PSIBLAST alignment of GI: 254780164 and protein with PDB id: 3g1b

>gi|228312133|pdb|3G1B|A Chain A, The Structure Of The M53a Mutant Of Caulobacter Crescentus Clps Protease Adaptor Protein In Complex With Wlfvqrdske Peptide Length = 85
>gi|228312134|pdb|3G1B|B Chain B, The Structure Of The M53a Mutant Of Caulobacter Crescentus Clps Protease Adaptor Protein In Complex With Wlfvqrdske Peptide Length = 85
 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 49/85 (57%), Positives = 64/85 (75%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
            + P LYRVL++ND+YTP EFV++VL+ FF K  E A  IML VH  G+G CGVY YE+A
Sbjct: 1   TQKPSLYRVLILNDDYTPAEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVA 60

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQK 138
           E KV QV++ +R+HQ+PLQC ME+ 
Sbjct: 61  ETKVAQVIDSARRHQHPLQCTMEKD 85