IGF +  +     EA+    +PEF NR
Sbjct: 588 GTLTDNNGRKADFRNIILVMTTNAGAETISRRSIGFTAQDHSTDGMEAISRMFTPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LDSI+ F PL  D+I  VV KF+ +L+ QL EK I+    E+   WLV  GYD  MGARP
Sbjct: 648 LDSIVQFQPLGEDVILTVVDKFLAELQGQLDEKRITLDVDEDARLWLVEKGYDQHMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENS 772
           ++R+I++H+K PLA+ +LFG L   GG   V LN D         E E+S
Sbjct: 708 MDRVIQDHIKKPLAEMVLFGALSNSGGTALVRLNADGDGLEVTVPEAEDS 757


>gi|332110107|gb|EGJ10735.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rubrivivax
           benzoatilyticus JA2]
          Length = 770

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/779 (50%), Positives = 551/779 (70%), Gaps = 33/779 (4%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLL+AL+D+  AA V+ +C  +++ L+ +L  
Sbjct: 1   MIAQELEVSLHMAFVEARQQRHEFITVEHLLMALLDNPSAAEVLRACAANIEDLRKSLAT 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGI--VTGANILVALFSEPDS 120
           +I  ++   +     V+ +PT  FQRV+QRA++HVQSTG G   VTGAN+LVA+F E DS
Sbjct: 61  FIKENTPT-VSGSEEVDTQPTLGFQRVIQRAIMHVQSTGSGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSS------AGSDGEGFVND 174
           HA Y+L +Q +T  D VNFI+HGI K       +S  N  G        AG +G+G    
Sbjct: 120 HAVYYLHQQGVTRLDVVNFIAHGIKKSDPPEPAKSSDNTPGGGEGERDEAGGEGKG---- 175

Query: 175 YQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDP 234
                       L  +  +L      GK+D L+GR +E+ R IQ+LCRR KNNPL VG+ 
Sbjct: 176 ----------SPLEQFTQNLNALALAGKIDPLIGREQEVERVIQVLCRRRKNNPLLVGEA 225

Query: 235 GVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES 294
           GVGKTAIAEG A +I +  VP++L  + +++LDMG L+AGT+YRGDFE+R+K ++K+++ 
Sbjct: 226 GVGKTAIAEGLAWRITEKDVPEVLADSTVYALDMGALLAGTKYRGDFEQRLKGVLKQLKD 285

Query: 295 YANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKA 354
             +AIL+IDEIHTL+GAG+ASG ++DASNLLKPALSSG+++CIG+TT++EYR  FEKD A
Sbjct: 286 QPSAILFIDEIHTLIGAGAASGGTLDASNLLKPALSSGSMKCIGATTFTEYRGIFEKDAA 345

Query: 355 LVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD 414
           L RRFQK+DV EPS+E  IEI+KG+K  FE+HH ++Y+  A++AA +LS ++   R LPD
Sbjct: 346 LSRRFQKVDVVEPSVEQTIEILKGLKSRFEDHHNVKYALGALQAAAELSAKYINDRHLPD 405

Query: 415 KAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKN 474
           KAIDVIDEAGA+Q + P SK++K IT  +++  +A + R I   S S DD   L  LE++
Sbjct: 406 KAIDVIDEAGAAQRILPKSKQKKTITRAEVEDIVAKIAR-IPPASVSSDDRDKLKTLERD 464

Query: 475 LGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQ 534
           L +VV+GQ+ +I+ L+S+IK+AR+GL  P+KPIG ++FSGPTGVGKTE++KQLA+ LG++
Sbjct: 465 LKSVVFGQDPSIEALASAIKMARSGLGKPDKPIGSFLFSGPTGVGKTEVAKQLAYILGIE 524

Query: 535 LLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLN 594
           L+RFDMSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P++V+LLDEIEK+HPDV N
Sbjct: 525 LIRFDMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHAVLLLDEIEKAHPDVFN 584

Query: 595 ILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNF 654
           +LLQ+MD+G LTD +G+K  FRNVI+IMTTNAGA  M+K+ IGF + R    +   ++  
Sbjct: 585 VLLQVMDHGTLTDNNGRKADFRNVIIIMTTNAGAETMNKSTIGFTTRREQGDEMADIKRL 644

Query: 655 LSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGY 714
            +PEF NRLD+I+ F  L  +II +VV KF+++LE QL EK +   F++++   L   G+
Sbjct: 645 FTPEFRNRLDAIVSFRALDEEIILRVVDKFLLQLESQLAEKKVEVTFTDKLRRHLSKKGF 704

Query: 715 DVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGV---------VKVSLNPDKSASSP 764
           D  MGARP++R+I++ ++  LADE+LFG+L  GG +         V + + P K +  P
Sbjct: 705 DPLMGARPMQRLIQDMIRRALADELLFGRLVDGGRLTVDLDDKDEVLLDIQPPKRSDKP 763


>gi|33593713|ref|NP_881357.1| ATP-dependent Clp protease ATP-binding [Bordetella pertussis Tohama
           I]
 gi|33563786|emb|CAE43028.1| ATP-dependent clp protease ATP-binding [Bordetella pertussis Tohama
           I]
          Length = 771

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/789 (51%), Positives = 558/789 (70%), Gaps = 22/789 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE  LH A V A    HE+ T+EHLLL+L+D++ A  V+ +C  +L  L+ NL  
Sbjct: 1   MISQELEVSLHMAFVEARSARHEFITVEHLLLSLLDNASAVEVLRACAANLDDLRRNLRQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQS--TGRGIVTGANILVALFSEPDS 120
           ++  ++         V+ +PT  FQRV+QRA++HV +  TG+  VTGAN+LVA+F E DS
Sbjct: 61  FVTENTPVIPSGAAEVDTQPTLGFQRVIQRAIMHVSAGGTGKKPVTGANVLVAIFGEKDS 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKR--KEFANFQSKLNVDGSSAGSDGEGFVNDYQAK 178
           HA Y+LQ+Q +T  D VNF+SHGI+K+  +E +    +    G   G++           
Sbjct: 121 HAVYYLQQQGVTRLDVVNFLSHGITKQPQEESSALPKEQQASGEEPGAESRQ-------- 172

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                   L  Y  DL      G++D L+GR  E+ R IQ+LCRR KNNPL VG+ GVGK
Sbjct: 173 ------SPLDQYANDLNAAALAGRIDPLIGREHEVERVIQVLCRRRKNNPLLVGEAGVGK 226

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A +I  G VP++L  A++F+LDMG L+AGT+YRGDFE+R+K ++K+I    +A
Sbjct: 227 TAIAEGLAWRITRGEVPEVLQTAQVFALDMGALLAGTKYRGDFEQRLKGVLKQIRGNPDA 286

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHTL+GAGSASG ++DASNLLKPALSSG ++CIG+TTY+E+R  FEKD AL RR
Sbjct: 287 ILFIDEIHTLIGAGSASGGTLDASNLLKPALSSGQLKCIGATTYTEFRGVFEKDHALSRR 346

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKIDV EPS+E  ++I++G+K  FEEHH +RYS  A+ AA +LS R+   R LPDKAID
Sbjct: 347 FQKIDVPEPSVEQTVQILRGLKSRFEEHHNVRYSAAALSAAAELSARYINDRHLPDKAID 406

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDEAGA+Q L P S+++K I + +I+  ++ + R I   S S DD S L+ L+++L TV
Sbjct: 407 VIDEAGAAQRLLPRSRQKKVIGKGEIEHIVSKIAR-IPPQSVSNDDRSKLATLDRDLKTV 465

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ+EAI  L+++IK+AR+GL  P+KPIG ++FSGPTGVGKTE+++QLAF +G++LLRF
Sbjct: 466 VFGQDEAIGALTAAIKMARSGLGKPDKPIGAFLFSGPTGVGKTEVARQLAFTMGIELLRF 525

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ NILLQ
Sbjct: 526 DMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKQPHCVLLLDEIEKAHPDIFNILLQ 585

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +G+K  FRNVILIMTTNAGA  +++  IGF + R    +   +R   +PE
Sbjct: 586 VMDHGTLTDNNGRKADFRNVILIMTTNAGAEILNRPAIGFANERVAGDEMAEIRRMFTPE 645

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+IIPF  LS +II +VV KF+M+LE QL E+ ++  F+E++ + L   G+D  M
Sbjct: 646 FRNRLDAIIPFSALSREIILRVVDKFLMQLEDQLHERRVAAVFTEKLRDHLAKEGFDPLM 705

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISL 778
           GARP++R+I++ ++  LADE+LFGKL  GG    V+++ D +    + FE     S+ + 
Sbjct: 706 GARPMQRLIQDTIRRALADELLFGKLVDGG---NVTVDLDDAGKVVLGFEAPGKPSSNAA 762

Query: 779 ETEEKEVED 787
           + +E E+ D
Sbjct: 763 DKQEVELID 771


>gi|253997307|ref|YP_003049371.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylotenera
           mobilis JLW8]
 gi|253983986|gb|ACT48844.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Methylotenera
           mobilis JLW8]
          Length = 757

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/748 (52%), Positives = 540/748 (72%), Gaps = 19/748 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A ++ HE  T+EHLLLA+ID+  AA V+ +C   L+ L+  L  
Sbjct: 1   MIAQELEVSLHMAFMDARQKRHELITVEHLLLAMIDNPTAAEVLRACGAKLETLRTELNQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           YI+  +   +     V+ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  YIEEHTPTVIGQD-DVDTQPTLGFQRVIQRAMLHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            +FL +Q +T  D VNFISHG+SK                  G   +    + +A+ +  
Sbjct: 120 VFFLHQQGITRLDIVNFISHGVSK-----------------IGETAKPEGGEQEAEAEAA 162

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL  Y ++L  +V  GK+D L+GR  E+ R +Q LCRR KNNPL VG+ GVGKTAIA
Sbjct: 163 PNGALENYTLNLNSQVLAGKIDPLIGRASELERVVQTLCRRRKNNPLLVGEAGVGKTAIA 222

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++IV+  +PD+L  A ++SLDMG L+AGT+YRGDFE+R+K ++K++E   +AIL+I
Sbjct: 223 EGLARRIVEKDIPDVLANAVVYSLDMGALLAGTKYRGDFEQRLKAVMKQLEEKPDAILFI 282

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAGSASG ++DASNLLKPALS+G+++CIG+TTY EYR  FEKD AL RRFQK+
Sbjct: 283 DEIHTLIGAGSASGGTLDASNLLKPALSNGSLKCIGATTYQEYRGIFEKDHALSRRFQKV 342

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPS+ + IEI+KG+K  FE HH ++Y+  A+  A +LS ++   R LPDKAIDVIDE
Sbjct: 343 DVVEPSVAETIEILKGLKSRFETHHSVKYTAAALTTAAELSAKYINDRHLPDKAIDVIDE 402

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P SK++K I  K+I+  IA + R I   + S DD + L  LE++L  VV+GQ
Sbjct: 403 AGAAQRILPKSKQKKVIGNKEIEDIIAKVAR-IPPKNISSDDRNALKTLERDLKAVVFGQ 461

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ LSS++K+AR+GL   NKPIG ++FSGPTGVGKTE++KQLA+ +G++L+RFDMSE
Sbjct: 462 DKAIEALSSAVKMARSGLGQNNKPIGSFLFSGPTGVGKTEVAKQLAYIMGIELIRFDMSE 521

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRLIGAPPGYVGF QGG++ +++ ++PY V+LLDEIEK+HPD+ NILLQ+MD+
Sbjct: 522 YMERHAVSRLIGAPPGYVGFEQGGLMTEAITKHPYCVLLLDEIEKAHPDIFNILLQVMDH 581

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNV +IMTTNAGA  +SK+ +GF +++    ++  ++   SPEF NR
Sbjct: 582 GTLTDNNGRKADFRNVTIIMTTNAGAESLSKSNMGFTTAKQAGDEQADIKRLFSPEFRNR 641

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+ + F  LS DII +VV KF+++LE QL EK +   FS+ +  +L   G+D +MGARP
Sbjct: 642 LDATVSFTALSHDIIIRVVDKFLIQLEDQLHEKKVEATFSDALKTYLGKKGFDPQMGARP 701

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I++ ++  LADE+LFGKL  GG V
Sbjct: 702 MARLIQDTIRKALADELLFGKLANGGSV 729


>gi|114320603|ref|YP_742286.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226997|gb|ABI56796.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 756

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/748 (52%), Positives = 531/748 (70%), Gaps = 13/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S+ LE  L+ A   A E+ HE+ T+EHLLLAL D+  A  V+  C V L  L+ +L  
Sbjct: 1   MLSKELEFTLNMAFKDAREKRHEFLTVEHLLLALTDNPAAVAVLKGCGVKLDKLRRDLEG 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++   +     N  R E +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+FSE +S A
Sbjct: 61  FLAETTPLLPANDTR-ETQPTLGFQRVLQRAILHVQSSGKREVTGANVLVAIFSEQESQA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFL  Q ++  D VN++SHG S     AN       +G  AG  G G V +       N
Sbjct: 120 VYFLHRQNVSRLDVVNYLSHGTSS---VANDPE----EGEDAG--GTGNVEEEAEPAQGN 170

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L  Y  +L  K +KG++D L+GR  E+ RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 171 --SPLDQYATNLNAKARKGQIDPLIGREHEVERTIQVLCRRRKNNPLYVGEAGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK I D  VP++L  A I+SLD+G L+AGT+YRGDFE+R+K +++++ +  +A+L+I
Sbjct: 229 EGLAKMIEDSQVPEVLADATIYSLDLGALVAGTKYRGDFEKRLKALLQQLRNDQHAVLFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG  +DASNL+KP L+SG ++CIGSTTY EYR  FEKD+AL RRFQKI
Sbjct: 289 DEIHTIIGAGSASGGVMDASNLIKPMLASGELKCIGSTTYQEYRGIFEKDRALARRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPS+ + ++I+KG+K  FE HH +R+++ A+ AA +LS R+   R+LPDKAIDVIDE
Sbjct: 349 DVGEPSVSETVQILKGLKSRFEAHHGVRFTEPALNAAAELSARYINDRRLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA   L+P S+RRK +  +DI+  +A + R I     S  D  VL NLEK+L  +++GQ
Sbjct: 409 AGARLRLRPKSRRRKTVGVQDIEGIVAKIAR-IPPKRVSATDMQVLENLEKDLKGLIFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           +EAI  L+S+IK++RAGL  P KP+G ++FSGPTGVGKTE+S++LA  +GV+L+RFDMSE
Sbjct: 468 DEAIDTLASTIKLSRAGLGQPEKPVGSFLFSGPTGVGKTEVSRRLAELMGVKLIRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVG+ QGG+L + V ++P+SVVLLDE+EK+HPDV N+LLQ+MD+
Sbjct: 528 YMERHTVSRLIGAPPGYVGYDQGGLLTEEVIKHPHSVVLLDELEKAHPDVFNLLLQVMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G++  FRNVILIMTTNAGA +MS+  IGF    +     EA++   +PEF NR
Sbjct: 588 GTLTDNNGREADFRNVILIMTTNAGAEDMSRRSIGFMPQDHSSDGLEAIKRQFTPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+++ F PL  D +++VV KF+ +L +QL EK ++         WL   GYD  MGARP
Sbjct: 648 LDAVVQFNPLDEDNVQRVVDKFVRELSVQLAEKRVTLMVDGAARRWLGEKGYDPSMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + RII++HVK PLA+++LFG+L  GG V
Sbjct: 708 MARIIQQHVKKPLAEKLLFGELADGGEV 735


>gi|226944901|ref|YP_002799974.1| ATP-dependent clp protease, ATP-binding subunit, ClipA [Azotobacter
           vinelandii DJ]
 gi|226719828|gb|ACO78999.1| ATP-dependent clp protease, ATP-binding subunit, ClipA [Azotobacter
           vinelandii DJ]
          Length = 756

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/753 (51%), Positives = 530/753 (70%), Gaps = 13/753 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             +  LE  L+ A   A  + HE+ T+EHLLLAL+D+  AA V+ +C  ++  L+++L  
Sbjct: 1   MLNRELEVTLNLAFKEARAKRHEFMTVEHLLLALLDNEAAAAVLRACGANIDKLRHDLQE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID+ +    ++    E +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+FSE +S A
Sbjct: 61  FIDSTTPLIPQHDEERETQPTLGFQRVLQRAVFHVQSSGKREVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            + L++Q +   D VN+I+HGISK            V G     DGE  + D +      
Sbjct: 121 VFLLKQQSVARIDVVNYIAHGISK------------VPGHGDHPDGEHEMQDEEGGDASA 168

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L AY  +L E  ++G++D LVGR  E+ R  QIL RR KNNPL VG+ GVGKTAIA
Sbjct: 169 SGHPLEAYASNLNELARQGRIDPLVGREFEVERVAQILARRRKNNPLLVGEAGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVD  VPD+L  + ++SLD+G L+AGT+YRGDFE+R K ++ E+    +AIL+I
Sbjct: 229 EGLAKRIVDNQVPDLLTHSVVYSLDLGALLAGTKYRGDFEKRFKALLNELRKKPHAILFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  +DASNLLKP LSSG +RCIGSTT+ E+R  FEKD+AL RRFQK+
Sbjct: 289 DEIHTIIGAGAASGGVMDASNLLKPLLSSGEIRCIGSTTFQEFRGIFEKDRALARRFQKV 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV EPS+ED + I++G+KP FE+HH + YS EA+RAA +LS R+   R +PDKAIDVIDE
Sbjct: 349 DVIEPSVEDTVGILRGLKPRFEQHHGIEYSDEALRAAAELSFRYINDRHMPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q LQP  +R K I    ++  +A + R I     S  D  +L NLE++L   V+GQ
Sbjct: 409 AGAFQRLQPEDRRAKLIDVAQVEDIVAKIAR-IPPKHVSTSDKELLRNLERDLKLTVFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI  L+++IK++RAGL  P+KP+G ++F+GPTGVGKTE ++QLA ALGV+L+RFDMSE
Sbjct: 468 DAAIDSLATAIKLSRAGLKSPDKPVGSFLFAGPTGVGKTEAARQLAKALGVELVRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HP+V N+LLQ+MD+
Sbjct: 528 YMERHTVSRLIGAPPGYVGFDQGGLLTEAITKQPHCVLLLDEIEKAHPEVFNLLLQVMDH 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FR+VI+IMTTNAGA   ++A IGF    +     E ++   +PEF NR
Sbjct: 588 GTLTDNNGRKADFRSVIIIMTTNAGAETAARASIGFTLQDHSSDAMEVIKKSFTPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F  LS ++I+ +V KF+ +L+ QL++K +    SE    WL  HGYD +MGARP
Sbjct: 648 LDTIIQFGRLSHEVIKNIVDKFLTELQAQLEDKHVQLDVSERARGWLAEHGYDAQMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           + R+I++ +K PLA+EILFG+L + GGVV + L
Sbjct: 708 MARLIQDRIKRPLAEEILFGELAEHGGVVHIDL 740


>gi|330818076|ref|YP_004361781.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           gladioli BSR3]
 gi|327370469|gb|AEA61825.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Burkholderia
           gladioli BSR3]
          Length = 765

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/771 (52%), Positives = 552/771 (71%), Gaps = 25/771 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A + A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ NL N
Sbjct: 1   MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I +D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-HDNTPTVPGTEDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI+K       ++      S           D  A+ +
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIAKTGSADAAKAGDGAPESE----------DSNAQKE 169

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L+ +  +L +  K G++D L+GR  E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 170 T----PLAQFTQNLNQMAKDGRIDPLIGRETEVERVVQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  A++FSLDMG L+AGT+YRGDFE+R+K ++KE++   +AIL
Sbjct: 226 IAEGLAWRITRGEVPDILANAQVFSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAIL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGNLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV+EPS+E  + I++G+K  FEEHH ++YS  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 346 KVDVNEPSVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I++ I+ + R +   S S+DD S L  L+++L +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGKSEIEEIISKIAR-VPPQSVSQDDRSKLQTLDRDLKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L+++IK+ARAGL   +KPIG ++FSGPTGVGKTE+++QLAF LG++L+RFDM
Sbjct: 465 GQDPAIDALAAAIKMARAGLGKLDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+ V+LLDEIEK+HPD+ N+LLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNVLLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M K  IGF + R    +   ++ F +PEF 
Sbjct: 585 DHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKGTIGFTTRREVGDEMSEIKRFFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+++LE QL EK +   F++ +  +L  +G+D  MGA
Sbjct: 645 NRLDATISFRSLDEEIIMRVVDKFLIQLEDQLHEKKVDALFTDALRKYLSKNGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSASSP 764
           RP++R+I++ ++  LADE+LFGKL  GG V         V L+ D SA  P
Sbjct: 705 RPMQRLIQDTIRRALADELLFGKLVNGGRVTVDVDENNTVQLSFDNSAEPP 755


>gi|145589928|ref|YP_001156525.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145048334|gb|ABP34961.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 768

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/768 (52%), Positives = 546/768 (71%), Gaps = 25/768 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A    HE+ T+EHLL AL+D++ A  V+ +C V++  L+  L N
Sbjct: 1   MIAQELEVSLHMAFVDARASRHEFITVEHLLAALLDNATAVEVLKACAVNIAELRTQLKN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I ND++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-NDNTPVVPGSDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA YFLQ+Q +T  D VNFISHG+ K             D S      E      ++ T 
Sbjct: 120 HAVYFLQQQGVTRLDVVNFISHGVRK-------------DQSEHVKPVESSQETEESATS 166

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
               P L  Y  +L    ++GK+D L+GR  E+ R IQ+LCRR KNNPL VG+ GVGKTA
Sbjct: 167 GKESP-LDQYTQNLNALARQGKIDPLIGRESEVERVIQVLCRRRKNNPLLVGEAGVGKTA 225

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +IV G VPDIL  A ++SLDMG L+AGT+YRGDFE+R+K ++K ++ +A+ +L
Sbjct: 226 IAEGLAWRIVKGDVPDILADATVYSLDMGALLAGTKYRGDFEQRLKSVLKSLKDHAHGVL 285

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALS+G ++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 286 FIDEIHTLIGAGAASGGTLDASNLLKPALSNGQLKCIGATTFTEYRGIFEKDAALSRRFQ 345

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           K+DV EP+++  ++I++G+K  FEEHH ++Y+  A+ AA +LS R+   R LPDKAIDVI
Sbjct: 346 KVDVVEPTVDQTVQILRGLKSRFEEHHGVKYAAAALVAAAELSSRYINDRHLPDKAIDVI 405

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I   +I++ +A + R I   S + DD S L  L++++ +VV+
Sbjct: 406 DEAGAAQRILPKSKQKKTIGRPEIEEIVAKIAR-IPPQSVTVDDRSKLQTLDRDIKSVVF 464

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI+ L+S+IK+ RAGL   ++PIG ++FSGPTGVGKTE++KQLA+ LG++LLRFDM
Sbjct: 465 GQDPAIEALASAIKMTRAGLGKIDRPIGSFLFSGPTGVGKTEVAKQLAYILGIELLRFDM 524

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L ++V++ P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 525 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVNKKPHCVLLLDEIEKAHPDIFNILLQVM 584

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M K+ IGF ++R    +   ++ F +PEF 
Sbjct: 585 DHGTLTDNNGRKTDFRNVIIIMTTNAGAEAMQKSTIGFTNARESGDEMADIKKFFTPEFR 644

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+I+ F  L   II +VV KF+M+LE QL EK +   FS  +   L  HG+D  MGA
Sbjct: 645 NRLDAIVSFKALDETIIMRVVDKFLMQLEEQLHEKKVDATFSAALRAHLAKHGFDPLMGA 704

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV-------KVSLNPDKSA 761
           RP++RII++ V+  LADE+LFGKL +GG V        KV L+ D  A
Sbjct: 705 RPMQRIIQDTVRKALADELLFGKLAQGGHVAVDIDAEGKVQLDFDAPA 752


>gi|149928084|ref|ZP_01916331.1| Putative ATP-dependent Clp protease ATP- binding subunit
           [Limnobacter sp. MED105]
 gi|149823170|gb|EDM82407.1| Putative ATP-dependent Clp protease ATP- binding subunit
           [Limnobacter sp. MED105]
          Length = 774

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/771 (52%), Positives = 556/771 (72%), Gaps = 21/771 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLLAL+D+  AA V+ SC+ D++ ++ NL N
Sbjct: 1   MIAQELEVSLHMAFVDARQQKHEFITVEHLLLALLDNPSAAEVLRSCSADVEEIRKNLQN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-KDNTPVVSGQDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEF-ANFQSKLNVDGSSAGSDGEGFVNDYQAKT 179
           HA Y+L +Q +T  D VN+ISHGI+K  +  A        +G    ++    V D Q+  
Sbjct: 120 HAVYYLHQQGITRLDVVNYISHGITKTPQAPAPKPENSQNEGQEQEAEATQSVGDKQSPL 179

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
           D         Y  +L    K+GK+D L+GR +E+ R IQ+LCRR KNNPL VG+ GVGKT
Sbjct: 180 D--------QYTQNLNALAKEGKIDPLIGREQEVERVIQVLCRRRKNNPLLVGEAGVGKT 231

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A +IV G VP+IL  A++ SLDMG L+AGT+YRGDFE+R+K ++K++++  +++
Sbjct: 232 AIAEGLAWRIVQGDVPEILATAQVHSLDMGALLAGTKYRGDFEQRLKAVLKQLKANPDSV 291

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHTL+GAGSASG ++DASNLLKPALSSG ++CIG+TT++EYR  FEKD AL RRF
Sbjct: 292 LFIDEIHTLIGAGSASGGTLDASNLLKPALSSGQLKCIGATTFTEYRGIFEKDHALSRRF 351

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QKIDVSEP++E  IEI++G+K  FE+HH ++YS  AI AA +LS +    R LPDKAIDV
Sbjct: 352 QKIDVSEPTVEQTIEILRGLKSRFEDHHGVKYSSAAISAAAELSAKFINDRHLPDKAIDV 411

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           IDEAGA+Q + P SK+RK IT+ DI+  ++ + R I   S + DD + L+ L+++L   V
Sbjct: 412 IDEAGAAQRILPKSKQRKTITKGDIEDIVSKIAR-IPPQSVNTDDRNKLATLDRDLKATV 470

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ+ AI+ L+++IK++RAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG+++LRFD
Sbjct: 471 FGQDPAIEALANAIKMSRAGLGKADKPIGSFLFSGPTGVGKTEVAKQLAFILGIEMLRFD 530

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPDV NILLQ+
Sbjct: 531 MSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKKPHCVLLLDEIEKAHPDVFNILLQV 590

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD G LTD +G+K  FRNVI+IMTTNAGA  ++K  IGF  S+    + E ++   SPEF
Sbjct: 591 MDNGTLTDNNGRKADFRNVIIIMTTNAGAEALTKRGIGFMESKVQGDEMEDIKRMFSPEF 650

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLDS+I F  L  +II +VV KF+M+LE QL +K +   F++E+   L   G+D  MG
Sbjct: 651 RNRLDSVISFRALDEEIILRVVDKFLMELEEQLHQKKVDAVFTDELRKHLAKKGFDPLMG 710

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVV--------KVSLNPDKSAS 762
           ARP++R+I++ ++  LADE+LFGKL  GG V         +VSL  D+ +S
Sbjct: 711 ARPMQRLIQDTIRKALADELLFGKLVNGGKVTVDHDVENDQVSLTFDEGSS 761


>gi|83746256|ref|ZP_00943309.1| Hypothetical Protein RRSL_03844 [Ralstonia solanacearum UW551]
 gi|207723597|ref|YP_002253996.1| atp-dependent protease (atp-binding specificity subunit) protein
           [Ralstonia solanacearum MolK2]
 gi|207742559|ref|YP_002258951.1| atp-dependent protease (atp-binding specificity subunit) protein
           [Ralstonia solanacearum IPO1609]
 gi|300703255|ref|YP_003744857.1| ATP-dependent clp protease ATP-binding subunit Clpa [Ralstonia
           solanacearum CFBP2957]
 gi|83727006|gb|EAP74131.1| Hypothetical Protein RRSL_03844 [Ralstonia solanacearum UW551]
 gi|206588799|emb|CAQ35762.1| atp-dependent protease (atp-binding specificity subunit) protein
           [Ralstonia solanacearum MolK2]
 gi|206593952|emb|CAQ60879.1| atp-dependent protease (atp-binding specificity subunit) protein
           [Ralstonia solanacearum IPO1609]
 gi|299070918|emb|CBJ42222.1| ATP-dependent Clp protease ATP-binding subunit clpA [Ralstonia
           solanacearum CFBP2957]
          Length = 762

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/751 (53%), Positives = 547/751 (72%), Gaps = 20/751 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A +  HE+ T+EHLLLAL+D+  AA V+ +C  +++ L+ +L N
Sbjct: 1   MIAQELEVSLHMAFVEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRTHLKN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQST--GRGIVTGANILVALFSEPDS 120
           +I  D++  +     V+ +PT  FQRV+QRA++HVQST  G+  VTGAN+LVA+F E DS
Sbjct: 61  FI-ADNTPVVPGTDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HA Y+LQ+Q +T  D VNFISHGI K +     +   + D +  G  G+G  +       
Sbjct: 120 HAVYYLQQQGVTRLDVVNFISHGIRKDQA----EPAKHGDSNPEGEAGDGKES------- 168

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 L  +  +L    K GK+D L+GR +E+ R +Q+LCRR KNNPL VG+ GVGKTA
Sbjct: 169 -----PLEQFTQNLNALAKAGKIDPLIGREQEVERVVQVLCRRRKNNPLLVGEAGVGKTA 223

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +I  G VPDIL  + ++SLDMG L+AGT+YRGDFE+R+K ++K ++   NAIL
Sbjct: 224 IAEGLAWRITKGEVPDILARSVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDNPNAIL 283

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHTL+GAG+ASG ++DASNLLKPALSSGA++CIG+TT++EYR  FEKD AL RRFQ
Sbjct: 284 FIDEIHTLIGAGAASGGTLDASNLLKPALSSGALKCIGATTFTEYRGIFEKDAALSRRFQ 343

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KIDV EPS++  ++I++G+K  FEEHH ++Y+  A+ AA +LS R  T R LPDKAIDVI
Sbjct: 344 KIDVVEPSVDQTVQILRGLKSRFEEHHGVKYAAAALTAAAELSARFITDRHLPDKAIDVI 403

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA+Q + P SK++K I + +I+  ++ + R +   S S+DD S L  LE++L +VV+
Sbjct: 404 DEAGAAQRILPKSKQKKTIGKGEIEDIVSRIAR-VPPQSVSQDDRSKLQTLERDLKSVVF 462

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ+ AI  L+S+IK++RAGL   +KPIG ++FSGPTGVGKTE++KQLAF LG++L+RFDM
Sbjct: 463 GQDPAIDALASAIKMSRAGLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFILGIELIRFDM 522

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERHAVSRLIGAPPGYVGF QGG+L +++ + P+ V+LLDEIEK+HPD+ NILLQ+M
Sbjct: 523 SEYMERHAVSRLIGAPPGYVGFDQGGLLTEAITKKPHCVLLLDEIEKAHPDIFNILLQVM 582

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D+G LTD +G+K  FRNVI+IMTTNAGA  M+KA IGF ++R    +   ++   +PEF 
Sbjct: 583 DHGALTDNNGRKADFRNVIIIMTTNAGAETMNKATIGFTTAREQGDEMADIKRMFTPEFR 642

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+ I F  L  +II +VV KF+M+LE QL EK +   F+E++ ++L   G+D  MGA
Sbjct: 643 NRLDATISFRSLDEEIILRVVDKFLMQLEEQLHEKKVDAIFTEKLRHFLAKKGFDPLMGA 702

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVV 751
           RP++R+I++ ++  LADE+LFGKL  GG VV
Sbjct: 703 RPMQRLIQDMIRKALADELLFGKLVNGGKVV 733


>gi|109898689|ref|YP_661944.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Pseudoalteromonas atlantica T6c]
 gi|109700970|gb|ABG40890.1| ATP-dependent Clp protease ATP-binding subunit ClpA
           [Pseudoalteromonas atlantica T6c]
          Length = 755

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/758 (52%), Positives = 533/758 (70%), Gaps = 19/758 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE+ L++A + A E  HE+ T+EHLLLAL+D+  A   + +C  ++ ++K  L +
Sbjct: 1   MLNKELEQTLNEAFIFAREHRHEFMTVEHLLLALLDNGSATEALQACGANVDIIKKELTD 60

Query: 63  YIDNDSSNKLKNGF-RVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSH 121
           ++ + +   L++     E +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+FSE +S 
Sbjct: 61  FVKDTTPLLLEDANNERETQPTLGFQRVLQRAVFHVQSSGKEEVTGANVLVAIFSEQESQ 120

Query: 122 ATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDL 181
           A Y L++ ++T  D VNFISHG+SK  E      + + +G+   S               
Sbjct: 121 AVYILKKADVTRLDVVNFISHGVSKNDEETPHSIEQDEEGAGQESGS------------- 167

Query: 182 NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
                L  Y  +L E  K+GK+D L+GR  E+ R+IQILCRR KNNPL VG+ GVGKTAI
Sbjct: 168 ---SMLDQYSTNLNELAKEGKIDPLIGRDFEVERSIQILCRRRKNNPLLVGEAGVGKTAI 224

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG A +IV   VPD++  A I+SLDMG L+AGT+YRGDFE+R+K I+KE+    +AIL+
Sbjct: 225 AEGLAFRIVHNDVPDVIANAVIYSLDMGTLLAGTKYRGDFEKRLKGILKELAKDPDAILF 284

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHT++GAG+ASG  +DASNLLKP LSSG +RC+GSTTY EY+  FEKD+AL RRFQK
Sbjct: 285 IDEIHTIIGAGAASGGVMDASNLLKPKLSSGELRCMGSTTYQEYQGIFEKDRALARRFQK 344

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           +DV EPS+ D  +I+ G+K  +EEHH +R++++AIRAA +LS ++   R LPDKAIDV+D
Sbjct: 345 VDVIEPSVADTTKILMGLKSRYEEHHSVRFTQKAIRAAAELSAKYINERHLPDKAIDVMD 404

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           EAGASQ L P SKR+K I   DI+  I+ + R I   S S  D   L NL+++L  VV+G
Sbjct: 405 EAGASQRLLPPSKRKKTIGVTDIEHIISKIAR-IPEKSVSSSDKESLKNLDRDLKLVVFG 463

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q++AI  L+ +I+++RAGL    KPIG ++F+GPTGVGKTEI++QL+  +GV+LLRFDMS
Sbjct: 464 QDQAIDTLTDAIRLSRAGLGAETKPIGSFLFAGPTGVGKTEITQQLSNIMGVELLRFDMS 523

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERHAVSRLIGAPPGYVGF QGG+L D+V ++P+SVVLLDEIEK+H DV NILLQ+MD
Sbjct: 524 EYMERHAVSRLIGAPPGYVGFDQGGLLTDAVIKHPHSVVLLDEIEKAHSDVFNILLQVMD 583

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
           +G LTD +G+K+ FRNVIL+MTTNAG  E  +  IGF    +       +    +PEF N
Sbjct: 584 HGTLTDNNGRKVDFRNVILVMTTNAGVQETIRKSIGFKQQDHSHDAMSEINKVFTPEFRN 643

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD+I+ F  L  D+I QVV KFI++L++QL  +G+S   + E   WL   GYD  MGAR
Sbjct: 644 RLDAIVWFNHLEQDVILQVVDKFIIELQVQLDNQGVSLEVTNEARQWLAQEGYDRNMGAR 703

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           P+ R+I++ VK  LA E+LFG+L +GG  VK+SL   K
Sbjct: 704 PMSRVIQQQVKKELASELLFGELSQGGS-VKISLKNKK 740


>gi|258626364|ref|ZP_05721211.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Vibrio
           mimicus VM603]
 gi|258581416|gb|EEW06318.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Vibrio
           mimicus VM603]
          Length = 755

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/759 (52%), Positives = 538/759 (70%), Gaps = 16/759 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A ++ HE+ T+EHLLLAL+++  A   +L+C  D+ VL+  L  
Sbjct: 1   MLNKELESSLNGAFARARDKRHEFMTVEHLLLALLENDAAREALLACQADIDVLRRELDT 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +ID  +    KN    E +PT SFQRV+QRAV HVQS+GR  VTGAN+LVA+FSE +SHA
Sbjct: 61  FIDQTTPLIPKNDETRETQPTLSFQRVLQRAVFHVQSSGRSEVTGANVLVAIFSEQESHA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L++ +++  D VNFISHGI+K        S  N D SS     + F ND  +  +++
Sbjct: 121 AYLLKKNDISRLDIVNFISHGITK-------ASNQNEDSSS-----DSFGND--SSEEVS 166

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L ++  +L +  K+G++D L+GR +E+ RTIQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 167 ADERLESFATNLNQLAKQGQIDPLIGRDKELERTIQVLCRRRKNNPLLVGEAGVGKTAIA 226

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +IV+G VP+++  + I+SLD+G+L+AGT+YRGDFE+R K I+K++E   +AIL+I
Sbjct: 227 EGLAWRIVEGNVPEVIQRSVIYSLDIGSLLAGTKYRGDFEKRFKSILKQLEKEKDAILFI 286

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  VDA+NL+KP LSSG +RCIGSTTY EY   FEK++AL RRFQKI
Sbjct: 287 DEIHTIIGAGAASGGQVDAANLIKPLLSSGKLRCIGSTTYQEYSNIFEKERALSRRFQKI 346

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP ++D  +I+ G+K  +E HH +RY+ +A+RAAV+LS ++   R LPDKAIDVIDE
Sbjct: 347 DIVEPLLDDTTKILMGLKTKYEAHHDVRYTNKALRAAVELSAKYINERHLPDKAIDVIDE 406

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA   L P S+R+K +   +I+  +A M R I   S S  D  +L NL+K +  +V+GQ
Sbjct: 407 AGARARLMPASRRKKTVGVAEIESMVAKMAR-IPEKSVSSSDKDILKNLDKQMKMLVFGQ 465

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI  L+ SIK+ RAGL   +KP+G ++F+GPTGVGKTE++ QL+  LG++LLRFDMSE
Sbjct: 466 DTAIDVLTESIKLTRAGLGAEHKPVGSFLFAGPTGVGKTEVTLQLSKLLGIELLRFDMSE 525

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           Y ERH+VSRLIGAPPGYVG+ QGG+L D+V ++P+SVVLLDEIEK+HPD+ N+LLQ+MD 
Sbjct: 526 YGERHSVSRLIGAPPGYVGYDQGGLLTDAVIKHPHSVVLLDEIEKAHPDIFNLLLQVMDN 585

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVIL+MTTNAG  E  K  IG     N       ++   +PEF NR
Sbjct: 586 GTLTDNNGRKADFRNVILVMTTNAGVAETVKKSIGLIQQDNSHDAMSEIKKVFTPEFRNR 645

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD II F  L   +I QVV KFI++L+ QL  +G+S   SE+  +WL   GYD +MGARP
Sbjct: 646 LDHIIWFNSLDERVIHQVVDKFIVELQAQLDARGVSLEVSEDARHWLAVKGYDREMGARP 705

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSA 761
           + R+I+E +K PLA+E+LFG L   GG VKVSL+ D+ A
Sbjct: 706 MGRVIQEQLKKPLANELLFGSL-VNGGTVKVSLSDDRLA 743


>gi|299533530|ref|ZP_07046907.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Comamonas
           testosteroni S44]
 gi|298718488|gb|EFI59468.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Comamonas
           testosteroni S44]
          Length = 774

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/750 (52%), Positives = 548/750 (73%), Gaps = 19/750 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLLAL+D+  AA V+ +C  ++  L+++L N
Sbjct: 1   MIAQELEVSLHMAFVEARQQRHEFITVEHLLLALLDNPSAAEVLRACAANIDDLRSSLSN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGI--VTGANILVALFSEPDS 120
           +I  D++ ++     V+ +PT  FQRV+QRA++HVQSTG G   VTGAN+LVA+F E DS
Sbjct: 61  FI-KDNTPQVDGTEEVDTQPTLGFQRVIQRAIMHVQSTGNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRK--EFANFQSKLNVDGSSAGSDGEGFVNDYQAK 178
           HA Y+L +Q +T  D VN+I+HGI K +  E A  +S    +  +AG   E         
Sbjct: 120 HAVYYLHQQGVTRLDVVNYIAHGIKKGEPPEPAKAESPSESEEGAAGERNEKA------- 172

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                   L  + ++L +  K+GK+D L+GR  E+ RTIQILCRR KNNPL VG+ GVGK
Sbjct: 173 ------SPLEQFTLNLNQAAKEGKIDPLIGREYEVERTIQILCRRRKNNPLLVGEAGVGK 226

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A +I +G VP++L    ++SLDMG L+AGT+YRGDFE+R+K ++K ++   +A
Sbjct: 227 TAIAEGLAWRITEGTVPEVLREGVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDKPHA 286

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHTL+GAG+ASG ++DASNLLKPALSSG +RCIG+TT++EYR  FEKD AL RR
Sbjct: 287 ILFIDEIHTLIGAGAASGGTLDASNLLKPALSSGQLRCIGATTFTEYRGIFEKDAALSRR 346

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQK+DV EP++ + ++I+KG+K  FEEHH + Y++EA++AA +LS ++   R LPDKAID
Sbjct: 347 FQKVDVVEPTVAETVDILKGLKSRFEEHHSITYAQEALQAAAELSAKYINDRHLPDKAID 406

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDEAGA+Q + P ++R++ I + +I+  +A + R I   + S DD S L  LE++L +V
Sbjct: 407 VIDEAGAAQRIAPEAQRKQTIGKAEIEAIVAKIAR-IPPANVSNDDRSKLQTLERDLKSV 465

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ++A++ LSS++K+AR+GL  P+KPIG ++FSGPTGVGKTE +KQLA+ LGV L+RF
Sbjct: 466 VFGQDKALEVLSSAVKMARSGLGKPDKPIGSFLFSGPTGVGKTEAAKQLAYILGVDLIRF 525

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+SV+LLDEIEK+HPD+ N+LLQ
Sbjct: 526 DMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHSVLLLDEIEKAHPDIFNVLLQ 585

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +G+K  FRNVI+IMTTNAGA  M+KA IGF + R    +   ++   +PE
Sbjct: 586 VMDHGTLTDNNGRKADFRNVIIIMTTNAGAETMNKATIGFTNPREAGDEMGDIKRLFTPE 645

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+I+ F PL   II +VV KF+++LE QL EK +   FS+ +   L   G+D  M
Sbjct: 646 FRNRLDAIVSFKPLDEQIILRVVDKFLLQLEQQLAEKKVEVTFSDNLRKHLAKKGFDPLM 705

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGG 748
           GARP++R+I++ ++  LADE+LFG+L  GG
Sbjct: 706 GARPMQRLIQDTIRRSLADELLFGRLTNGG 735


>gi|264678277|ref|YP_003278184.1| ATP-dependent Clp protease ATP-binding subunit [Comamonas
           testosteroni CNB-2]
 gi|262208790|gb|ACY32888.1| ATP-dependent Clp protease, ATP-binding subunit [Comamonas
           testosteroni CNB-2]
          Length = 774

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/750 (52%), Positives = 548/750 (73%), Gaps = 19/750 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V A ++ HE+ T+EHLLLAL+D+  AA V+ +C  ++  L+++L N
Sbjct: 1   MIAQELEVSLHMAFVEARQQRHEFITVEHLLLALLDNPSAAEVLRACAANIDDLRSSLSN 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGI--VTGANILVALFSEPDS 120
           +I  D++ ++     V+ +PT  FQRV+QRA++HVQSTG G   VTGAN+LVA+F E DS
Sbjct: 61  FI-KDNTPQVDGTEEVDTQPTLGFQRVIQRAIMHVQSTGNGKKEVTGANVLVAIFGEKDS 119

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRK--EFANFQSKLNVDGSSAGSDGEGFVNDYQAK 178
           HA Y+L +Q +T  D VN+I+HGI K +  E A  +S    +  +AG   E         
Sbjct: 120 HAVYYLHQQGVTRLDVVNYIAHGIKKGEPPEPAKAESPSESEEGAAGERNEKA------- 172

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                   L  + ++L +  K+GK+D L+GR  E+ RTIQILCRR KNNPL VG+ GVGK
Sbjct: 173 ------SPLEQFTLNLNQAAKEGKIDPLIGREYEVERTIQILCRRRKNNPLLVGEAGVGK 226

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A +I +G VP++L    ++SLDMG L+AGT+YRGDFE+R+K ++K ++   +A
Sbjct: 227 TAIAEGLAWRITEGTVPEVLKEGVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDKPHA 286

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHTL+GAG+ASG ++DASNLLKPALSSG +RCIG+TT++EYR  FEKD AL RR
Sbjct: 287 ILFIDEIHTLIGAGAASGGTLDASNLLKPALSSGQLRCIGATTFTEYRGIFEKDAALSRR 346

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQK+DV EP++ + ++I+KG+K  FEEHH + Y++EA++AA +LS ++   R LPDKAID
Sbjct: 347 FQKVDVVEPTVAETVDILKGLKSRFEEHHSITYAQEALQAAAELSAKYINDRHLPDKAID 406

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDEAGA+Q + P ++R++ I + +I+  +A + R I   + S DD S L  LE++L +V
Sbjct: 407 VIDEAGAAQRIAPEAQRKQTIGKAEIEAIVAKIAR-IPPANVSNDDRSKLQTLERDLKSV 465

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ++A++ LSS++K+AR+GL  P+KPIG ++FSGPTGVGKTE +KQLA+ LGV L+RF
Sbjct: 466 VFGQDKALEVLSSAVKMARSGLGKPDKPIGSFLFSGPTGVGKTEAAKQLAYILGVDLIRF 525

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERHAVSRLIGAPPGYVGF QGG+L ++V + P+SV+LLDEIEK+HPD+ N+LLQ
Sbjct: 526 DMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHSVLLLDEIEKAHPDIFNVLLQ 585

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD+G LTD +G+K  FRNVI+IMTTNAGA  M+KA IGF + R    +   ++   +PE
Sbjct: 586 VMDHGTLTDNNGRKADFRNVIIIMTTNAGAETMNKATIGFTNPREAGDEMGDIKRLFTPE 645

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+I+ F PL   II +VV KF+++LE QL EK +   FS+ +   L   G+D  M
Sbjct: 646 FRNRLDAIVSFKPLDEQIILRVVDKFLLQLEQQLAEKKVEVTFSDNLRKHLAKKGFDPLM 705

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGG 748
           GARP++R+I++ ++  LADE+LFG+L  GG
Sbjct: 706 GARPMQRLIQDTIRRSLADELLFGRLTNGG 735


>gi|190574285|ref|YP_001972130.1| putative ATP-dependent Clp protease ATP-binding subunit
           [Stenotrophomonas maltophilia K279a]
 gi|190012207|emb|CAQ45830.1| putative ATP-dependent Clp protease ATP-binding subunit
           [Stenotrophomonas maltophilia K279a]
          Length = 761

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/748 (51%), Positives = 538/748 (71%), Gaps = 13/748 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
            FS++LE  + Q    A E  HE+ T+EHLLLAL+D+  A  V+ +C  D   L+  L  
Sbjct: 1   MFSKDLEHTIGQCYKRAREARHEFMTVEHLLLALLDNPSAQAVLKACGADADRLRQELEQ 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
            I+   S   ++  R + +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  AIEASVSRLAEDDGR-DTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y+L +Q++T  D VN++SHGI+K  +     S      SS   +G     + + K D  
Sbjct: 120 VYYLNQQDVTRLDVVNYLSHGIAKLGDEGEQSS------SSPEGEGRMEGGEGEPKGD-- 171

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
              AL+ +  +L ++ + G++D LVGR +EI RTIQ+LCRR KNNPLYVG+ GVGKTAIA
Sbjct: 172 ---ALTEFASNLNDQARAGRIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIA 228

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++I++G VPD+L  A I+SLD+G L+AGT+YRGDFE+R+K ++  ++   NA+L+I
Sbjct: 229 EGLARRIIEGSVPDVLADAVIYSLDLGALVAGTKYRGDFEKRLKSVLTALKKVPNAVLFI 288

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG ++DASNL+KPAL+SG +RCIGSTT+ EYR  FEKD+AL RRFQKI
Sbjct: 289 DEIHTIIGAGSASGGTMDASNLIKPALASGELRCIGSTTFQEYRGIFEKDRALARRFQKI 348

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+ EP++ +  EI++G+K  +E HH + YS EA++AAV LSV+H   R LPDKAIDVIDE
Sbjct: 349 DIVEPTVGETYEILQGLKSKYELHHGVTYSDEALQAAVDLSVKHIGDRLLPDKAIDVIDE 408

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L P  +R++ I  ++++  +A M R I     S  D  VL +LE+NL  V++GQ
Sbjct: 409 AGARQRLLPEEQRKELIDVEEVEAIVAKMAR-IPAKQVSATDKDVLQHLERNLKMVIFGQ 467

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI+ LSS+IK+AR+GL +P KPIG ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 468 DPAIETLSSAIKLARSGLGNPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSE 527

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YME H++SRLIGAPPGYVGF QGG+L + + + P+ V+LLDEIEK+HPD+ NILLQ+MD 
Sbjct: 528 YMEPHSISRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEIEKAHPDIFNILLQVMDR 587

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G+LTD +G++ +F+NV+L+MTTNAGA + S+  IGF    +     E +R   +PEF NR
Sbjct: 588 GVLTDTNGREANFKNVVLVMTTNAGAAQASRRSIGFTKQDHATDAMETIRRSFTPEFRNR 647

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+++ F  L  + I +VV KF+++LE+ LQ+K +S   +    +WL  HG+D  MGARP
Sbjct: 648 LDAVVQFQALGFEHILRVVDKFLIELEMLLQDKHVSLSATPTARDWLAHHGFDPLMGARP 707

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGV 750
           + R+I++ +K PLADE+LFGKL  GG V
Sbjct: 708 MARVIQDKIKRPLADELLFGKLVNGGKV 735


>gi|30249695|ref|NP_841765.1| ClpA, ATP dependent protease, chaperonin [Nitrosomonas europaea
           ATCC 19718]
 gi|30180732|emb|CAD85644.1| ClpA, ATP dependent protease, chaperonin [Nitrosomonas europaea
           ATCC 19718]
          Length = 756

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/767 (50%), Positives = 547/767 (71%), Gaps = 23/767 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V + ++ HE+ T+EHLLLAL+D+  AA V+++C VD++ L+ +L +
Sbjct: 1   MIAQELEVSLHMAFVESRQKRHEFITVEHLLLALLDNPSAAKVLVACTVDIEDLRKSLQD 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I   +   ++    V+ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  HIARHTP-VVEGSEDVDTQPTLGFQRVIQRAILHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQ-SKLNVDGSSAGSDGEGFVNDYQAKTDL 181
            YFLQ++ +T  D VN+ISH I K  + +  + ++ N DG    S               
Sbjct: 120 VYFLQQRGVTRLDVVNYISHKIGKAAQSSESEKNEENADGEQQDSGS------------- 166

Query: 182 NLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI 241
                L  Y V+L  +    ++D L+GR +E+ R IQ LCRR KNNPL VG+ GVGKTAI
Sbjct: 167 ----TLENYTVNLNSQAIANRIDPLIGREKEVERVIQTLCRRRKNNPLLVGEAGVGKTAI 222

Query: 242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILY 301
           AEG A++I +  VPD+L   ++++LDMG L+AGT+YRGDFE+R+K ++K++     AIL+
Sbjct: 223 AEGLARRITENRVPDVLANHQVYALDMGALLAGTKYRGDFEQRLKVVLKQLTDNPKAILF 282

Query: 302 IDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK 361
           IDEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TTY+EYR  FEKD AL RRFQK
Sbjct: 283 IDEIHTLIGAGAASGGTLDASNLLKPALSSGRLKCIGATTYNEYRGVFEKDHALSRRFQK 342

Query: 362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID 421
           IDVSEP I + +EI++G+K  +E+HH ++Y++ A+ AA +LS R    R LPDKAIDVID
Sbjct: 343 IDVSEPDIGETVEILRGLKSRYEKHHNVKYTEVALTAAAELSARFINDRHLPDKAIDVID 402

Query: 422 EAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYG 481
           EAGA+Q + P S++RK I  ++I++ IA + R I   + S DD + L  L+++L  +V+G
Sbjct: 403 EAGAAQRILPKSRQRKIIGRQEIEQVIAGIAR-IPPQNVSSDDRNKLKTLDRDLKAIVFG 461

Query: 482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMS 541
           Q+ AI  L+S+IK+AR+GL +  KPIG ++FSGPTGVGKTE+++QLA+ LG+ L RFDMS
Sbjct: 462 QDAAIDALTSAIKMARSGLGNTCKPIGSFLFSGPTGVGKTEVARQLAYTLGIPLHRFDMS 521

Query: 542 EYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMD 601
           EYMERHAVSRLIGAPPGYVGF QGG+L +++ + P++V+L DEIEK+HPD+ N++LQIMD
Sbjct: 522 EYMERHAVSRLIGAPPGYVGFDQGGLLTETIIKQPHAVLLFDEIEKAHPDIFNVMLQIMD 581

Query: 602 YGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN 661
           YG LTD SG+K  FRNVI++MTTNAGA  +++  IGF        +   ++   +PEF N
Sbjct: 582 YGTLTDNSGRKADFRNVIIVMTTNAGADVLTRTSIGFTEHTKSGDEMVEIKRLFTPEFRN 641

Query: 662 RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGAR 721
           RLD+II F  L+ DII +VV KF+++LE QLQEK +   F++ +  +L  HG+D  MGAR
Sbjct: 642 RLDAIISFTSLTEDIILRVVDKFLIELETQLQEKKVDVTFTDNLRKYLARHGFDPLMGAR 701

Query: 722 PLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           P+ R+I++ ++  LADE+LFG L  GG   KV+++ D+   + + FE
Sbjct: 702 PMARLIQDIIRRALADELLFGHLANGG---KVTVDIDEDGKARLTFE 745


>gi|254433238|ref|ZP_05046746.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Nitrosococcus
           oceani AFC27]
 gi|207089571|gb|EDZ66842.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Nitrosococcus
           oceani AFC27]
          Length = 734

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/729 (52%), Positives = 522/729 (71%), Gaps = 15/729 (2%)

Query: 24  HEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKPT 83
           HE+ T+EHLL A++D+  AA V+ +C  +L+ LK  +  ++ N+++  L      + +PT
Sbjct: 2   HEFLTVEHLLFAMLDNPAAAAVLRACGANLEQLKQEITVFL-NETTPLLSTEDGRDTQPT 60

Query: 84  SSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHG 143
             FQRV+QRAVL VQS+G+  VTGAN+LVA++ E  S A YFL+ Q MT  D VN+ISHG
Sbjct: 61  LGFQRVLQRAVLQVQSSGQKEVTGANVLVAIYGEQQSQAVYFLKRQHMTRLDIVNYISHG 120

Query: 144 ISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQ-AKTDLNLFPALSAYCVDLTEKVKKGK 202
           ISK            VD   +G D  G   + + A  + +    L  Y  +L     +G+
Sbjct: 121 ISK------------VDPQGSGGDSAGAPEEAETAGAETSGQNPLETYATNLNRLAAQGR 168

Query: 203 VDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGAR 262
           +D L+GR  E+ RTIQILCRR KNNPL+VG+ GVGKTA+AEG A +I +G +PDIL    
Sbjct: 169 IDPLIGRSLELERTIQILCRRRKNNPLFVGEAGVGKTALAEGLAWKISEGDIPDILRDCT 228

Query: 263 IFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDAS 322
           I+SLDMG L+AGT+YRGDFE+R+K I+ +++   +AIL+IDEIHT++GAGSASG  +DAS
Sbjct: 229 IYSLDMGTLLAGTKYRGDFEKRLKGILSQLKKEKSAILFIDEIHTVIGAGSASGGVMDAS 288

Query: 323 NLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPY 382
           NL+KPAL+SG ++CIGSTTY EYR  FEKD+AL RRFQKID+ EPS+E+ ++I++G+KP 
Sbjct: 289 NLIKPALASGELKCIGSTTYQEYRNIFEKDRALARRFQKIDIPEPSVEETVQILRGLKPR 348

Query: 383 FEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEK 442
            E HH+LR+S+ A+R A +LS R+   R LPDKAIDV+DE GASQ L   S+R+K I  +
Sbjct: 349 LEAHHKLRFSQAALRTAAELSARYINDRHLPDKAIDVLDECGASQQLLTPSRRKKVIGVQ 408

Query: 443 DIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSD 502
           D++  +A M R I     S  D   L+ LE NL  V++GQ++AI+ L ++IK++R+GL D
Sbjct: 409 DVQTVVAKMAR-IPPKHVSASDKESLAKLEANLKRVIFGQDKAIEALGAAIKMSRSGLGD 467

Query: 503 PNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGF 562
            ++P+G ++FSGPTGVGKTE+++QLA  LG++L+RFDMSEYMERH VSRLIGAPPGYVG+
Sbjct: 468 TDRPVGSFLFSGPTGVGKTEVTRQLAHILGIELIRFDMSEYMERHTVSRLIGAPPGYVGY 527

Query: 563 GQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIM 622
            QGG+L +++ +NP++V+LLDEIEK+HPDV N+LLQ+MD+G LTD +G+K  FRNVILIM
Sbjct: 528 DQGGLLTEAICKNPHAVLLLDEIEKAHPDVFNLLLQVMDHGTLTDNNGRKADFRNVILIM 587

Query: 623 TTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVH 682
           T+NAGA E+S+  IGF    +     E +R   SPEF NRLD II F  L +  I +VV 
Sbjct: 588 TSNAGAQEISRTSIGFTLQDHSSDAMEVIRRTFSPEFRNRLDDIIQFQSLDAPAISRVVD 647

Query: 683 KFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFG 742
           KFI +LE  LQ+K ++   SE    WL  HGYD KMGARP+ R+I+E +K PLA+E+LFG
Sbjct: 648 KFIFELEFLLQDKNVTLEVSETARAWLAKHGYDEKMGARPMARLIQERIKRPLAEELLFG 707

Query: 743 KLKKGGGVV 751
           KL K G V 
Sbjct: 708 KLAKEGHVA 716


>gi|149376384|ref|ZP_01894147.1| ATPase with chaperone activity, ATP-binding subunit [Marinobacter
           algicola DG893]
 gi|149359398|gb|EDM47859.1| ATPase with chaperone activity, ATP-binding subunit [Marinobacter
           algicola DG893]
          Length = 756

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/753 (51%), Positives = 531/753 (70%), Gaps = 14/753 (1%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             S++LE  L+ A   A ++ HE+ T+EHLLLAL+D+  A  V+ +C  DL  L+  L+ 
Sbjct: 1   MLSKDLEITLNTAFKSARDKRHEFMTVEHLLLALLDNESAVGVLKACGADLARLQEELVE 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           ++D+ +     N    E +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+FSE +S A
Sbjct: 61  FVDSTTPLIPSNDSERETQPTLGFQRVLQRAVFHVQSSGKKEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L++Q +   D VNF+SHGIS+       Q   + +G    S  E       A  +  
Sbjct: 121 VYVLKKQSIARIDVVNFVSHGISR------VQGAEDQEGHDQASHDE-------AAEEGG 167

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L +Y  +L ++ ++G++D L+GR  E+ R +QIL RR KNNPL VG+ GVGKTAIA
Sbjct: 168 ASRPLESYATNLNDQARQGRIDPLIGREHEVERVVQILVRRRKNNPLLVGEAGVGKTAIA 227

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG AK+IVD  VP+I+  A ++SLD+G L+AGT+YRGDFE+R+K ++ E++   +AIL+I
Sbjct: 228 EGLAKRIVDSQVPEIISDAVVYSLDLGALLAGTKYRGDFEKRLKGLLAELKKEKHAILFI 287

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAGSASG  +DASNLLKP LSSG +RCIGSTT+ E+R  FEKD AL RRFQKI
Sbjct: 288 DEIHTIIGAGSASGGVMDASNLLKPMLSSGEIRCIGSTTFQEFRGIFEKDSALARRFQKI 347

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           DV+EPS+ED  +I+KG+K +FE+HH L+Y+ +A+R A +LS R+ T R LPDKAIDVIDE
Sbjct: 348 DVNEPSVEDTYQILKGLKSHFEKHHDLKYTDQALRVAAELSERYITDRHLPDKAIDVIDE 407

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA Q L  ++KR+K I   +I+  +A++ R I   + S  D  +L NLE++L  VV+GQ
Sbjct: 408 AGAHQRLLAVAKRKKTIDVSEIEDVVANIAR-IPPKNVSTSDKDLLRNLERDLKMVVFGQ 466

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI+ LS++IK+ARAGL  P KP G ++F+GPTGVGKTE++KQLA  LG++L+RFDMSE
Sbjct: 467 DPAIESLSTAIKLARAGLKAPEKPEGAFLFAGPTGVGKTEVTKQLAKVLGIELVRFDMSE 526

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVG+ QGG+L +SV ++P+ V+LLDEIEK+HP+V N+LLQ+MD+
Sbjct: 527 YMERHTVSRLIGAPPGYVGYDQGGLLTESVSKHPHCVLLLDEIEKAHPEVFNLLLQVMDH 586

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FR+VIL+MTTNAGA  M++  IGF    +     E +    +PEF NR
Sbjct: 587 GTLTDNNGRKADFRHVILVMTTNAGAESMARRSIGFSEQDHSTDGMEIISKTFTPEFRNR 646

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD II F  L    I  VV KF+ +L+ QL EK +  H  +    WL   GYDV MGARP
Sbjct: 647 LDGIIQFGDLQPATITHVVDKFLTELQAQLDEKHVVLHVDDAAKEWLAEKGYDVTMGARP 706

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSL 755
           + R+I++ +K PLA++ILFG+L + GG V + L
Sbjct: 707 MARLIQDKIKRPLAEQILFGRLSEHGGDVHIHL 739


>gi|117623060|ref|YP_851973.1| ATP-dependent Clp protease ATP-binding subunit [Escherichia coli
           APEC O1]
 gi|115512184|gb|ABJ00259.1| ATP-dependent clp protease ATP-binding subunit ClpA [Escherichia
           coli APEC O1]
          Length = 760

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/762 (51%), Positives = 538/762 (70%), Gaps = 22/762 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           M   ++ LE  L+ A   A E  HE+ T+EHLLLAL+ +  A   + +C+VDL  L+  L
Sbjct: 1   MPMLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQEL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             +I+  +     +    + +PT SFQRV+QRAV HVQS+GR  VTGAN+LVA+FSE +S
Sbjct: 61  EAFIEQTTPVLPASEEERDTQPTLSFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQES 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRK--EFANFQSKLNVDGSSAGSDGEGFVNDYQAK 178
            A Y L++ E++  D VNFISHG  K +  + ++  S+ N +  + G +           
Sbjct: 121 QAAYLLRKHEVSRLDVVNFISHGTRKDEPTQSSDPGSQPNSEEQAGGEE----------- 169

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
                   +  +  +L +  + G +D L+GR +E+ R IQ+LCRR KNNPL VG+ GVGK
Sbjct: 170 -------RMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGK 222

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A +IV G VP+++    I+SLD+G+L+AGT+YRGDFE+R K ++K++E   N+
Sbjct: 223 TAIAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNS 282

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHT++GAG+ASG  VDA+NL+KP LSSG +R IGSTTY E+   FEKD+AL RR
Sbjct: 283 ILFIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARR 342

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKID++EPSIE+ ++I+ G+KP +E HH +RY+ +A+RAAV+L+V++   R LPDKAID
Sbjct: 343 FQKIDITEPSIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAID 402

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDEAGA   L P+SKR+K +   DI+  +A + R I   S S+ D   L NL   L  +
Sbjct: 403 VIDEAGARARLMPVSKRKKTVNVADIESVVARIAR-IPEKSVSQSDRDTLKNLGDRLKML 461

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ++AI+ L+ +IK+ARAGL   +KP+G ++F+GPTGVGKTE++ QL+ ALG++LLRF
Sbjct: 462 VFGQDKAIEALTEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKALGIELLRF 521

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH VSRLIGAPPGYVGF QGG+L D+V ++P++V+LLDEIEK+HPDV NILLQ
Sbjct: 522 DMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQ 581

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD G LTD +G+K  FRNV+L+MTTNAG  E  +  IG     N     E ++   +PE
Sbjct: 582 VMDNGTLTDNNGRKADFRNVVLVMTTNAGVRETERKSIGLIHQDNSTDAMEEIKKIFTPE 641

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+II F  LS+D+I QVV KFI++L++QL +KG+S   S+E  NWL   GYD  M
Sbjct: 642 FRNRLDNIIWFDHLSTDVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAM 701

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKS 760
           GARP+ R+I++++K PLA+E+LFG L  GG V  V+L+ +K+
Sbjct: 702 GARPMARVIQDNLKKPLANELLFGSLVDGGQVT-VALDKEKN 742


>gi|251789966|ref|YP_003004687.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Dickeya zeae
           Ech1591]
 gi|247538587|gb|ACT07208.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Dickeya zeae
           Ech1591]
          Length = 758

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/754 (51%), Positives = 530/754 (70%), Gaps = 19/754 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E  HE+ T+EHLLLAL+ +  A   + +C VDL VL+  L  
Sbjct: 1   MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACTVDLAVLRQELET 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I+  +    +N    + +PT SFQRV+QRAV HVQS+GR  V+GAN+LVA+FSE +S A
Sbjct: 61  FIEQTTPTLPQNDEERDTQPTLSFQRVLQRAVFHVQSSGRSEVSGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L++ +++  D VNFISHG  K +             S   ++ E  VN+ QA  +  
Sbjct: 121 AYLLRKHDVSRLDVVNFISHGTRKEE-------------SGPAANPENPVNEEQAGGE-- 165

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               +  +  +L +  + G +D L+GR  E+ RTIQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 166 --ERMENFTTNLNQLARVGGIDPLIGRDSELERTIQVLCRRRKNNPLLVGESGVGKTAIA 223

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +IV G VP+++ G  I+SLD+G+L+AGT+YRGDFE+R K ++K++E   ++IL+I
Sbjct: 224 EGLAWRIVQGDVPEVMAGCTIYSLDIGSLLAGTKYRGDFEKRFKSLLKQLEQDQSSILFI 283

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  VDA+NL+KP LSSG +R +GSTTY E+   FEKD+AL RRFQKI
Sbjct: 284 DEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVVGSTTYQEFSNIFEKDRALARRFQKI 343

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D++EPS+E+ ++I+ G+KP +E HH +RY+ +AIRAAV+L+V++   R LPDKAIDVIDE
Sbjct: 344 DITEPSVEETVQIINGLKPKYEAHHDVRYTAKAIRAAVELAVKYINDRHLPDKAIDVIDE 403

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA   L P SKR+K +   DI+  +A + R I   + S  D  VL NL   L  +V+GQ
Sbjct: 404 AGARCRLLPASKRKKTVNVADIESVVARIAR-IPEKTVSASDRDVLRNLGDRLKMLVFGQ 462

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI+ L+ +IK++RAGL    KP+G ++F+GPTGVGKTE++ QLA AL ++LLRFDMSE
Sbjct: 463 DNAIEALTEAIKMSRAGLGHERKPVGSFLFAGPTGVGKTEVTVQLAKALDIELLRFDMSE 522

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVG+ QGG+L D+V ++P+SV+LLDEIEK+HPDV N+LLQ+MD 
Sbjct: 523 YMERHTVSRLIGAPPGYVGYDQGGLLTDAVIKHPHSVLLLDEIEKAHPDVFNLLLQVMDN 582

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVI++MTTNAG  E  +  IG     N     E ++   +PEF NR
Sbjct: 583 GTLTDNNGRKADFRNVIVVMTTNAGVRETQRKSIGLIQQDNSSDAMEEIKKVFTPEFRNR 642

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD II F  LS+++I+QVV KFI++L+ QL  KG+S   SEE  NWL   GYD  MGARP
Sbjct: 643 LDGIIWFNHLSAEVIQQVVDKFIVELQAQLDAKGVSLEVSEEARNWLAEKGYDKAMGARP 702

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLN 756
           + R+I+E++K PLA+E+LFG L  GG  VKV L+
Sbjct: 703 MARVIQENLKKPLANELLFGSLVDGGS-VKVELD 735


>gi|170769184|ref|ZP_02903637.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Escherichia
           albertii TW07627]
 gi|170121836|gb|EDS90767.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Escherichia
           albertii TW07627]
          Length = 758

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/758 (51%), Positives = 536/758 (70%), Gaps = 18/758 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E  HE+ T+EHLLLAL+ +  A   + +C+VDL  L+  L  
Sbjct: 1   MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQELEA 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I+  +     +    + +PT SFQRV+QRAV HVQS+GR  VTGAN+LVA+FSE +S A
Sbjct: 61  FIEQTTPVLPASEEERDTQPTLSFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            Y L++ E++  D VNFISHG +++ E +      N  GS   + GE             
Sbjct: 121 AYLLRKHEVSRLDVVNFISHG-TRKDEPSQSSEPGNQPGSEEQAGGE------------- 166

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               +  +  +L +  + G +D L+GR +E+ R IQ+LCRR KNNPL VG+ GVGKTAIA
Sbjct: 167 --ERMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTAIA 224

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A +IV G VP+++    I+SLD+G+L+AGT+YRGDFE+R K ++K++E   N+IL+I
Sbjct: 225 EGLAWRIVQGDVPEVIADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSILFI 284

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHT++GAG+ASG  VDA+NL+KP LSSG +R IGSTTY E+   FEKD+AL RRFQKI
Sbjct: 285 DEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQKI 344

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D++EPSIE+ ++I+ G+KP +E HH +RY+ +A+RAAV+L+V++   R LPDKAIDVIDE
Sbjct: 345 DITEPSIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAIDVIDE 404

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA   L P+SKR+K +   DI+  +A + R I   S S+ D   L NL   L  +V+GQ
Sbjct: 405 AGARARLMPVSKRKKTVNVADIESVVARIAR-IPEKSVSQSDRDTLRNLGDRLKMLVFGQ 463

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           ++AI+ L+ +IK++RAGL   +KP+G ++F+GPTGVGKTE++ QL+ ALG++LLRFDMSE
Sbjct: 464 DKAIEALTEAIKMSRAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKALGIELLRFDMSE 523

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERH VSRLIGAPPGYVGF QGG+L D+V ++P++V+LLDEIEK+HPDV NILLQ+MD 
Sbjct: 524 YMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVMDN 583

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNV+L+MTTNAG  E  +  IG     N     E ++   +PEF NR
Sbjct: 584 GTLTDNNGRKADFRNVVLVMTTNAGVRETERKSIGLIQQDNSTDAMEEIKKIFTPEFRNR 643

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F  LS+D+I QVV KFI++L++QL +KG+S   S+E  NWL   GYD  MGARP
Sbjct: 644 LDNIIWFDHLSTDVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGARP 703

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKS 760
           + R+I++++K PLA+E+LFG L  GG V  V+L+ +K+
Sbjct: 704 MARVIQDNLKKPLANELLFGSLVDGGQVT-VALDKEKN 740


>gi|332173683|gb|AEE22937.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 755

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/760 (51%), Positives = 536/760 (70%), Gaps = 23/760 (3%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE+ L++A + A E  HE+ T+EHLLLAL+D+  A   + +C  ++ ++K  L +
Sbjct: 1   MLNKELEQTLNEAFIFAREHRHEFMTVEHLLLALLDNGSATEALQACGANVDIIKKELTD 60

Query: 63  YIDNDSSNKLKNGF-RVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSH 121
           ++ + +   L++     E +PT  FQRV+QRAV HVQS+G+  VTGAN+LVA+FSE +S 
Sbjct: 61  FVKDTTPLLLEDANNERETQPTLGFQRVLQRAVFHVQSSGKEEVTGANVLVAIFSEQESQ 120

Query: 122 ATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSS--AGSDGEGFVNDYQAKT 179
           A Y L++ ++T  D VNFISHG+SK  + +    + + +G+   AGS             
Sbjct: 121 AVYILKKADVTRLDVVNFISHGVSKSDDESTHSVEQDEEGAGQEAGS------------- 167

Query: 180 DLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKT 239
                  L  Y  +L E  K+GK+D L+GR  E+ R+IQILCRR KNNPL VG+ GVGKT
Sbjct: 168 -----SMLDQYSTNLNELAKEGKIDPLIGRDFEVERSIQILCRRRKNNPLLVGEAGVGKT 222

Query: 240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAI 299
           AIAEG A +I+   VPD++  A I+SLDMG L+AGT+YRGDFE+R+K I+KE+    +AI
Sbjct: 223 AIAEGLAFRIIHNDVPDVIANAVIYSLDMGTLLAGTKYRGDFEKRLKGILKELSKDPDAI 282

Query: 300 LYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF 359
           L+IDEIHT++GAG+ASG  +DASNLLKP LSSG +RC+GSTTY EY+  FEKD+AL RRF
Sbjct: 283 LFIDEIHTIIGAGAASGGVMDASNLLKPKLSSGELRCMGSTTYQEYQGIFEKDRALARRF 342

Query: 360 QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV 419
           QK+DV EPS+ D  +I+ G+K  +EEHH +R++++AIRA  +LS ++   R LPDKAIDV
Sbjct: 343 QKVDVIEPSVADTTKILMGLKSRYEEHHSVRFTQKAIRATAELSAKYINERHLPDKAIDV 402

Query: 420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVV 479
           +DEAGASQ L P SKR+K I   DI+  I+ + R I   S S  D   L NL+++L  VV
Sbjct: 403 MDEAGASQRLLPPSKRKKTIGVTDIEHIISKIAR-IPEKSVSSSDKESLKNLDRDLKLVV 461

Query: 480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD 539
           +GQ++AI  L+ +I+++RAGL    KPIG ++F+GPTGVGKTEI++QL+  +GV+LLRFD
Sbjct: 462 FGQDQAIDTLTDAIRLSRAGLGVETKPIGSFLFAGPTGVGKTEITQQLSNIMGVELLRFD 521

Query: 540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQI 599
           MSEYMERHAVSRLIGAPPGYVGF QGG+L D+V ++P+SVVLLDEIEK+H DV NILLQ+
Sbjct: 522 MSEYMERHAVSRLIGAPPGYVGFDQGGLLTDAVIKHPHSVVLLDEIEKAHSDVFNILLQV 581

Query: 600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF 659
           MD+G LTD +G+K+ FRNVIL+MTTNAG  E  +  IGF    +       +    +PEF
Sbjct: 582 MDHGTLTDNNGRKVDFRNVILVMTTNAGVQETIRKSIGFKQQDHSHDAMSEINKVFTPEF 641

Query: 660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG 719
            NRLD+I+ F  L  ++I QVV KFI++L++QL  +G+S   + E   WL   GYD  MG
Sbjct: 642 RNRLDAIVWFNHLEQEVILQVVDKFIVELQVQLDNQGVSLDVTNEARQWLAEEGYDRNMG 701

Query: 720 ARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDK 759
           ARP+ R+I++HVK  LA E+LFG+L +GG  VK+SL   K
Sbjct: 702 ARPMSRVIQQHVKKELASELLFGELSQGGS-VKISLKNKK 740


>gi|110804884|ref|YP_688404.1| ATP-dependent Clp protease ATP-binding subunit [Shigella flexneri 5
           str. 8401]
 gi|110614432|gb|ABF03099.1| ATP-binding component of serine protease [Shigella flexneri 5 str.
           8401]
          Length = 758

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/760 (51%), Positives = 537/760 (70%), Gaps = 22/760 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E  HE+ T+EHLLLAL+ +  A   + +C+VDL  L+  L  
Sbjct: 1   MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQELEA 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I+  +     +    + +PT SFQRV+QRAV HVQS+GR  VTGAN+LVA+FSE +S A
Sbjct: 61  FIEQTTPVLPASEEERDTQPTLSFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRK--EFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
            Y L++ E++  D VNFISHG  K +  + ++  S+ N +  + G +             
Sbjct: 121 AYLLRKHEVSRLDVVNFISHGTRKDEPTQSSDPGSQPNSEEQAGGEE------------- 167

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 +  +  +L +  + G +D L+GR +E+ R IQ+LCRR KNNPL VG+ GVGKTA
Sbjct: 168 -----RMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTA 222

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +IV G VP+++    I+SLD+G+L+AGT+YRGDFE+R K ++K++E   N+IL
Sbjct: 223 IAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSIL 282

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ASG  VDA+NL+KP LSSG +R IGSTTY E+   FEKD+AL RRFQ
Sbjct: 283 FIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQ 342

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KID++EPSIE+ ++I+ G+KP +E HH +RY+ +A+RAAV+L+V++   R LPDKAIDVI
Sbjct: 343 KIDITEPSIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAIDVI 402

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA   L P+SKR+K +   DI+  +A + R I   S S+ D   L NL   L  +V+
Sbjct: 403 DEAGARARLMPVSKRKKTVNVADIESVVARIAR-IPEKSVSQSDRDTLKNLSDRLKMLVF 461

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L+ +IK+ARAGL   +KP+G ++F+GPTGVGKTE++ QL+ ALG++LLRFDM
Sbjct: 462 GQDKAIEALTEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKALGIELLRFDM 521

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D+V ++P++V+LLDEIEK+HPDV NILLQ+M
Sbjct: 522 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVM 581

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+K  FRNV+L+MTTNAG  E  +  IG     N     E ++   +PEF 
Sbjct: 582 DTGTLTDNNGRKADFRNVVLVMTTNAGVRETERKSIGLIHQDNSTDAMEEIKKIFTPEFR 641

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  LS+D+I QVV KFI++L++QL +KG+S   S+E  NWL   GYD  MGA
Sbjct: 642 NRLDNIIWFDHLSTDVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGA 701

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKS 760
           RP+ R+I++++K PLA+E+LFG L  GG V  V+L+ +K+
Sbjct: 702 RPMARVIQDNLKKPLANELLFGSLVDGGQVT-VALDKEKN 740


>gi|198282815|ref|YP_002219136.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218666632|ref|YP_002425012.1| ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247336|gb|ACH82929.1| ATP-dependent Clp protease, ATP-binding subunit clpA
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518845|gb|ACK79431.1| ATP-dependent Clp protease, ATP-binding subunit ClpA
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 752

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/742 (52%), Positives = 533/742 (71%), Gaps = 20/742 (2%)

Query: 8   LEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDND 67
           LE+ ++QA  +A +  HEYA++EHLLLAL+D+ D   V+ +C  D   L   L  +++  
Sbjct: 6   LEQSINQAFQIARQYGHEYASVEHLLLALLDNPDGMDVLSACGADRTHLSVELRQFLERK 65

Query: 68  SSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQ 127
                  G  V  +P+  FQRV+QRA+ HVQS G+  V+GAN++VA+F+E +SHA YFLQ
Sbjct: 66  VPAMGPAG-TVNTQPSIGFQRVIQRALYHVQSAGKDAVSGANVIVAIFAERESHAVYFLQ 124

Query: 128 EQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPAL 187
           ++ +T  D VNF++HG+ K +     + ++       G   +                 L
Sbjct: 125 KEHVTRLDVVNFLAHGVRKDEVMDEEEEEVEGTTEKKGDSKD----------------PL 168

Query: 188 SAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAK 247
           +AY  +L    + G++D L+GR EE+ R +Q+L RR KNNPL+VG+PGVGKTAI EG A+
Sbjct: 169 TAYARNLNAMARAGRLDPLIGRQEELIRALQVLARRRKNNPLFVGEPGVGKTAIVEGLAR 228

Query: 248 QIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHT 307
            +V G VP++L  A I++LD+G LIAG+RYRGDFEER+K ++K +    N+IL+IDEIHT
Sbjct: 229 AVVAGKVPEMLENATIYALDLGALIAGSRYRGDFEERLKGVLKALRKKPNSILFIDEIHT 288

Query: 308 LVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEP 367
           L+GAG+ASG ++DASNLLKPAL+SG ++CIG+TTY E+RQ+FEKD+AL RRFQKIDV EP
Sbjct: 289 LIGAGAASGGAMDASNLLKPALASGELKCIGATTYQEFRQYFEKDRALTRRFQKIDVPEP 348

Query: 368 SIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQ 427
           S E++++I++G+K  FE+HH LRY+  A+RAAV+LSV+H   R LPDKAID+IDE GA+Q
Sbjct: 349 SQEESVQILRGLKGQFEQHHGLRYTDTALRAAVELSVKHIHDRHLPDKAIDLIDEVGAAQ 408

Query: 428 ILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIK 487
            L P+S+R+K I   DI++ +A + R I   S S DD   L NLE++LG V++GQE+AI 
Sbjct: 409 ALLPVSRRKKSIGVHDIEEMVARVAR-IPGKSVSTDDRQALKNLERDLGFVIFGQEKAIH 467

Query: 488 KLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERH 547
           +LS++IK+ARAGL    KP+G ++FSGPTGVGKTE+S+QLA  LG+ LLRFDMSEYMERH
Sbjct: 468 ELSAAIKMARAGLRHHEKPVGSFLFSGPTGVGKTELSRQLASLLGIPLLRFDMSEYMERH 527

Query: 548 AVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTD 607
            VSRLIGAPPGYVG  Q G L ++V +NP++V+LLDEIEK+HPD+ N+LLQ+MD+G LTD
Sbjct: 528 TVSRLIGAPPGYVGHDQAGQLTEAVSRNPHAVLLLDEIEKAHPDIFNVLLQVMDHGKLTD 587

Query: 608 QSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADK--EALRNFLSPEFLNRLDS 665
             G+ + FRNV+LIMTTNAGA    KA IGF ++   D  +  E +R   +PEF NRLD+
Sbjct: 588 AGGRTVDFRNVVLIMTTNAGAEARGKANIGFMNAPQSDGGQEMETIRRVFAPEFRNRLDA 647

Query: 666 IIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLER 725
           ++PF PLS + +  VV KF+M+L+ QL +KG S   S E+  WL   GYD +MGARP+ R
Sbjct: 648 VVPFTPLSKETVLHVVDKFVMELDEQLLQKGYSLEISAELRQWLADKGYDPQMGARPMTR 707

Query: 726 IIKEHVKVPLADEILFGKLKKG 747
           +I+EH+K PLA+ ILFG L KG
Sbjct: 708 MIQEHLKKPLAEHILFGDLPKG 729


>gi|114332014|ref|YP_748236.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Nitrosomonas
           eutropha C91]
 gi|114309028|gb|ABI60271.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Nitrosomonas
           eutropha C91]
          Length = 756

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/766 (50%), Positives = 547/766 (71%), Gaps = 21/766 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  LH A V + ++ HE+ T+EHLLLAL+D+  A  V+L+C VD++ L+ +L +
Sbjct: 1   MIAQELEVSLHMAFVESRQKRHEFITVEHLLLALLDNPSAIKVLLACTVDIEDLRKSLQD 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I   +     +G  V+ +PT  FQRV+QRA+LHVQS+G+  VTGAN+LVA+F E DSHA
Sbjct: 61  HIARHTPVVEGSG-DVDTQPTLGFQRVIQRAILHVQSSGKKEVTGANVLVAIFGEKDSHA 119

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLN 182
            YFLQ++  T  D VN+ISH I K  +  N +S+ N D + +     G            
Sbjct: 120 VYFLQQKGATRLDVVNYISHKIDKTAQ--NSESEKNEDSTDSEQRDSG------------ 165

Query: 183 LFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA 242
               L +Y ++L  +    ++D L+GR +E+ R IQ LCRR KNNPL VG+ GVGKTAIA
Sbjct: 166 --SPLESYTINLNSQAAANRIDPLIGREKEVERVIQTLCRRRKNNPLLVGEAGVGKTAIA 223

Query: 243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI 302
           EG A++I +  VPD+L   ++++LDMG L+AGT+YRGDFE+R+K ++K++     AIL+I
Sbjct: 224 EGLARRITENRVPDVLANHQVYALDMGALLAGTKYRGDFEQRLKAVLKQLTDNPKAILFI 283

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DEIHTL+GAG+ASG ++DASNLLKPALSSG ++CIG+TTY+EYR  FEKD AL RRFQKI
Sbjct: 284 DEIHTLIGAGAASGGTLDASNLLKPALSSGQLKCIGATTYNEYRGIFEKDHALSRRFQKI 343

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
           D+SEP I + +EI++G+K  +E+HH +RY++ A+ AA +LS R    R LPDKAIDVIDE
Sbjct: 344 DISEPDISETVEILRGLKSRYEKHHNVRYTEVALTAAAELSARFINDRHLPDKAIDVIDE 403

Query: 423 AGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ 482
           AGA+Q + P S++RK I +++I+  IA + R I   + S DD + L  L+++L  +V+GQ
Sbjct: 404 AGAAQRVLPKSRQRKIIGKQEIEHVIAGIAR-IPPQNVSNDDRNKLKTLDRDLKAIVFGQ 462

Query: 483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE 542
           + AI  L+++IK+AR+GL +  KPIG ++FSGPTGVGKTE+++QLA+ LG+ L RFDMSE
Sbjct: 463 DAAIDALTAAIKMARSGLGNTGKPIGSFLFSGPTGVGKTEVARQLAYILGIPLHRFDMSE 522

Query: 543 YMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY 602
           YMERHAVSRL+GAPPGYVGF QGG+L +++ + P++V+L DEIEK+HPD+ N++LQIMDY
Sbjct: 523 YMERHAVSRLVGAPPGYVGFDQGGLLTETIIKQPHAVLLFDEIEKAHPDIFNVMLQIMDY 582

Query: 603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR 662
           G LTD +G+K  FRNVI+IMTTNAGA  ++K  IGF        +   ++   +PEF NR
Sbjct: 583 GTLTDNNGRKADFRNVIIIMTTNAGADTLTKTVIGFTKHAKSGDEMIEIKRLFTPEFRNR 642

Query: 663 LDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP 722
           LD+II F PL   II +VV KF+++LE QLQEK +   F++ + + L SHG+D  MGARP
Sbjct: 643 LDAIISFAPLGEAIILRVVDKFLIELEAQLQEKKVDVTFTDNLRSHLASHGFDPLMGARP 702

Query: 723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFE 768
           + R+I++ ++  LADE+LFG+L  GG   KV+++  +   + + FE
Sbjct: 703 MARLIQDIIRRALADELLFGQLVNGG---KVTVDIGEDGKAVLTFE 745


>gi|323937989|gb|EGB34251.1| ATP-dependent Clp protease ATP-binding ClpA [Escherichia coli
           E1520]
          Length = 758

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/760 (51%), Positives = 538/760 (70%), Gaps = 22/760 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E  HE+ T+EHLLLAL+ +  A   + +C+VDL  L+  L  
Sbjct: 1   MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQELEA 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I+  +     +    + +PT SFQRV+QRAV HVQS+GR  VTGAN+LVA+FSE +S A
Sbjct: 61  FIEQTTPVLPASEEERDTQPTLSFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRK--EFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
            Y L++ E++  D VNFISHG  K +  + ++  S+ N +  + G +             
Sbjct: 121 AYLLRKHEVSRLDVVNFISHGTRKDEPTQSSDPGSQPNSEEQAGGEE------------- 167

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 +  +  +L +  + G +D L+GR +E+ R IQ+LCRR KNNPL VG+ GVGKTA
Sbjct: 168 -----RMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTA 222

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +IV G VP+++    I+SLD+G+L+AGT+YRGDFE+R K ++K++E   N+IL
Sbjct: 223 IAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSIL 282

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ASG  VDA+NL+KP LSSG +R IGSTTY E+   FEKD+AL RRFQ
Sbjct: 283 FIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQ 342

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KID++EPSIE+ ++I+ G+KP +E HH +RY+ +A+RAAV+L+V++   R LPDKAIDVI
Sbjct: 343 KIDITEPSIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAIDVI 402

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA   L P+SKR+K +   DI+  +A + R I   S S+ D   L NL+  L  +V+
Sbjct: 403 DEAGARARLMPVSKRKKTVNVADIESVVARIAR-IPEKSVSQSDRDTLKNLDDRLKMLVF 461

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L+ +IK+ARAGL   +KP+G ++F+GPTGVGKTE++ QL+ ALG++LLRFDM
Sbjct: 462 GQDKAIEALTEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKALGIELLRFDM 521

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D+V ++P++V+LLDEIEK+HPDV NILLQ+M
Sbjct: 522 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVM 581

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+K  FRNV+L+MTTNAG  E  +  IG     N     E ++   +PEF 
Sbjct: 582 DNGTLTDNNGRKADFRNVVLVMTTNAGVRETERKSIGLIHQDNSTDAMEEIKKIFTPEFR 641

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  LS+D+I QVV KFI++L++QL +KG+S   S+E  NWL   GYD  MGA
Sbjct: 642 NRLDNIIWFDHLSTDVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGA 701

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKS 760
           RP+ R+I++++K PLA+E+LFG L  GG V  V+L+ +K+
Sbjct: 702 RPMARVIQDNLKKPLANELLFGSLVDGGQVT-VALDKEKN 740


>gi|238893944|ref|YP_002918678.1| ATP-dependent Clp protease ATP-binding subunit [Klebsiella
           pneumoniae NTUH-K2044]
 gi|238546260|dbj|BAH62611.1| ATP-dependent clp protease ATP-binding subunit [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 764

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/762 (51%), Positives = 536/762 (70%), Gaps = 21/762 (2%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           +   ++ LE  L+ A   A E  HE+ T+EHLLLAL+ +  A   + +C+VDL  L+  L
Sbjct: 4   VPMLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQEL 63

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
             +I+  +          + +PT SFQRV+QRAV HVQS+GR  VTGAN+LVA+FSE +S
Sbjct: 64  EAFIEQTTPVLPATEEERDTQPTLSFQRVLQRAVFHVQSSGRSEVTGANVLVAIFSEQES 123

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFV--NDYQAK 178
            A Y L++ E++  D VNFISHG  K             D  S  SD  G    N+ QA 
Sbjct: 124 QAAYLLRKHEVSRLDVVNFISHGTRK-------------DEPSQSSDNSGSQPGNEEQAG 170

Query: 179 TDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGK 238
            +      +  +  +L +  + G +D L+GR +E+ R IQ+LCRR KNNPL VG+ GVGK
Sbjct: 171 GE----ERMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGK 226

Query: 239 TAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA 298
           TAIAEG A +IV G VP+++    I+SLD+G+L+AGT+YRGDFE+R K ++K++E   N+
Sbjct: 227 TAIAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNS 286

Query: 299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRR 358
           IL+IDEIHT++GAG+ASG  VDA+NL+KP LSSG +R IGSTTY E+   FEKD+AL RR
Sbjct: 287 ILFIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARR 346

Query: 359 FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID 418
           FQKID++EPS+E+ ++I+ G+KP +E HH +RY+ +A+RAAV+L+V++   R LPDKAID
Sbjct: 347 FQKIDITEPSVEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAID 406

Query: 419 VIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTV 478
           VIDEAGA   L P+SKR+K +   DI+  +A + R I   S SR D   L NL   L  +
Sbjct: 407 VIDEAGARARLMPVSKRKKTVNVADIESVVARIAR-IPEKSVSRSDRDTLKNLGDRLKML 465

Query: 479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF 538
           V+GQ++AI+ L+ +IK+ARAGL   +KP+G ++F+GPTGVGKTE++ QLA ALG++LLRF
Sbjct: 466 VFGQDKAIEALTEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLAKALGIELLRF 525

Query: 539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQ 598
           DMSEYMERH VSRLIGAPPGYVGF QGG+L D+V ++P++V+LLDEIEK+HPDV N+LLQ
Sbjct: 526 DMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNLLLQ 585

Query: 599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE 658
           +MD G LTD +G+K  FRNV+L+MTTNAG  E  +  IG     N     + ++   +PE
Sbjct: 586 VMDNGTLTDNNGRKADFRNVVLVMTTNAGVRETERKSIGLIQQDNSPDAMDEIKKIFTPE 645

Query: 659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKM 718
           F NRLD+II F  LS+ +I QVV KFI++L++QL +KG+S   S+E  +WL + GYD  M
Sbjct: 646 FRNRLDNIIWFDHLSTTVIHQVVDKFIVELQVQLDQKGVSLEVSQEARDWLATKGYDRAM 705

Query: 719 GARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKS 760
           GARP+ R+I++++K PLA+E+LFG L  GG V  VSL+ DK+
Sbjct: 706 GARPMGRVIQDNLKKPLANELLFGSLVDGGQVT-VSLDSDKN 746


>gi|323967318|gb|EGB62741.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Escherichia
           coli M863]
 gi|323976731|gb|EGB71819.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Escherichia
           coli TW10509]
 gi|327253670|gb|EGE65299.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Escherichia
           coli STEC_7v]
          Length = 758

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/760 (51%), Positives = 537/760 (70%), Gaps = 22/760 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E  HE+ T+EHLLLAL+ +  A   + +C+VDL  L+  L  
Sbjct: 1   MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQELEA 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I+  +     +    + +PT SFQRV+QRAV HVQS+GR  VTGAN+LVA+FSE +S A
Sbjct: 61  FIEQTTPVLPASEEERDTQPTLSFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRK--EFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
            Y L++ E++  D VNFISHG  K +  + ++  S+ N +  + G +             
Sbjct: 121 AYLLRKHEVSRLDVVNFISHGTRKDEPTQSSDPGSQPNSEEQAGGEE------------- 167

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 +  +  +L +  + G +D L+GR +E+ R IQ+LCRR KNNPL VG+ GVGKTA
Sbjct: 168 -----RMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTA 222

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +IV G VP+++    I+SLD+G+L+AGT+YRGDFE+R K ++K++E   N+IL
Sbjct: 223 IAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSIL 282

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ASG  VDA+NL+KP LSSG +R IGSTTY E+   FEKD+AL RRFQ
Sbjct: 283 FIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQ 342

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KID++EPSIE+ ++I+ G+KP +E HH +RY+ +A+RAAV+L+V++   R LPDKAIDVI
Sbjct: 343 KIDITEPSIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAIDVI 402

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA   L P+SKR+K +   DI+  +A + R I   S S+ D   L NL   L  +V+
Sbjct: 403 DEAGARARLMPVSKRKKTVNVADIESVVARIAR-IPEKSVSQSDRDTLKNLSDRLKMLVF 461

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L+ +IK+ARAGL   +KP+G ++F+GPTGVGKTE++ QL+ ALG++LLRFDM
Sbjct: 462 GQDKAIEALTEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKALGIELLRFDM 521

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D+V ++P++V+LLDEIEK+HPDV NILLQ+M
Sbjct: 522 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVM 581

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+K  FRNV+L+MTTNAG  E  +  IG     N     E ++   +PEF 
Sbjct: 582 DNGTLTDNNGRKADFRNVVLVMTTNAGVRETERKSIGLIHQDNSTDAMEEIKKIFTPEFR 641

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  LS+D+I QVV KFI++L++QL +KG+S   S+E  NWL   GYD  MGA
Sbjct: 642 NRLDNIIWFDHLSTDVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGA 701

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKS 760
           RP+ R+I++++K PLA+E+LFG L  GG V  V+L+ +K+
Sbjct: 702 RPMARVIQDNLKKPLANELLFGSLVDGGQVT-VALDKEKN 740


>gi|152969472|ref|YP_001334581.1| ATP-dependent Clp protease ATP-binding subunit [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|329998511|ref|ZP_08303133.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Klebsiella sp.
           MS 92-3]
 gi|150954321|gb|ABR76351.1| ATP-binding component of serine protease [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|328538656|gb|EGF64753.1| ATP-dependent Clp protease ATP-binding subunit ClpA [Klebsiella sp.
           MS 92-3]
          Length = 759

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/760 (51%), Positives = 535/760 (70%), Gaps = 21/760 (2%)

Query: 3   FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLN 62
             ++ LE  L+ A   A E  HE+ T+EHLLLAL+ +  A   + +C+VDL  L+  L  
Sbjct: 1   MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQELEA 60

Query: 63  YIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHA 122
           +I+  +          + +PT SFQRV+QRAV HVQS+GR  VTGAN+LVA+FSE +S A
Sbjct: 61  FIEQTTPVLPATEEERDTQPTLSFQRVLQRAVFHVQSSGRSEVTGANVLVAIFSEQESQA 120

Query: 123 TYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFV--NDYQAKTD 180
            Y L++ E++  D VNFISHG  K             D  S  SD  G    N+ QA  +
Sbjct: 121 AYLLRKHEVSRLDVVNFISHGTRK-------------DEPSQSSDNSGSQPGNEEQAGGE 167

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
                 +  +  +L +  + G +D L+GR +E+ R IQ+LCRR KNNPL VG+ GVGKTA
Sbjct: 168 ----ERMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTA 223

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEG A +IV G VP+++    I+SLD+G+L+AGT+YRGDFE+R K ++K++E   N+IL
Sbjct: 224 IAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSIL 283

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           +IDEIHT++GAG+ASG  VDA+NL+KP LSSG +R IGSTTY E+   FEKD+AL RRFQ
Sbjct: 284 FIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQ 343

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KID++EPS+E+ ++I+ G+KP +E HH +RY+ +A+RAAV+L+V++   R LPDKAIDVI
Sbjct: 344 KIDITEPSVEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAIDVI 403

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGA   L P+SKR+K +   DI+  +A + R I   S SR D   L NL   L  +V+
Sbjct: 404 DEAGARARLMPVSKRKKTVNVADIESVVARIAR-IPEKSVSRSDRDTLKNLGDRLKMLVF 462

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ++AI+ L+ +IK+ARAGL   +KP+G ++F+GPTGVGKTE++ QLA ALG++LLRFDM
Sbjct: 463 GQDKAIEALTEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLAKALGIELLRFDM 522

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEYMERH VSRLIGAPPGYVGF QGG+L D+V ++P++V+LLDEIEK+HPDV N+LLQ+M
Sbjct: 523 SEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNLLLQVM 582

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           D G LTD +G+K  FRNV+L+MTTNAG  E  +  IG     N     + ++   +PEF 
Sbjct: 583 DNGTLTDNNGRKADFRNVVLVMTTNAGVRETERKSIGLIQQDNSPDAMDEIKKIFTPEFR 642

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLD+II F  LS+ +I QVV KFI++L++QL +KG+S   S+E  +WL + GYD  MGA
Sbjct: 643 NRLDNIIWFDHLSTTVIHQVVDKFIVELQVQLDQKGVSLEVSQEARDWLATKGYDRAMGA 702

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKS 760
           RP+ R+I++++K PLA+E+LFG L  GG V  VSL+ DK+
Sbjct: 703 RPMGRVIQDNLKKPLANELLFGSLVDGGQVT-VSLDSDKN 741


>gi|307311730|ref|ZP_07591370.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Escherichia
           coli W]
 gi|306908285|gb|EFN38784.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Escherichia
           coli W]
 gi|315060168|gb|ADT74495.1| ATPase and specificity subunit of ClpA-ClpP ATP-dependent serine
           protease, chape