PSIBLAST alignment of GI: 254780164 and protein with PDB id: 2wa8

>gi|228311830|pdb|2WA8|A Chain A, Structural Basis Of N-End Rule Substrate Recognition In Escherichia Coli By The Clpap Adaptor Protein Clps - The Phe Peptide Structure Length = 107
>gi|228311832|pdb|2WA8|C Chain C, Structural Basis Of N-End Rule Substrate Recognition In Escherichia Coli By The Clpap Adaptor Protein Clps - The Phe Peptide Structure Length = 107
 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105