Query gi|254780164|ref|YP_003064577.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus Liberibacter asiaticus str. psy62] Match_columns 138 No_of_seqs 145 out of 946 Neff 4.6 Searched_HMMs 39220 Date Mon May 23 15:18:22 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780164.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 COG2127 Uncharacterized conser 100.0 5E-35 1.3E-39 220.9 11.4 94 45-138 14-107 (107) 2 PRK00033 clpS ATP-dependent Cl 100.0 2E-30 5.2E-35 194.5 9.3 79 44-122 4-82 (83) 3 PRK13019 clpS ATP-dependent Cl 100.0 4E-30 1E-34 192.9 9.7 84 41-124 5-89 (96) 4 pfam02617 ClpS ATP-dependent C 100.0 3.5E-28 8.9E-33 181.7 9.6 78 54-135 1-78 (78) 5 cd02149 NfsB_like_nitroreducta 63.6 13 0.00033 18.3 4.4 33 88-122 92-124 (157) 6 cd02062 Nitro_FMN_reductase Pr 57.5 8.1 0.00021 19.5 2.3 37 88-124 73-109 (122) 7 KOG0622 consensus 55.8 18 0.00045 17.6 6.5 72 58-133 165-249 (448) 8 cd02143 NADH_nitroreductase Ni 52.5 20 0.00051 17.2 6.4 48 60-116 62-109 (147) 9 cd02138 Nitroreductase_2 Nitro 49.2 19 0.00049 17.3 3.1 34 88-123 106-139 (181) 10 KOG2599 consensus 38.9 3.7 9.6E-05 21.4 -1.8 58 58-115 135-194 (308) 11 cd02139 Nitroreductase_3 Nitro 38.7 26 0.00066 16.6 2.4 33 89-123 100-132 (164) 12 pfam07905 PucR Purine cataboli 34.5 39 0.001 15.6 3.5 79 55-134 22-104 (122) 13 cd02148 Nitroreductase_5 Nitro 33.6 32 0.00081 16.1 2.2 32 89-122 120-151 (185) 14 PRK03600 nrdI ribonucleotide r 29.6 48 0.0012 15.1 4.3 71 54-136 38-110 (136) 15 pfam10609 ParA ParA/MinD ATPas 28.8 49 0.0013 15.0 6.7 49 87-136 13-61 (81) 16 cd02137 Nitroreductase_1 Nitro 28.2 42 0.0011 15.4 2.1 26 88-113 84-109 (148) 17 PRK10977 hypothetical protein; 27.5 52 0.0013 14.9 4.4 72 38-109 158-232 (510) 18 cd03370 NADH_oxidase NADPH_oxi 26.6 54 0.0014 14.8 5.3 43 88-133 93-135 (156) 19 KOG0131 consensus 26.4 54 0.0014 14.8 5.4 37 98-135 49-85 (203) 20 PRK10765 nitroreductase A; Pro 26.4 55 0.0014 14.8 2.9 33 89-121 111-143 (240) 21 cd02135 Arsenite_oxidase Nitro 26.3 35 0.0009 15.8 1.4 35 89-123 112-146 (160) 22 pfam07972 Flavodoxin_NdrI NrdI 25.9 56 0.0014 14.7 4.3 72 54-136 36-108 (121) 23 PRK05365 hypothetical protein; 25.1 58 0.0015 14.6 2.5 27 89-115 125-151 (193) 24 cd02142 mcbC-like_oxidoreducta 23.8 60 0.0015 14.5 2.2 44 88-133 132-175 (180) 25 TIGR03553 F420_FbiB_CTERM F420 23.7 48 0.0012 15.1 1.7 35 89-123 126-160 (194) 26 cd02146 NfsA_FRP This family c 23.5 62 0.0016 14.5 2.4 35 88-122 112-146 (229) 27 TIGR01839 PHA_synth_II poly(R) 22.4 54 0.0014 14.8 1.8 33 55-87 388-421 (560) 28 cd02136 Nitroreductase Nitrore 20.5 72 0.0018 14.1 4.4 35 89-123 109-143 (178) No 1 >COG2127 Uncharacterized conserved protein [Function unknown] Probab=100.00 E-value=5e-35 Score=220.88 Aligned_cols=94 Identities=45% Similarity=0.721 Sum_probs=89.6 Q ss_pred CHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHH Q ss_conf 10100010026899748999718988489999999998299989999999998237968999638999999999999999 Q gi|254780164|r 45 DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYS 124 (138) Q Consensus 45 ~~~~~~~~k~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~A 124 (138) ....+.++++++|++|+|||+|||||+|||||.+|++||+++.++|++||++||++|+||||+|++|+||+|+.|++++| T Consensus 14 ~~~~~~~t~~~~p~~ykVillNDd~T~mefVv~vL~~~F~~s~e~A~~lMl~VH~~G~av~gv~t~evAEtk~~~v~~~g 93 (107) T COG2127 14 LVKRKTKTKTKPPKMYKVILLNDDYTPMEFVVYVLQKFFGMSEERATKLMLQVHREGKAVVGVYTREVAETKVAQVRDAG 93 (107) T ss_pred CCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHH T ss_conf 21245775667997336898569985899999999999565999999999999866967999702799999999999999 Q ss_pred HHCCCCEEEEEECC Q ss_conf 97599817986119 Q gi|254780164|r 125 RQHQYPLQCIMEQK 138 (138) Q Consensus 125 r~~~~PL~~~iE~e 138 (138) |.++|||+|++|++ T Consensus 94 ~~~~~pl~~~~e~~ 107 (107) T COG2127 94 LEATHPLLCTMEEE 107 (107) T ss_pred HHCCCCHHHHCCCC T ss_conf 97259745640679 No 2 >PRK00033 clpS ATP-dependent Clp protease adaptor protein ClpS; Reviewed Probab=99.97 E-value=2e-30 Score=194.51 Aligned_cols=79 Identities=42% Similarity=0.629 Sum_probs=74.4 Q ss_pred CCHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHH Q ss_conf 2101000100268997489997189884899999999982999899999999982379689996389999999999999 Q gi|254780164|r 44 LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122 (138) Q Consensus 44 ~~~~~~~~~k~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~ 122 (138) ..+..+.++++++||+|+|||||||+|||||||.+|+++|+++.++|.+||++||++|+|+||+|++|+||+|+.|++. T Consensus 4 ~~v~e~~~~~~k~p~~ykVil~NDd~ttmefVi~vL~~vf~~~~~~A~~iml~vH~~G~avvg~~~~E~AE~k~~qvh~ 82 (83) T PRK00033 4 TLVLEKVETVLKPPPMYKVLLHNDDYNPMEYVVYVLQKFFGYSEERATQLMLEVHNEGKAVVGVGTREVAETKVEQVHQ 82 (83) T ss_pred CEEEEECCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHC T ss_conf 4466521334579997189998899996899999999998889999999999970079689998278999999999854 No 3 >PRK13019 clpS ATP-dependent Clp protease adaptor; Reviewed Probab=99.96 E-value=4e-30 Score=192.86 Aligned_cols=84 Identities=23% Similarity=0.349 Sum_probs=77.9 Q ss_pred CCCCCHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHH-CCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHH Q ss_conf 6532101000100268997489997189884899999999982-999899999999982379689996389999999999 Q gi|254780164|r 41 DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119 (138) Q Consensus 41 d~~~~~~~~~~~k~k~P~~YkVIL~NDd~ttmefVi~vL~~vf-~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~q 119 (138) ++....+++.++++++||+|+|||||||+|||||||.+|+++| +++.++|.+||++||++|+|+||+|++|+||+|+.| T Consensus 5 ~p~~~p~~~~~~~~~~p~~ykVil~NDd~tt~e~Vi~~L~~vf~~~t~~~A~~im~~vH~~G~avv~~~~~E~AE~k~~q 84 (96) T PRK13019 5 DPSTKPKTKTKTKRERYPLYKVIVLNDDFNTFEHVVNCLKKIIPGMSEDRAWKLMITAHKEGSAVVWVGPLEQAELYHQQ 84 (96) T ss_pred CCCCCCCCEECCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHH T ss_conf 88756560101123589950799986999978999999999965999999999999966388489999679999999999 Q ss_pred HHHHH Q ss_conf 99999 Q gi|254780164|r 120 VMNYS 124 (138) Q Consensus 120 v~~~A 124 (138) +++.+ T Consensus 85 l~~~G 89 (96) T PRK13019 85 LTDAG 89 (96) T ss_pred HHHCC T ss_conf 99687 No 4 >pfam02617 ClpS ATP-dependent Clp protease adaptor protein ClpS. In the bacterial cytosol, ATP-dependent protein degradation is performed by several different chaperone-protease pairs, including ClpAP. ClpS directly influences the ClpAP machine by binding to the N-terminal domain of the chaperone ClpA. The degradation of ClpAP substrates, both SsrA-tagged proteins and ClpA itself, is specifically inhibited by ClpS. ClpS modifies ClpA substrate specificity, potentially redirecting degradation by ClpAP toward aggregated proteins. Probab=99.95 E-value=3.5e-28 Score=181.74 Aligned_cols=78 Identities=49% Similarity=0.770 Sum_probs=74.2 Q ss_pred CCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEE Q ss_conf 26899748999718988489999999998299989999999998237968999638999999999999999975998179 Q gi|254780164|r 54 VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQC 133 (138) Q Consensus 54 ~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~~ 133 (138) +++||+|+|||||||+|||||||.+|+++|+++.++|.++|++||++|+|+||+|++|+||+|+.++++.+| ||+| T Consensus 1 ~~~p~~y~Vil~NDd~~t~e~Vi~~L~~~~~~~~~~A~~~~~~vh~~G~avv~~~~~e~Ae~k~~~v~~~g~----PL~~ 76 (78) T pfam02617 1 LKPPPMYKVILLNDDYTTMEFVVEVLQKVFGMSEEQATQIMLEVHKEGRAVVGVGTREIAETKVAQVHAYGR----PLRA 76 (78) T ss_pred CCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCEEEEEEECHHHHHHHHHHHHHCCC----CCEE T ss_conf 999997179998699986999999999997899999999999853587089999469999999999996497----8354 Q ss_pred EE Q ss_conf 86 Q gi|254780164|r 134 IM 135 (138) Q Consensus 134 ~i 135 (138) ++ T Consensus 77 ti 78 (78) T pfam02617 77 TI 78 (78) T ss_pred EC T ss_conf 59 No 5 >cd02149 NfsB_like_nitroreductase NAD(P)H:FMN oxidoreductase family. This domain catalyzes the reduction of flavin, nitrocompound, quinones and azo compounds using NADH or NADPH as an electron donor. The enzyme is a homodimer, and each monomer binds a FMN as co-factor. This family includes FRase I in Vibrio fischeri, wihich reduces FMN into FMNH2 as part of the bioluminescent reaction. The family also includes oxygen-insensitive nitroreductases that use NADH or NADPH as an electron donor in the ping pong bi bi mechanism. This type of nitroreductase can be used in cancer chemotherapy to activate a range of prodrugs. Probab=63.57 E-value=13 Score=18.35 Aligned_cols=33 Identities=15% Similarity=0.432 Sum_probs=25.5 Q ss_pred HHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHH Q ss_conf 99999999982379689996389999999999999 Q gi|254780164|r 88 ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122 (138) Q Consensus 88 e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~ 122 (138) -.+..+|+.++..|.|.|+++.|+.++ +.++.. T Consensus 92 ia~~~~~LaA~~~Glgsc~i~~fd~~~--v~~~l~ 124 (157) T cd02149 92 IALGNMLLAAASLGIDSCPIEGFDPAK--LDEILG 124 (157) T ss_pred HHHHHHHHHHHHCCCCCCCCCCCCHHH--HHHHHC T ss_conf 999999999998498972266819999--999949 No 6 >cd02062 Nitro_FMN_reductase Proteins of this family catalyze the reduction of flavin or nitrocompounds using NAD(P)H as electron donor in a obligatory two-electron transfer, utilizing FMN or FAD as cofactor. They are often found to be homodimers. Enzymes of this family are described as NAD(P)H:FMN oxidoreductases, oxygen-insensitive nitroreductase, flavin reductase P, dihydropteridine reductase, NADH oxidase or NADH dehydrogenase. Probab=57.55 E-value=8.1 Score=19.51 Aligned_cols=37 Identities=22% Similarity=0.490 Sum_probs=29.3 Q ss_pred HHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHH Q ss_conf 9999999998237968999638999999999999999 Q gi|254780164|r 88 ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYS 124 (138) Q Consensus 88 e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~A 124 (138) -.++.+|+.++..|-|.|+...+...+.++.++.+.- T Consensus 73 ~a~~n~~laa~~~Glgt~~~~~~~~~~~~v~~~l~lp 109 (122) T cd02062 73 IAAQNILLAAHALGLGSCWIGGLDLVEEELRELLGIP 109 (122) T ss_pred HHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHCCCC T ss_conf 9999999999987906497746441249999981909 No 7 >KOG0622 consensus Probab=55.84 E-value=18 Score=17.56 Aligned_cols=72 Identities=14% Similarity=0.136 Sum_probs=54.1 Q ss_pred CCEEEEEE-CCCCCHHHHHH-HHHHHHHCCCHHHHHHHHHHHHCCCCEEEEEC-----------CHHHHHHHHHHHHHHH Q ss_conf 97489997-18988489999-99999829998999999999823796899963-----------8999999999999999 Q gi|254780164|r 58 KLYRVLLV-NDNYTPMEFVI-HVLQNFFYKDHETAKCIMLKVHHQGIGECGVY-----------AYEIAEMKVNQVMNYS 124 (138) Q Consensus 58 ~~YkVIL~-NDd~ttmefVi-~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~-----------~~E~AE~k~~qv~~~A 124 (138) |--++||- +-|+. +. -.|-.-||++.+++.+++..++..|.-|+|++ .|-.|-..+-++-+.+ T Consensus 165 P~a~llLrIatdds----~a~~~l~~KFG~~~~~~~~lLd~ak~l~lnvvGvsfHvGSgc~d~~~y~~Ai~dAr~vfd~g 240 (448) T KOG0622 165 PNANLLLRIATDDS----TATCRLNLKFGCSLDNCRHLLDMAKELELNVVGVSFHVGSGCTDLQAYRDAISDARNVFDMG 240 (448) T ss_pred CCCEEEEEECCCCC----CCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHH T ss_conf 97338999736887----45555667568777899999999987186588899872588787899999999999999999 Q ss_pred HHCCCCEEE Q ss_conf 975998179 Q gi|254780164|r 125 RQHQYPLQC 133 (138) Q Consensus 125 r~~~~PL~~ 133 (138) ++.||+..+ T Consensus 241 ~e~Gf~m~~ 249 (448) T KOG0622 241 AELGFEMDI 249 (448) T ss_pred HHCCCEEEE T ss_conf 861862788 No 8 >cd02143 NADH_nitroreductase Nitroreductase family. Members of this family utilize FMN as a cofactor. This family is involved in the reduction of flavin or nitroaromatic compounds by using NAD(P)H as electron donor in a obligatory two-electron transfer. Nitrogenase is homodimer. Each subunit contains one FMN molecule. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase. Probab=52.49 E-value=20 Score=17.24 Aligned_cols=48 Identities=17% Similarity=0.135 Sum_probs=31.9 Q ss_pred EEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHH Q ss_conf 489997189884899999999982999899999999982379689996389999999 Q gi|254780164|r 60 YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116 (138) Q Consensus 60 YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k 116 (138) +-++++.|+..+..++-.. -.|..+++.+|..|.|.||++.+..+... T Consensus 62 ~~i~v~~~~~~~~~~~D~~---------~a~~n~~LaA~~~GlGscw~g~~~~~~~~ 109 (147) T cd02143 62 HLLLASAPRDFPTAQVDAI---------IALTYFELAAQALGLGTCWAGFFQAAAEL 109 (147) T ss_pred EEEEEECCCCCCCCHHHHH---------HHHHHHHHHHHHCCCCEEEECCHHHHHHH T ss_conf 8999981777872120399---------99999999999879987776506554322 No 9 >cd02138 Nitroreductase_2 Nitroreductase-like family 2. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase. Probab=49.18 E-value=19 Score=17.35 Aligned_cols=34 Identities=12% Similarity=0.212 Sum_probs=26.2 Q ss_pred HHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHH Q ss_conf 999999999823796899963899999999999999 Q gi|254780164|r 88 ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123 (138) Q Consensus 88 e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~ 123 (138) -.+..+|+.++..|.+.|+++.++.. ++.++.+. T Consensus 106 ~A~~~l~LaA~~lGl~s~~i~~~~~~--~v~~~l~l 139 (181) T cd02138 106 AAWGNLALQATAMGLAAHQMGGFDAD--KAREELNI 139 (181) T ss_pred HHHHHHHHHHHHCCCCEEEECCCCHH--HHHHHHCC T ss_conf 99999999999869836547672999--99999683 No 10 >KOG2599 consensus Probab=38.92 E-value=3.7 Score=21.42 Aligned_cols=58 Identities=26% Similarity=0.488 Sum_probs=48.8 Q ss_pred CCEEEEE--ECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHH Q ss_conf 9748999--718988489999999998299989999999998237968999638999999 Q gi|254780164|r 58 KLYRVLL--VNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115 (138) Q Consensus 58 ~~YkVIL--~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~ 115 (138) |.||=++ +-|=.||=.|=.+.|.-.--.|+++|.+.+-..|.+|...|.+.+++.-|. T Consensus 135 pvYr~~i~~ladiiTPNqFE~EiLtg~~I~t~eda~~a~~~lhq~~v~~vVITS~~~~~~ 194 (308) T KOG2599 135 PVYRDLIIPLADIITPNQFEAEILTGMEIRTEEDAKRAVEKLHQKGVKTVVITSFDLGEF 194 (308) T ss_pred HHHHHHHCCHHHHCCCCCHHHHHHCCCEECCHHHHHHHHHHHHHHCCCEEEEEEEEECCC T ss_conf 999986302555107761111143287424499999999999974898799974430788 No 11 >cd02139 Nitroreductase_3 Nitroreductase-like family 3. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase. Probab=38.70 E-value=26 Score=16.60 Aligned_cols=33 Identities=18% Similarity=0.471 Sum_probs=24.2 Q ss_pred HHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHH Q ss_conf 99999999823796899963899999999999999 Q gi|254780164|r 89 TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123 (138) Q Consensus 89 ~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~ 123 (138) .+..+|+.++..|.|.|+++.++. ..+.++.+. T Consensus 100 a~~n~~Laa~~~Glgs~~~~~~~~--~~v~~~l~i 132 (164) T cd02139 100 AMEHMMLAAAELGLGTCWIGAFDE--DEIKEALDI 132 (164) T ss_pred HHHHHHHHHHHCCCCEEECCCCCH--HHHHHHCCC T ss_conf 999999999986989884166487--999997394 No 12 >pfam07905 PucR Purine catabolism regulatory protein-like family. The bacterial proteins found in this family are similar to the purine catabolism regulatory protein expressed by Bacillus subtilis (PucR). PucR is thought to be a transcriptional activator involved in the induction of the purine degradation pathway, and may contain a LysR-like DNA-binding domain. It is similar to LysR-type regulators in that it represses its own expression. The other members of this family are also annotated as being putative regulatory proteins. Probab=34.52 E-value=39 Score=15.59 Aligned_cols=79 Identities=11% Similarity=0.133 Sum_probs=48.1 Q ss_pred CCCCCEEEEEECCCCCH----HHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCC Q ss_conf 68997489997189884----89999999998299989999999998237968999638999999999999999975998 Q gi|254780164|r 55 RVPKLYRVLLVNDNYTP----MEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYP 130 (138) Q Consensus 55 k~P~~YkVIL~NDd~tt----mefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~P 130 (138) .++-.|--++-+-|... -|+|+..... |.-+.+...+..-..++.|.+-.++..-..-..--..+.++|.++++| T Consensus 22 ~r~V~~v~i~E~pd~~~~l~~gElvlTtg~~-~~~~~~~~~~~i~~L~~~g~agL~i~~g~~~~~iP~~~i~~a~~~~~P 100 (122) T pfam07905 22 DRPVRWVHVSELPDISPWLRGGELLLTTGYG-LKDDPEALREFVRELAEAGAAGLGIKTGRYIPEIPEELIAAANRLGLP 100 (122) T ss_pred CCCEEEEEEECCCCHHHHCCCCEEEEEECCC-CCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHCCCC T ss_conf 9968788976267988963698599972554-479999999999999978964999942555466999999999974997 Q ss_pred EEEE Q ss_conf 1798 Q gi|254780164|r 131 LQCI 134 (138) Q Consensus 131 L~~~ 134 (138) |-.. T Consensus 101 li~i 104 (122) T pfam07905 101 LIEL 104 (122) T ss_pred EEEE T ss_conf 7994 No 13 >cd02148 Nitroreductase_5 Nitroreductase-like family 5. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase. Probab=33.60 E-value=32 Score=16.10 Aligned_cols=32 Identities=13% Similarity=0.225 Sum_probs=24.5 Q ss_pred HHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHH Q ss_conf 9999999982379689996389999999999999 Q gi|254780164|r 89 TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122 (138) Q Consensus 89 ~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~ 122 (138) .|..+|+.++..|.+.|+.+.|+.. ++.++.. T Consensus 120 aa~~l~LaA~~~Gl~t~pm~gfd~~--~v~~~l~ 151 (185) T cd02148 120 QGGYFILAARALGLDAGPMSGFDAA--AVDAEFF 151 (185) T ss_pred HHHHHHHHHHHCCCCCCCCCCCCHH--HHHHHHC T ss_conf 9999999999849772428664899--9999868 No 14 >PRK03600 nrdI ribonucleotide reductase stimulatory protein; Reviewed Probab=29.57 E-value=48 Score=15.10 Aligned_cols=71 Identities=15% Similarity=0.030 Sum_probs=48.2 Q ss_pred CCCCCCEEEEEECCCCC--HHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCE Q ss_conf 26899748999718988--4899999999982999899999999982379689996389999999999999999759981 Q gi|254780164|r 54 VRVPKLYRVLLVNDNYT--PMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPL 131 (138) Q Consensus 54 ~k~P~~YkVIL~NDd~t--tmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL 131 (138) +..| |-+|......- .. .|-....++.... +-...=+||++.+..--.++++.-....|++.+-|| T Consensus 38 v~eP--yvLitpTyg~G~~~g-~VP~~v~~FL~~~---------~N~~~l~GVi~SGNrNfG~~f~~Aa~~Ia~k~~VP~ 105 (136) T PRK03600 38 VDEP--YILITPTYGGGGTKG-AVPKQVIRFLNDE---------HNRKLLRGVIASGNRNFGDAFALAGDVISAKCQVPL 105 (136) T ss_pred CCCC--EEEEEECCCCCCCCC-CCCHHHHHHHHCC---------CCHHHEEEEEECCCCCHHHHHHHHHHHHHHHHCCCE T ss_conf 6899--899970468998788-2678999988373---------035462678824887178999999999999809978 Q ss_pred EEEEE Q ss_conf 79861 Q gi|254780164|r 132 QCIME 136 (138) Q Consensus 132 ~~~iE 136 (138) ....| T Consensus 106 L~~FE 110 (136) T PRK03600 106 LYRFE 110 (136) T ss_pred EEEEE T ss_conf 99760 No 15 >pfam10609 ParA ParA/MinD ATPase like. This family contains ATPases involved in plasmid partitioning. It also contains the cytosolic Fe-S cluster assembling factor NBP35 which is required for biogenesis and export of both ribosomal subunits. Probab=28.82 E-value=49 Score=15.03 Aligned_cols=49 Identities=12% Similarity=0.200 Sum_probs=40.0 Q ss_pred HHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEE Q ss_conf 89999999998237968999638999999999999999975998179861 Q gi|254780164|r 87 HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136 (138) Q Consensus 87 ~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~~~iE 136 (138) -+..-.++..++..| +++-+.|.+.|..-+.+..+++++.+.|..-.+| T Consensus 13 gD~~ltl~~~~~~~~-~ivVTTP~~ls~~dv~r~i~~~~~~~i~ilGiVE 61 (81) T pfam10609 13 GDEHLTLAQSLPVDG-AVIVTTPQDVALLDVRKAIDMFKKLNVPILGIVE 61 (81) T ss_pred CHHHHHHHHHCCCCC-EEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEE T ss_conf 789999997488577-6998098599999999999999984996189997 No 16 >cd02137 Nitroreductase_1 Nitroreductase-like family 1. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase. Probab=28.19 E-value=42 Score=15.39 Aligned_cols=26 Identities=19% Similarity=0.345 Sum_probs=21.8 Q ss_pred HHHHHHHHHHHCCCCEEEEECCHHHH Q ss_conf 99999999982379689996389999 Q gi|254780164|r 88 ETAKCIMLKVHHQGIGECGVYAYEIA 113 (138) Q Consensus 88 e~A~~iml~vH~~G~avvgv~~~E~A 113 (138) --+..+|+.+|..|-|.|+++.++.. T Consensus 84 ~a~~~~~LaA~~~Glgs~~~~~~~~~ 109 (148) T cd02137 84 LAAMNLMLAARAYGYDTCPMGGFDAE 109 (148) T ss_pred HHHHHHHHHHHHCCCCCCCCCCCCHH T ss_conf 99999999999869964318773999 No 17 >PRK10977 hypothetical protein; Provisional Probab=27.54 E-value=52 Score=14.89 Aligned_cols=72 Identities=13% Similarity=0.099 Sum_probs=49.7 Q ss_pred CCCCCCCCHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHH-HH-HHHHHHH-CCCCEEEEECC Q ss_conf 7666532101000100268997489997189884899999999982999899-99-9999982-37968999638 Q gi|254780164|r 38 AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET-AK-CIMLKVH-HQGIGECGVYA 109 (138) Q Consensus 38 ~~~d~~~~~~~~~~~k~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~-A~-~iml~vH-~~G~avvgv~~ 109 (138) |..+..+-..++....++.+-.=-.++|+-++||-||.......++.++.-. |. .+....- ..|-|||..|. T Consensus 158 P~dt~~gRlILr~~~EL~q~~PNlTl~Yd~~~TpDd~~~~A~~~~~~csKP~faN~~~~~~~~~~~~ygIvSCYN 232 (510) T PRK10977 158 PKDTPAGRLILRADAELKQVAPNLTFKYDPEITPDDLLLEAAKNICECSKPHIANGPVHDKDFDKGGYGIVSCYN 232 (510) T ss_pred CCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCEEEEEECC T ss_conf 650089999999999983248972576488889279999999998871894002777678643877736998325 No 18 >cd03370 NADH_oxidase NADPH_oxidase. Nitroreductase family containing NADH oxidase and other, uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase. Probab=26.63 E-value=54 Score=14.80 Aligned_cols=43 Identities=12% Similarity=0.242 Sum_probs=27.8 Q ss_pred HHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEE Q ss_conf 9999999998237968999638999999999999999975998179 Q gi|254780164|r 88 ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQC 133 (138) Q Consensus 88 e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~~ 133 (138) -.+..+|+.++..|.|.|+++.++. .++.++...- ++.+++-+ T Consensus 93 ~a~~~l~LaA~~~Glgs~~~~g~~~--~~v~~~l~lP-~~~~~v~~ 135 (156) T cd03370 93 IAAGFLLLAATALGLATSPMTGFDE--EKVKEALGLP-GRDRAIAV 135 (156) T ss_pred HHHHHHHHHHHHCCCEEEECCCCCH--HHHHHHHCCC-CCCEEEEE T ss_conf 9999999999985970885387399--9999994979-98858999 No 19 >KOG0131 consensus Probab=26.45 E-value=54 Score=14.78 Aligned_cols=37 Identities=22% Similarity=0.251 Sum_probs=31.3 Q ss_pred HCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEE Q ss_conf 23796899963899999999999999997599817986 Q gi|254780164|r 98 HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135 (138) Q Consensus 98 H~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~~~i 135 (138) -.+|-|.|--.+.|.|+ ++.++++.-+..|-||++-. T Consensus 49 ~~qGygF~Ef~~eedad-YAikiln~VkLYgrpIrv~k 85 (203) T KOG0131 49 KHQGYGFAEFRTEEDAD-YAIKILNMVKLYGRPIRVNK 85 (203) T ss_pred CCCCEEEEEEECHHHHH-HHHHHHHHHHHCCCEEEEEE T ss_conf 55664689871103368-99999988876494468875 No 20 >PRK10765 nitroreductase A; Provisional Probab=26.35 E-value=55 Score=14.77 Aligned_cols=33 Identities=15% Similarity=0.194 Sum_probs=23.4 Q ss_pred HHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHH Q ss_conf 999999998237968999638999999999999 Q gi|254780164|r 89 TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVM 121 (138) Q Consensus 89 ~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~ 121 (138) .|..+++.++..|-|.|+++........+.+++ T Consensus 111 aaqn~~lAAeslGLG~~~IG~irn~~~~v~elL 143 (240) T PRK10765 111 MAQNALLAAESLGLGGVYIGGLRNNIEAVTELL 143 (240) T ss_pred HHHHHHHHHHHCCCCEEEECCHHCCHHHHHHHH T ss_conf 999999999986998587764322999999997 No 21 >cd02135 Arsenite_oxidase Nitroreductase-like family which includes NADH oxidase and arsenite oxidiase. NADH oxidase catalyses the oxidation of NAD(P)H and accepts a wide broad range of compounds as electron acceptors, such as nitrocompound. Arsenite oxidase in a beta-proteobacterial strain is able to oxidize arsenite to arsenate. Probab=26.34 E-value=35 Score=15.84 Aligned_cols=35 Identities=14% Similarity=0.277 Sum_probs=22.7 Q ss_pred HHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHH Q ss_conf 99999999823796899963899999999999999 Q gi|254780164|r 89 TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123 (138) Q Consensus 89 ~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~ 123 (138) -++.+||.++..|.|.|++...-..+.++.++.+. T Consensus 112 a~qnl~LaA~a~Glgscw~~~~~~~~~~v~e~l~i 146 (160) T cd02135 112 AIQNLLLAAHALGFGAVWRTGWAAYDPAVREALGL 146 (160) T ss_pred HHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHCCC T ss_conf 99999999998799869415875568999997394 No 22 >pfam07972 Flavodoxin_NdrI NrdI Flavodoxin like. Probab=25.86 E-value=56 Score=14.71 Aligned_cols=72 Identities=17% Similarity=0.074 Sum_probs=48.0 Q ss_pred CCCCCCEEEEEECCCCCH-HHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEE Q ss_conf 268997489997189884-8999999999829998999999999823796899963899999999999999997599817 Q gi|254780164|r 54 VRVPKLYRVLLVNDNYTP-MEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQ 132 (138) Q Consensus 54 ~k~P~~YkVIL~NDd~tt-mefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~ 132 (138) +..| |-+|......-- .+-|-..+.++..... =...=+||+|.+..--.++.+.-....|++.+-||. T Consensus 36 ~~ep--~vLitpTyg~G~~~~~vp~~v~~FL~~~~---------N~~~~~GVi~SGNrNfG~~f~~aa~~ia~ky~VPll 104 (121) T pfam07972 36 VDEP--YVLITPTYGGGGNGEAVPKQVIRFLNYEK---------NRKLLRGVIGSGNRNFGDNFCLAADKISEKYNVPLL 104 (121) T ss_pred CCCC--EEEEECCCCCCCCCCCCCHHHHHHHHCHH---------HHHHEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEE T ss_conf 6899--89996567899888826889999985655---------453267888238761488999999999998199789 Q ss_pred EEEE Q ss_conf 9861 Q gi|254780164|r 133 CIME 136 (138) Q Consensus 133 ~~iE 136 (138) ...| T Consensus 105 ~kfE 108 (121) T pfam07972 105 YKFE 108 (121) T ss_pred EEEC T ss_conf 9760 No 23 >PRK05365 hypothetical protein; Provisional Probab=25.07 E-value=58 Score=14.63 Aligned_cols=27 Identities=11% Similarity=0.297 Sum_probs=22.7 Q ss_pred HHHHHHHHHHCCCCEEEEECCHHHHHH Q ss_conf 999999998237968999638999999 Q gi|254780164|r 89 TAKCIMLKVHHQGIGECGVYAYEIAEM 115 (138) Q Consensus 89 ~A~~iml~vH~~G~avvgv~~~E~AE~ 115 (138) .|..+|+.++..|.+.|..+.|+.+.. T Consensus 125 a~~~lmlaA~~~GL~t~pM~GFd~~~v 151 (193) T PRK05365 125 QGAYLILAARALGLDAGPMSGFDAAAV 151 (193) T ss_pred HHHHHHHHHHHCCCCCCCCCCCCHHHH T ss_conf 999999999986986111557199999 No 24 >cd02142 mcbC-like_oxidoreductase This family is the oxydase domain of NRPS (non-ribosomal peptide synthetase) and other proteins that modify polypeptides by cyclizing a thioester to form a ring. These include epoB, part of the epothilone biosynthesis pathway; tubD, part of the tubulysin biosynthesis pathway, mtsD, part of the myxothiozol biosynthesis pathway; indC, part of the indigoidine biosynthesis pathway and tfxB, part of the trifitoxin processing pathway. All are FMN-dependent and oxidize the product of the cyclization of thioesters in short polypeptides. Probab=23.80 E-value=60 Score=14.55 Aligned_cols=44 Identities=16% Similarity=0.399 Sum_probs=30.8 Q ss_pred HHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEE Q ss_conf 9999999998237968999638999999999999999975998179 Q gi|254780164|r 88 ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQC 133 (138) Q Consensus 88 e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~~ 133 (138) --++.+++.+...|-+.|+++.+... ++.++......++.||-. T Consensus 132 ~l~q~l~L~A~alGlg~~~ig~~~d~--~v~~~lgL~~~~e~~l~~ 175 (180) T cd02142 132 HLGQNLYLAATALGLGTCAIGAFDDD--ALAELLGLDGLEEQPLYA 175 (180) T ss_pred HHHHHHHHHHHHCCCCEEEEEEECHH--HHHHHHCCCCCCEEEEEE T ss_conf 99999999999869857899888399--999996859877337999 No 25 >TIGR03553 F420_FbiB_CTERM F420 biosynthesis protein FbiB, C-terminal domain. Coenzyme F420 differs between the Archaea and the Actinobacteria, where the numbers of glutamate residues attached are 2 (Archaea) or 5-6 (Mycobacterium). The enzyme in the Archaea is homologous to the N-terminal domain of FbiB from Mycobacterium bovis, and is responsible for glutamate ligation. Therefore it seems likely that the C-terminal domain of FbiB, modeled by this HMM, is involved in additional glutamate ligation. Probab=23.68 E-value=48 Score=15.06 Aligned_cols=35 Identities=17% Similarity=0.316 Sum_probs=23.1 Q ss_pred HHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHH Q ss_conf 99999999823796899963899999999999999 Q gi|254780164|r 89 TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123 (138) Q Consensus 89 ~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~ 123 (138) -++.+++.++..|.|.|+++..-.++..+.++... T Consensus 126 a~qnl~LaA~a~GLGtcw~~~~~~~~~~v~~~L~l 160 (194) T TIGR03553 126 AVQNLLVALAVEGLGSCWVGSTIFAADVVRAELDL 160 (194) T ss_pred HHHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHCC T ss_conf 99999999998699578517877888999999493 No 26 >cd02146 NfsA_FRP This family contains NADPH-dependent flavin reductase and oxygen-insensitive nitroreductase. These enzymes are homodimeric flavoproteins that contain one FMN per monomer as a cofactor. Flavin reductase catalyzes the reduction of flavin by using NADPH as an electron donor. Oxygen-insensitive nitroreductase, such as NfsA protein in Escherichia coli, catalyzes reduction of nitrocompounds using NADPH as electron donor. Probab=23.53 E-value=62 Score=14.45 Aligned_cols=35 Identities=14% Similarity=0.115 Sum_probs=24.2 Q ss_pred HHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHH Q ss_conf 99999999982379689996389999999999999 Q gi|254780164|r 88 ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122 (138) Q Consensus 88 e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~ 122 (138) -.|+.+++.++..|-|.|+++..-.-...+.++++ T Consensus 112 iAaqn~~lAAeslGLG~~~IG~irn~~~~v~elL~ 146 (229) T cd02146 112 LAAQNAAVAAESLGLGIVYIGGIRNDPEAVIELLN 146 (229) T ss_pred HHHHHHHHHHHHCCCCEEEEHHHHCCHHHHHHHHC T ss_conf 99999999999869985874145409999999978 No 27 >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II; InterPro: IPR011287 This entry represents the class II subfamily of poly(R)-hydroxyalkanoate synthases, which polymerises hydroxyacyl-CoAs, typically with six to fourteen carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids . These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell.; GO: 0008415 acyltransferase activity, 0042619 poly-hydroxybutyrate biosynthetic process. Probab=22.37 E-value=54 Score=14.78 Aligned_cols=33 Identities=21% Similarity=0.408 Sum_probs=23.7 Q ss_pred CCCCCEEEEEECCCCCHHHHHHHH-HHHHHCCCH Q ss_conf 689974899971898848999999-999829998 Q gi|254780164|r 55 RVPKLYRVLLVNDNYTPMEFVIHV-LQNFFYKDH 87 (138) Q Consensus 55 k~P~~YkVIL~NDd~ttmefVi~v-L~~vf~~~~ 87 (138) +.||.|-+++||.|-|-.---.+= |.++|..+. T Consensus 388 ~~PP~FDILyWN~D~TRLPAA~HGdLld~FK~NP 421 (560) T TIGR01839 388 KEPPAFDILYWNNDTTRLPAAFHGDLLDLFKSNP 421 (560) T ss_pred CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCC T ss_conf 8768112553058886673665336999961378 No 28 >cd02136 Nitroreductase Nitroreductase family. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase. Probab=20.45 E-value=72 Score=14.09 Aligned_cols=35 Identities=20% Similarity=0.240 Sum_probs=25.0 Q ss_pred HHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHH Q ss_conf 99999999823796899963899999999999999 Q gi|254780164|r 89 TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123 (138) Q Consensus 89 ~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~ 123 (138) -++.+|+.++..|.|.|+.+.+......+.++... T Consensus 109 a~~nl~LaA~~~Glgsc~~~~~~~~~~~v~~~l~i 143 (178) T cd02136 109 FLQTIMLAARARGLDTCPQAALAKYPDIVREELGI 143 (178) T ss_pred HHHHHHHHHHHCCCCHHHCCHHHCCHHHHHHHHCC T ss_conf 99999999998796632304200281999998689 Done!