BLAST/PSIBLAST alignment of GI: 254780164 and GI: 241204496 at iteration 1
>gi|241204496|ref|YP_002975592.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 118
>gi|240858386|gb|ACS56053.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 118
 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 81/110 (73%), Gaps = 2/110 (1%)

Query: 31  RMNKKGIAEFDNCLDSEV--RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
           RM        DN   + V  R   K + P LYRVLL+ND+YTPMEFVIH+L+ FF KD E
Sbjct: 9   RMQNDSERNGDNANRTSVITRTKPKTKKPNLYRVLLLNDDYTPMEFVIHILERFFQKDRE 68

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +A  IML VH+ G+GECG++ YE+AE KV+QVM+++RQHQ+PLQC+ME+K
Sbjct: 69  SATRIMLHVHNHGVGECGIFTYEVAETKVSQVMDFARQHQHPLQCVMEKK 118