Query         gi|254780164|ref|YP_003064577.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 138
No_of_seqs    145 out of 946
Neff          4.6 
Searched_HMMs 23785
Date          Mon May 23 04:10:05 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780164.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2w9r_A YLJA, ATP-dependent CLP 100.0 3.4E-35 1.4E-39  220.6  11.6   98   41-138     9-106 (108)
  2 3dnj_A ATP-dependent CLP prote 100.0 7.7E-35 3.2E-39  218.6  11.2   85   54-138     1-85  (85)
  3 3h4o_A Nitroreductase family p  34.4      24   0.001   15.6   3.0   26   88-113   117-142 (191)
  4 3c3m_A Response regulator rece  33.6      23 0.00097   15.7   2.6   38   58-96      2-45  (138)
  5 3n3a_C Protein NRDI; ribonucle  31.7      18 0.00077   16.2   1.8   38  100-137    94-131 (153)
  6 3ge5_A Putative NAD(P)H:FMN ox  30.9      27  0.0012   15.2   2.7   25   89-113   127-151 (198)
  7 2r01_A Nitroreductase family p  26.7      33  0.0014   14.8   4.9   51   56-115    93-143 (210)
  8 1vkw_A Putative nitroreductase  26.1      33  0.0014   14.7   2.8   48   53-111    58-105 (218)
  9 1bkj_A NADPH-flavin oxidoreduc  25.8      33  0.0014   14.8   2.3   34   89-122   111-144 (240)
 10 1c07_A Protein (epidermal grow  22.8      39  0.0016   14.4   5.5   61   67-132    24-84  (95)
 11 3m5k_A Putative NADH dehydroge  21.8      28  0.0012   15.1   1.3   52   54-113    74-125 (172)
 12 2b67_A COG0778: nitroreductase  21.7      41  0.0017   14.2   2.5   25   90-114   139-163 (204)
 13 1f5v_A Oxygen-insensitive NADP  21.7      41  0.0017   14.2   2.3   33   88-120   110-142 (240)
 14 2xod_A NRDI protein, NRDI; fla  21.2      42  0.0018   14.2   3.2   52   86-137    48-99  (119)
 15 3e39_A Putative nitroreductase  20.2      44  0.0019   14.1   2.5   23   89-111   104-126 (178)

No 1  
>2w9r_A YLJA, ATP-dependent CLP protease adapter protein CLPS; chaperone, adaptor protein, DNA condensation, iron, CLPS, CLPA, cytoplasm, N-END RULE; HET: DNA; 1.70A {Escherichia coli} PDB: 2wa9_A 1mbx_C* 1mbv_B 1mbu_C* 1r6o_C* 1r6q_C* 2wa8_A 1mg9_A* 1lzw_A*
Probab=100.00  E-value=3.4e-35  Score=220.60  Aligned_cols=98  Identities=47%  Similarity=0.768  Sum_probs=91.8

Q ss_pred             CCCCCHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHH
Q ss_conf             65321010001002689974899971898848999999999829998999999999823796899963899999999999
Q gi|254780164|r   41 DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV  120 (138)
Q Consensus        41 d~~~~~~~~~~~k~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv  120 (138)
                      |.+...+.+.+.++++||+|+|||||||+|||||||.+|++||+++.++|.++|++||++|+|+||+|++|+||+|+.++
T Consensus         9 ~~~~~~~e~~~~~~k~p~~y~ViL~NDd~~t~e~Vi~~L~~v~~~s~~~A~~~~~~vh~~G~avv~~~~~E~AE~k~~~~   88 (108)
T 2w9r_A            9 DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMV   88 (108)
T ss_dssp             ---CHHHHHHHHTCCCCCEEEEEEECCSSSBHHHHHHHHHHHHCCCHHHHHHHHHHHHHHSEEEEEEEEHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHH
T ss_conf             52021366766413799853899977999989999999999959999999999999844698899997799999999999


Q ss_pred             HHHHHHCCCCEEEEEECC
Q ss_conf             999997599817986119
Q gi|254780164|r  121 MNYSRQHQYPLQCIMEQK  138 (138)
Q Consensus       121 ~~~Ar~~~~PL~~~iE~e  138 (138)
                      +++||.+||||+|+||+.
T Consensus        89 ~~~ar~~g~PL~~tiE~a  106 (108)
T 2w9r_A           89 NKYARENEHPLLCTLEKA  106 (108)
T ss_dssp             HHHHHHTTCCCEEEEEEC
T ss_pred             HHHHHHCCCCCEEEEEEC
T ss_conf             999997399818999858


No 2  
>3dnj_A ATP-dependent CLP protease adapter protein CLPS; adaptor, protein-peptide complex, peptide binding protein; 1.15A {Caulobacter vibrioides} PDB: 3g19_A 3gq0_A 3gq1_A 3gw1_A 3g1b_A 3g3p_A*
Probab=100.00  E-value=7.7e-35  Score=218.56  Aligned_cols=85  Identities=59%  Similarity=1.044  Sum_probs=83.7

Q ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             26899748999718988489999999998299989999999998237968999638999999999999999975998179
Q gi|254780164|r   54 VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQC  133 (138)
Q Consensus        54 ~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~~  133 (138)
                      +++||+|+|||||||+|||||||.+|+++|+++.++|.++|++||++|+|+||+|++|+||+|+.|++++||.+||||+|
T Consensus         1 t~~p~~y~Vil~NDd~~t~e~Vi~~L~~v~~~~~~~A~~i~~~vH~~G~avv~~~~~E~AE~k~~~~~~~ar~~~~pL~~   80 (85)
T 3dnj_A            1 TQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQC   80 (85)
T ss_dssp             -----CEEEEEECCSSSBHHHHHHHHHHHHCCCHHHHHHHHHHHHHHSEEEEEEECHHHHHHHHHHHHHHHHHTTCCCCE
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99998448999879999889999999999693999999999995569968999977999999999999999974999769


Q ss_pred             EEECC
Q ss_conf             86119
Q gi|254780164|r  134 IMEQK  138 (138)
Q Consensus       134 ~iE~e  138 (138)
                      ++|+|
T Consensus        81 ~iE~e   85 (85)
T 3dnj_A           81 TMEKD   85 (85)
T ss_dssp             EEEEC
T ss_pred             EECCC
T ss_conf             97049


No 3  
>3h4o_A Nitroreductase family protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE FMN; 1.50A {Clostridium difficile 630} PDB: 3koq_A*
Probab=34.44  E-value=24  Score=15.58  Aligned_cols=26  Identities=15%  Similarity=0.231  Sum_probs=22.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCHHHH
Q ss_conf             99999999982379689996389999
Q gi|254780164|r   88 ETAKCIMLKVHHQGIGECGVYAYEIA  113 (138)
Q Consensus        88 e~A~~iml~vH~~G~avvgv~~~E~A  113 (138)
                      -.|..+++.++..|.|.|+++.++..
T Consensus       117 ~a~~nl~LaA~~lGlgt~~~~~~~~~  142 (191)
T 3h4o_A          117 IVTDHMMLQATELGLASVWVCYFNPD  142 (191)
T ss_dssp             HHHHHHHHHHHHTTCEEEEECCSCHH
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCHH
T ss_conf             99999999999869988745674999


No 4  
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1}
Probab=33.60  E-value=23  Score=15.66  Aligned_cols=38  Identities=18%  Similarity=0.217  Sum_probs=22.9

Q ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHC------CCHHHHHHHHHH
Q ss_conf             974899971898848999999999829------998999999999
Q gi|254780164|r   58 KLYRVLLVNDNYTPMEFVIHVLQNFFY------KDHETAKCIMLK   96 (138)
Q Consensus        58 ~~YkVIL~NDd~ttmefVi~vL~~vf~------~~~e~A~~iml~   96 (138)
                      ++|+|++.+||-...+.+...|... |      .+-++|.+...+
T Consensus         2 ~~~rILIVDD~~~~~~~l~~~L~~~-G~~v~~a~~g~eal~~l~~   45 (138)
T 3c3m_A            2 SLYTILVVDDSPMIVDVFVTMLERG-GYRPITAFSGEECLEALNA   45 (138)
T ss_dssp             CCCEEEEECSCHHHHHHHHHHHHHT-TCEEEEESSHHHHHHHHHH
T ss_pred             CCCEEEEEECCHHHHHHHHHHHHHC-CCEEEEECCHHHHHHHHHC
T ss_conf             9898999979999999999999987-9999998999999999753


No 5  
>3n3a_C Protein NRDI; ribonucleotide reductase, four-helix bundle, dimanganese CLU flavoprotein, oxidoreductase; HET: FMN; 1.99A {Escherichia coli} PDB: 3n39_C* 3n3b_C*
Probab=31.74  E-value=18  Score=16.24  Aligned_cols=38  Identities=13%  Similarity=-0.091  Sum_probs=34.0

Q ss_pred             CCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             79689996389999999999999999759981798611
Q gi|254780164|r  100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ  137 (138)
Q Consensus       100 ~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~~~iE~  137 (138)
                      .-+||+|.+..--.++++.-+..+|++.+-||...+|-
T Consensus        94 ~~~gVigSGNrnfg~~Fc~Aa~~ia~k~~vP~L~kfEl  131 (153)
T 3n3a_C           94 LLRGVIASGNRNFGEAYGRAGDVIARKCGVPWLYRFEL  131 (153)
T ss_dssp             HEEEEEEEECGGGGGGTTHHHHHHHHHHTCCEEEEEET
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             47899964767378999999999999859975997614


No 6  
>3ge5_A Putative NAD(P)H:FMN oxidoreductase; NP_904626.1, structural genomics, joint center for structural genomics, JCSG; HET: FMN UNL; 1.70A {Porphyromonas gingivalis W83}
Probab=30.86  E-value=27  Score=15.23  Aligned_cols=25  Identities=32%  Similarity=0.506  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHCCCCEEEEECCHHHH
Q ss_conf             9999999982379689996389999
Q gi|254780164|r   89 TAKCIMLKVHHQGIGECGVYAYEIA  113 (138)
Q Consensus        89 ~A~~iml~vH~~G~avvgv~~~E~A  113 (138)
                      .+..+++.++..|.|.|+++.++..
T Consensus       127 a~~~l~LaA~~~Glgsc~i~~~~~~  151 (198)
T 3ge5_A          127 AMTYMMLEAHSLGLGCTWVCAFDQA  151 (198)
T ss_dssp             HHHHHHHHHHHTTCEEEEECCSCHH
T ss_pred             HHHHHHHHHHHCCCCEEEEEHCCHH
T ss_conf             9999999999869988643010367


No 7  
>2r01_A Nitroreductase family protein; NP_661249.1, putative FMN-dependent nitroreductase, structural genomics; HET: MSE FMN; 1.15A {Chlorobium tepidum tls}
Probab=26.68  E-value=33  Score=14.80  Aligned_cols=51  Identities=24%  Similarity=0.260  Sum_probs=33.6

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHH
Q ss_conf             899748999718988489999999998299989999999998237968999638999999
Q gi|254780164|r   56 VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM  115 (138)
Q Consensus        56 ~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~  115 (138)
                      .++.+-+++..++..+.-++- +        --.+..+++.++..|.|.|+++.++..+.
T Consensus        93 ~~~~~~~~~~~~~~~~~~~~d-~--------g~a~~nl~Laa~~lGlgs~~~~~~~~~~l  143 (210)
T 2r01_A           93 RPAAALVMLCRNEDLPGAACD-S--------GIAAQTIMLGAAEKELGGCIVAAIDRERL  143 (210)
T ss_dssp             SCSEEEEEEEEGGGGGGTHHH-H--------HHHHHHHHHHHHHTTCEEEEECCBCHHHH
T ss_pred             CCCCEEEEEECCCCCCHHHHH-H--------HHHHHHHHHHHHHCCCCEEEECCCCHHHH
T ss_conf             478389999658888408999-9--------99999999999967998686457699999


No 8  
>1vkw_A Putative nitroreductase; TM1586, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima MSB8} SCOP: d.90.1.2
Probab=26.08  E-value=33  Score=14.74  Aligned_cols=48  Identities=17%  Similarity=0.210  Sum_probs=29.4

Q ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHH
Q ss_conf             02689974899971898848999999999829998999999999823796899963899
Q gi|254780164|r   53 KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYE  111 (138)
Q Consensus        53 k~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E  111 (138)
                      .+...|.|-|++-+.+..   +    ++++    --.+.+++|.++..|.|.||++.++
T Consensus        58 ~~~~Ap~~Ivv~~~~~~~---~----~~~~----g~~~e~l~L~A~~lGLGtcWig~~~  105 (218)
T 1vkw_A           58 NLSSFPSYIYAKAEKHFD---E----LVEY----GFQGEQIVLFLTAQGFGTCWMARSP  105 (218)
T ss_dssp             ECSSSSEEEECCCCSSHH---H----HHHH----HHHHHHHHHHHHHTTCEEEEESCCS
T ss_pred             CHHCCCCCEEEEECCCHH---H----HHHH----HHHHHHHHHHHHHCCCCCEEECCCC
T ss_conf             011588029999769666---8----9999----9999999999998699855544677


No 9  
>1bkj_A NADPH-flavin oxidoreductase; luminescence, flavoprotein; HET: FMN; 1.80A {Vibrio harveyi} SCOP: d.90.1.1 PDB: 2bkj_A*
Probab=25.83  E-value=33  Score=14.78  Aligned_cols=34  Identities=15%  Similarity=0.283  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             9999999982379689996389999999999999
Q gi|254780164|r   89 TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN  122 (138)
Q Consensus        89 ~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~  122 (138)
                      .|..+++.++..|-|.|+++.......++.++++
T Consensus       111 a~qn~~laA~slGlGt~~ig~~~~~~~~v~e~L~  144 (240)
T 1bkj_A          111 MAQNCLLAAESMGLGGVYIGGLRNSAAQVDELLG  144 (240)
T ss_dssp             HHHHHHHHHHHTTCEEEEEGGGGGGHHHHHHHTT
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHCC
T ss_conf             9999999999859998974686655899999809


No 10 
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6
Probab=22.79  E-value=39  Score=14.37  Aligned_cols=61  Identities=8%  Similarity=-0.015  Sum_probs=45.1

Q ss_pred             CCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             898848999999999829998999999999823796899963899999999999999997599817
Q gi|254780164|r   67 DNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQ  132 (138)
Q Consensus        67 Dd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~  132 (138)
                      |.+-+.+-+...|.+ .+.+.++..+|+..++.++.|....--|-+|=    .+...++..|+||-
T Consensus        24 ~G~is~~e~~~~l~~-~~l~~~~l~~i~~~~D~~~~G~l~~~EF~~am----~li~~~~~~g~~lP   84 (95)
T 1c07_A           24 DGFVSGLEVREIFLK-TGLPSTLLAHIWSLCDTKDCGKLSKDQFALAF----HLISQKLIKGIDPP   84 (95)
T ss_dssp             SSEECHHHHHHHHHT-TTCCHHHHHHHHHHHCTTCSSSEETTTHHHHH----HHHHHHHTSCCCCC
T ss_pred             CCCEECCHHHHHHHH-CCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHH----HHHHHHHHCCCCCC
T ss_conf             982631012567876-08899999999998258999929899999999----99999997799898


No 11 
>3m5k_A Putative NADH dehydrogenase/NAD(P)H nitroreductas; structural genomics, joint center for structural genomics; HET: MSE FMN; 1.86A {Parabacteroides distasonis}
Probab=21.80  E-value=28  Score=15.14  Aligned_cols=52  Identities=10%  Similarity=0.194  Sum_probs=32.2

Q ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHH
Q ss_conf             268997489997189884899999999982999899999999982379689996389999
Q gi|254780164|r   54 VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA  113 (138)
Q Consensus        54 ~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~A  113 (138)
                      ++..|.+-++.-+.....-.+-+.+        --.+..+|+.++..|.|.|++..+...
T Consensus        74 ~~~ap~~ii~~~~~~~~~~~~~~d~--------g~~~~~l~Laa~~~Glgscw~~~~~~~  125 (172)
T 3m5k_A           74 LKETRQAIVVCGDTIKSSNAWFLDC--------SAASQNLLLAAESMGLGAVWTAVYPYP  125 (172)
T ss_dssp             GGGCSEEEEEEEETTTCTTTHHHHH--------HHHHHHHHHHHHHTTCEECCEECTTCH
T ss_pred             HHHCCCCEEECCCCCCCCCHHHHHH--------HHHHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             4405420144036666654799999--------999989999999879975302124541


No 12 
>2b67_A COG0778: nitroreductase; alpha-beta sandwich, FMN binding pocket, structural genomics, PSI, protein structure initiative; HET: MSE FMN; 2.05A {Streptococcus pneumoniae TIGR4} SCOP: d.90.1.1
Probab=21.75  E-value=41  Score=14.25  Aligned_cols=25  Identities=24%  Similarity=0.461  Sum_probs=21.3

Q ss_pred             HHHHHHHHHCCCCEEEEECCHHHHH
Q ss_conf             9999999823796899963899999
Q gi|254780164|r   90 AKCIMLKVHHQGIGECGVYAYEIAE  114 (138)
Q Consensus        90 A~~iml~vH~~G~avvgv~~~E~AE  114 (138)
                      +..+++.++..|.|.|++..++.++
T Consensus       139 ~qn~~Laa~~~Glgs~~~~~~~~~~  163 (204)
T 2b67_A          139 AMNLVLALTDQGIGSNIILGFDKSK  163 (204)
T ss_dssp             HHHHHHHHHHTTCEEEEECCBCHHH
T ss_pred             HHHHHHHHHHCCCCEEEECCCCHHH
T ss_conf             9999999987696677355448999


No 13 
>1f5v_A Oxygen-insensitive NADPH nitroreductase; flavoprotein, oxidoreduction, nitrocompound, oxidoreductase; HET: FMN; 1.70A {Escherichia coli} SCOP: d.90.1.1
Probab=21.70  E-value=41  Score=14.24  Aligned_cols=33  Identities=12%  Similarity=0.131  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHH
Q ss_conf             999999999823796899963899999999999
Q gi|254780164|r   88 ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV  120 (138)
Q Consensus        88 e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv  120 (138)
                      -.+..+++.++..|.|.|+++........+.++
T Consensus       110 ~a~qn~~LaA~~lGLGt~~~g~~~~~~~~v~~~  142 (240)
T 1f5v_A          110 MMAQNALIAAESLGLGGVYIGGLRNNIEAVTKL  142 (240)
T ss_dssp             HHHHHHHHHHHHTTCEEEEEGGGGGGHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHH
T ss_conf             999999999998499988435752328999998


No 14 
>2xod_A NRDI protein, NRDI; flavoprotein, redox protein, ribonucleotide reductase, flavi mononucleotide, FMN; HET: FMN; 0.96A {Bacillus anthracis} PDB: 2xoe_A* 2x2o_A* 2x2p_A*
Probab=21.24  E-value=42  Score=14.18  Aligned_cols=52  Identities=12%  Similarity=0.001  Sum_probs=39.4

Q ss_pred             CHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             9899999999982379689996389999999999999999759981798611
Q gi|254780164|r   86 DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ  137 (138)
Q Consensus        86 ~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~~~iE~  137 (138)
                      -.+.+..........=.||+|.+..--.+..+.-+...+++-+-||...+|.
T Consensus        48 ~P~~~~~Fl~~~~~~~~~V~g~Gd~~y~~~fc~a~k~i~~~~~~p~l~k~E~   99 (119)
T 2xod_A           48 VPERVLEFLERNNEKLKGVSASGNRNWGDMFGASADKISAKYEVPIVSKFEL   99 (119)
T ss_dssp             CCHHHHHHHHHHGGGEEEEEEEECGGGGGGTTHHHHHHHHHHTCCEEEEEET
T ss_pred             CCHHHHHHHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             9978999998655464789845877678999699999999959960462012


No 15 
>3e39_A Putative nitroreductase; YP_387283.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE FMN PGE; 1.70A {Desulfovibrio desulfuricans subsp}
Probab=20.19  E-value=44  Score=14.05  Aligned_cols=23  Identities=13%  Similarity=0.173  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHCCCCEEEEECCHH
Q ss_conf             99999999823796899963899
Q gi|254780164|r   89 TAKCIMLKVHHQGIGECGVYAYE  111 (138)
Q Consensus        89 ~A~~iml~vH~~G~avvgv~~~E  111 (138)
                      .+..+++.++..|.|.|+++.+.
T Consensus       104 a~qn~~L~A~~lGlgs~~~~~~~  126 (178)
T 3e39_A          104 AVQNMLLAAHALQLGAVWLGEII  126 (178)
T ss_dssp             HHHHHHHHHHHTTCEEEEECGGG
T ss_pred             HHHHHHHHHHHCCCCEEEECCCC
T ss_conf             99999999998798889625644


Done!