HHsearch alignment of GI: 254780164 and MMDB domain: 2w9r_A_24-108

>2w9r_A (A:24-108) YLJA, ATP-dependent CLP protease adapter protein CLPS; chaperone, adaptor protein, DNA condensation, iron, CLPS, CLPA, cytoplasm, N-END RULE; HET: DNA; 1.70A {Escherichia coli} PDB: 2wa9_A 1mbx_C* 1mbv_B 1mbu_C* 1r6o_C* 1r6q_C* 2wa8_A 1mg9_A* 1lzw_A*
Probab=99.97  E-value=2.4e-30  Score=193.77  Aligned_cols=83  Identities=53%  Similarity=0.895  Sum_probs=81.4

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             89974899971898848999999999829998999999999823796899963899999999999999997599817986
Q gi|254780164|r   56 VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM  135 (138)
Q Consensus        56 ~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~~~i  135 (138)
                      .|++|+|||||||+|||||||.+|+++|+++.++|.++|++||++|+|+||+|++|+||+++.+++++||.+|+||+|++
T Consensus         1 pp~~y~ViL~NDd~~t~e~Vi~~L~~v~~~~~~~A~~~~~~vh~~G~avv~~~~~e~Ae~~~~~l~~~~~~~~~pL~~~i   80 (85)
T 2w9r_A            1 PPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHPLLCTL   80 (85)
T ss_dssp             CCCEEEEEEECCSSSBHHHHHHHHHHHHCCCHHHHHHHHHHHHHHSEEEEEEEEHHHHHHHHHHHHHHHHHTTCCCEEEE
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             99844899985899978999999999968899999999999636997899997799999999999999997499838999


Q ss_pred             ECC
Q ss_conf             119
Q gi|254780164|r  136 EQK  138 (138)
Q Consensus       136 E~e  138 (138)
                      |++
T Consensus        81 e~~   83 (85)
T 2w9r_A           81 EKA   83 (85)
T ss_dssp             EEC
T ss_pred             EEC
T ss_conf             868