RPSBLAST alignment for GI: 254780163 and conserved domain: KOG1051

>gnl|CDD|36269 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]. Length = 898
 Score =  224 bits (571), Expect = 9e-59
 Identities = 126/347 (36%), Positives = 190/347 (54%), Gaps = 23/347 (6%)

Query: 413 PDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLE 472
            D   +     G                E DI + + S    I     +  +   L  LE
Sbjct: 499 NDYTRETDLRYGRIPDELSEKSNDNQGGESDISE-VVSRWTGIPVDRLAEAEAERLKKLE 557

Query: 473 KNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA---F 529
           + L   V GQ+EA+  ++++I+ +RAGL DPN P   ++F GP GVGKTE++K LA   F
Sbjct: 558 ERLHERVIGQDEAVAAIAAAIRRSRAGLKDPN-PDAWFLFLGPDGVGKTELAKALAEYVF 616

Query: 530 ALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSH 589
                 +R DMSE+ E   VS+LIG+PPGYVG  +GG L ++V + PYSVVL +EIEK+H
Sbjct: 617 GSEENFIRLDMSEFQE---VSKLIGSPPGYVGKEEGGQLTEAVKRRPYSVVLFEEIEKAH 673

Query: 590 PDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALE-MSKARIGFGSSRND---- 644
           PDVLNILLQ++D G LTD  G+++ F+N I IMT+N G+    + A +       D    
Sbjct: 674 PDVLNILLQLLDRGRLTDSHGREVDFKNAIFIMTSNVGSSAIANDASLEEKLLDMDEKRG 733

Query: 645 ----------DADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQE 694
                     DA +   + F   EFLNR+D +    PL  D + ++V+K + ++E +L+E
Sbjct: 734 SYRLKKVQVSDAVRIYNKQFFRKEFLNRIDELDLNLPLDRDELIEIVNKQLTEIEKRLEE 793

Query: 695 KGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILF 741
           + +    ++ V + ++  GYD   GARP++R I+E  +  LA+ +L 
Sbjct: 794 RELLLLVTDRVDDKVLFKGYDFDYGARPIKRSIEERFENRLAEALLG 840