RPSBLAST alignment for GI: 254780163 and conserved domain: cd00009

>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.. Length = 151
 Score = 83.3 bits (206), Expect = 2e-16
 Identities = 40/158 (25%), Positives = 60/158 (37%), Gaps = 14/158 (8%)

Query: 207 VGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSL 266
           VG+ E I    + L      N L  G PG GKT +A   A ++          GA    L
Sbjct: 1   VGQEEAIEALREALELPPPKNLLLYGPPGTGKTTLARAIANEL-------FRPGAPFLYL 53

Query: 267 DMGNLIAGTRYRGDFEERIKKIVKEIESYA-NAILYIDEIHTLVGAGSASGISVDASNLL 325
           +  +L+ G      F   + +++ E+   A   +L+IDEI +L  +  A    +     L
Sbjct: 54  NASDLLEGLVVAELFGHFLVRLLFELAEKAKPGVLFIDEIDSL--SRGAQNALLRVLETL 111

Query: 326 KPAL-SSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
                    VR IG+T           D+AL  R    
Sbjct: 112 NDLRIDRENVRVIGATNRPLLGDL---DRALYDRLDIR 146