BLAST/PSIBLAST alignment of GI: 254780164 and GI: 190891596 at iteration 1
>gi|190891596|ref|YP_001978138.1| ATP-dependent Clp protease adaptor protein [Rhizobium etli CIAT 652] Length = 117
>gi|190696875|gb|ACE90960.1| ATP-dependent Clp protease adaptor protein [Rhizobium etli CIAT 652] Length = 117
 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 80/111 (72%), Gaps = 3/111 (2%)

Query: 31  RMNKKGIAEFDNCLDSE---VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
           RM   G    DN         R   K + P LYRVLL+ND+YTPMEFVIH+L+ FF KD 
Sbjct: 7   RMQNNGERNGDNGNRGTSVITRTKPKTKKPNLYRVLLLNDDYTPMEFVIHILERFFQKDR 66

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           E+A  IML VH+ G+GECG++ YE+AE KV+QVM+++RQHQ+PLQC+ME+K
Sbjct: 67  ESATRIMLHVHNHGVGECGIFTYEVAETKVSQVMDFARQHQHPLQCVMEKK 117