BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780164|ref|YP_003064577.1| ATP-dependent Clp protease
adaptor protein ClpS [Candidatus Liberibacter asiaticus str. psy62]
         (138 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|254780164|ref|YP_003064577.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039841|gb|ACT56637.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 138

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 138/138 (100%), Positives = 138/138 (100%)

Query: 1   MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLY 60
           MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLY
Sbjct: 1   MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLY 60

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
           RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV
Sbjct: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120

Query: 121 MNYSRQHQYPLQCIMEQK 138
           MNYSRQHQYPLQCIMEQK
Sbjct: 121 MNYSRQHQYPLQCIMEQK 138


>gi|300022147|ref|YP_003754758.1| ATP-dependent Clp protease adaptor protein ClpS [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523968|gb|ADJ22437.1| ATP-dependent Clp protease adaptor protein ClpS [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 129

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 63/124 (50%), Positives = 80/124 (64%), Gaps = 4/124 (3%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEV----RFSSKVRVPKLYRVLLVNDNYTPMEF 74
           L + + I MA       G    D   DS+     +   K + P LY+VLL+ND++TPMEF
Sbjct: 6   LPIAALIRMAGKDDPPNGPGRDDRDGDSKTGIVTKTRPKTKKPSLYKVLLLNDDFTPMEF 65

Query: 75  VIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCI 134
           V+ VLQ FF K  E A  IML VHH+G+G CGVY YEIAE KV QVM++SRQH +PLQC 
Sbjct: 66  VVLVLQRFFNKGQEDATRIMLHVHHKGVGICGVYTYEIAETKVTQVMDFSRQHGHPLQCT 125

Query: 135 MEQK 138
           ME++
Sbjct: 126 MEKE 129


>gi|144898735|emb|CAM75599.1| ATP-dependent Clp protease adaptor protein clpS [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 146

 Score =  159 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 78/123 (63%)

Query: 16  DGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFV 75
           D  + + + +       +       DN     ++   K + P +Y+VL++ND+YTPMEFV
Sbjct: 24  DRRVPMGTNLANETMSDHNDDKQNGDNQTGVVIKTRPKTKKPSMYKVLMLNDDYTPMEFV 83

Query: 76  IHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
           +HVL++FF K  E A  IML VH +G+G CGVY YE+AE KV QVM+ +RQ+Q+PLQC +
Sbjct: 84  VHVLEHFFNKSREDATRIMLHVHTRGVGICGVYTYEVAETKVTQVMDLARQNQHPLQCTI 143

Query: 136 EQK 138
           E+ 
Sbjct: 144 EKD 146


>gi|114765842|ref|ZP_01444935.1| ATP-dependent Clp protease, adaptor protein ClpS [Pelagibaca
           bermudensis HTCC2601]
 gi|114541841|gb|EAU44878.1| ATP-dependent Clp protease, adaptor protein ClpS [Roseovarius sp.
           HTCC2601]
          Length = 120

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 76/114 (66%), Gaps = 3/114 (2%)

Query: 25  IFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFY 84
           I +A+S          D   D  ++   K + P LY+VLL+ND+YTPMEFV+HVL+ FF 
Sbjct: 10  IRLANSPSLPGD---GDGDADVVLQTKPKTKRPPLYKVLLLNDDYTPMEFVVHVLERFFG 66

Query: 85  KDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             H  A  IML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 67  MSHAQAFEIMLTVHKKGVAVVGVFSHEIAETKVGQVMDFARRHQHPLQCTMEKE 120


>gi|148553784|ref|YP_001261366.1| ATP-dependent Clp protease adaptor protein ClpS [Sphingomonas
           wittichii RW1]
 gi|148498974|gb|ABQ67228.1| ATP-dependent Clp protease adaptor protein ClpS [Sphingomonas
           wittichii RW1]
          Length = 131

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 50/125 (40%), Positives = 79/125 (63%)

Query: 13  VKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPM 72
           V    I++  +F         +K   +    L    R  ++ + P  Y+VL++ND+YTPM
Sbjct: 6   VSPAPIMSHSAFTTAPTGMATRKDGDDNGTGLGLATRTRTRTKKPSPYKVLMLNDDYTPM 65

Query: 73  EFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQ 132
           EFV+  LQ FF  + E A  +ML VH +G+G CGV++YE+AE KV+QV++++RQ+Q+PLQ
Sbjct: 66  EFVVLCLQRFFRMNLEDATRVMLHVHQKGVGVCGVFSYEVAETKVSQVVDFARQNQHPLQ 125

Query: 133 CIMEQ 137
           C +E+
Sbjct: 126 CTLEK 130


>gi|126031981|gb|ABN71557.1| putative ATP-dependent Clp protease adaptor protein ClpS
           [uncultured bacterium]
          Length = 131

 Score =  157 bits (397), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 49/127 (38%), Positives = 79/127 (62%), Gaps = 3/127 (2%)

Query: 14  KRDGILALMSFIFMAD---SRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYT 70
           +     A   F+  ++      ++ G     + +    +  +K + P  ++VL++ND+YT
Sbjct: 4   RHSLAPAFAPFVRASERAAGDDDESGRPGDQDQVGVATKTRTKPKKPSQFKVLMLNDDYT 63

Query: 71  PMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYP 130
           PMEFV+  L+ FF  D E A  +ML VH +G+G CG++ YEIAE KVNQVM+++RQ+Q+P
Sbjct: 64  PMEFVVMCLKRFFSMDLEQATRVMLHVHQRGVGVCGIFPYEIAETKVNQVMDFARQNQHP 123

Query: 131 LQCIMEQ 137
           LQC +E+
Sbjct: 124 LQCTLEK 130


>gi|90424816|ref|YP_533186.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris BisB18]
 gi|90106830|gb|ABD88867.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris BisB18]
          Length = 137

 Score =  156 bits (395), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 4   FDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVL 63
               S +HR      L               +     +       +   K + P LYRVL
Sbjct: 7   HRAYSPFHRSATQSRLRSAPR----MGNDEGRSSGPGNPATSVITKVKPKTKRPNLYRVL 62

Query: 64  LVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123
           ++ND+YTPMEFV+HVL+ FF  D E A  +ML VHH GIGECGV+ YEIAE KV QVM++
Sbjct: 63  ILNDDYTPMEFVVHVLEKFFQMDVEAATQVMLHVHHHGIGECGVFTYEIAETKVTQVMDF 122

Query: 124 SRQHQYPLQCIMEQK 138
           +R+HQ+PLQC+ME+K
Sbjct: 123 ARKHQHPLQCVMEKK 137


>gi|114328313|ref|YP_745470.1| ATP-dependent Clp protease adaptor protein ClpS [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316487|gb|ABI62547.1| ATP-dependent Clp protease adaptor protein ClpS [Granulibacter
           bethesdensis CGDNIH1]
          Length = 178

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/109 (47%), Positives = 72/109 (66%)

Query: 30  SRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET 89
           S  + +G A          +     R P LY+VL++ND+YTPMEFV+HVL+ FF K  E 
Sbjct: 70  SDEHGQGHAGDGTSTGLIAKTRPATRKPSLYKVLMLNDDYTPMEFVVHVLERFFQKTREE 129

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           A  IML VH +G+G CGV+ YE+AE KV QVM+ +R +Q+PLQC +E++
Sbjct: 130 ATQIMLHVHRRGVGVCGVFTYEVAETKVTQVMDLARHNQHPLQCTIEKE 178


>gi|296283029|ref|ZP_06861027.1| ATP-dependent Clp protease adaptor protein ClpS [Citromicrobium
           bathyomarinum JL354]
          Length = 140

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 78/124 (62%)

Query: 14  KRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPME 73
            RD           A +  + +     D  +    +  +K + P  Y+VL++ND+YTPME
Sbjct: 16  PRDAAPLPSRAPTAAGNDDHGEDGRPADPNVGVATKTRAKPKKPSQYKVLMLNDDYTPME 75

Query: 74  FVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQC 133
           FV+ VL+ FF  D E A  +ML+VH +G+G CG++ YE+AE KVNQVM+++RQ+Q+PLQC
Sbjct: 76  FVVIVLKRFFRMDMEEATRVMLQVHQRGVGVCGIFPYEVAETKVNQVMDFARQNQHPLQC 135

Query: 134 IMEQ 137
            +E+
Sbjct: 136 TLEK 139


>gi|330993783|ref|ZP_08317715.1| ATP-dependent Clp protease adapter protein ClpS [Gluconacetobacter
           sp. SXCC-1]
 gi|329759051|gb|EGG75563.1| ATP-dependent Clp protease adapter protein ClpS [Gluconacetobacter
           sp. SXCC-1]
          Length = 175

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 54/131 (41%), Positives = 78/131 (59%), Gaps = 6/131 (4%)

Query: 14  KRDGILALMSFIFMADSRMNKKG------IAEFDNCLDSEVRFSSKVRVPKLYRVLLVND 67
            R    A        ++   + G          D  +D  +    + R P +Y+VL++ND
Sbjct: 45  SRPAGAAARPLGHGGNTPPRRNGGGQDSPPGNDDGMIDVVIHTRPQTRKPAMYKVLMLND 104

Query: 68  NYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQH 127
           +YTPMEFV+HVL+ FF K+ E A  IML VH +G+G CGV+ YE+AE KV QVM+ +RQ+
Sbjct: 105 DYTPMEFVVHVLERFFQKNREEATDIMLHVHKRGVGVCGVFTYEVAETKVTQVMDLARQN 164

Query: 128 QYPLQCIMEQK 138
           Q+PLQC +E+ 
Sbjct: 165 QHPLQCTIEKD 175


>gi|312113135|ref|YP_004010731.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218264|gb|ADP69632.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 128

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 76/109 (69%), Gaps = 2/109 (1%)

Query: 32  MNKKGIAEFDNC--LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET 89
           M      + DN     +  +   K + P LY+VLL+ND+YTPMEFV++VL+ FF K HE 
Sbjct: 20  MAGNNGFKDDNGLKTGAVTKTRPKTKRPSLYKVLLLNDDYTPMEFVVYVLERFFNKPHEE 79

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           A  IM+ VH +G+G CGVY YE+AE KV QVMN++RQHQ+PLQC ME++
Sbjct: 80  ATLIMMHVHQKGVGICGVYTYEVAETKVTQVMNFARQHQHPLQCTMEKE 128


>gi|46201030|ref|ZP_00055925.2| COG2127: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 110

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 72/110 (65%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
            S          D      ++   K + P +Y+VL++ND+YTPMEFV+HVL+ FF K  E
Sbjct: 1   MSENGNDKQGGDDGQTGVVIKTRPKTKKPSMYKVLMLNDDYTPMEFVVHVLERFFNKSRE 60

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            A  +ML VH +G+G CGVY YE+AE KV QVM+ +RQ+Q+PLQC +E++
Sbjct: 61  DATRVMLNVHTRGVGICGVYTYEVAETKVTQVMDLARQNQHPLQCTIEKE 110


>gi|85709342|ref|ZP_01040407.1| ATP-dependent Clp protease adaptor protein ClpS [Erythrobacter sp.
           NAP1]
 gi|85688052|gb|EAQ28056.1| ATP-dependent Clp protease adaptor protein ClpS [Erythrobacter sp.
           NAP1]
          Length = 140

 Score =  154 bits (390), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 53/121 (43%), Positives = 79/121 (65%), Gaps = 3/121 (2%)

Query: 20  ALMSFIFMADSRMNKK---GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVI 76
           A  + + +AD    K       E D  +    +  +K + P  Y+VL++ND+YTPMEFV+
Sbjct: 19  AAFAAVRLADDDEKKDGGSDTDEGDGQVVIATKTRTKPKKPSQYKVLMLNDDYTPMEFVV 78

Query: 77  HVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
            VL+ FF  D E A  +ML VH +G+G CG++ YE+AE KVNQVM+++RQ+Q+PLQC +E
Sbjct: 79  MVLKRFFGMDLEAATRVMLHVHQKGVGVCGIFPYEVAETKVNQVMDFARQNQHPLQCTLE 138

Query: 137 Q 137
           +
Sbjct: 139 K 139


>gi|103485996|ref|YP_615557.1| ATP-dependent Clp protease adaptor protein ClpS [Sphingopyxis
           alaskensis RB2256]
 gi|98976073|gb|ABF52224.1| ATP-dependent Clp protease adaptor protein ClpS [Sphingopyxis
           alaskensis RB2256]
          Length = 121

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 77/116 (66%)

Query: 22  MSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN 81
            S   M  +  +K   A     +    R  +K + P +Y+VLL+ND+YTPMEFV+ VLQ 
Sbjct: 5   ASSPHMVRAMADKDDDATGTPGVGIATRTRAKPKKPSMYKVLLLNDDYTPMEFVVMVLQR 64

Query: 82  FFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           FF  D E A  +ML VH QG+G CGV++YE+AE KVNQVM+ +RQ+Q+PLQC +E+
Sbjct: 65  FFNMDIERATQVMLHVHQQGVGVCGVFSYEVAETKVNQVMDAARQNQHPLQCTLEK 120


>gi|83951021|ref|ZP_00959754.1| ATP-dependent Clp protease, adaptor protein ClpS [Roseovarius
           nubinhibens ISM]
 gi|83838920|gb|EAP78216.1| ATP-dependent Clp protease, adaptor protein ClpS [Roseovarius
           nubinhibens ISM]
          Length = 114

 Score =  154 bits (389), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 54/106 (50%), Positives = 73/106 (68%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
           N  G  + D  +   V    K + P LY+VLL+ND+YTPMEFV+HVL+ FF   H  A  
Sbjct: 9   NSSGQDDGDGHISVAVATRPKTKRPPLYKVLLLNDDYTPMEFVVHVLERFFGMTHAEAFE 68

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           IML VH +G+   GV+++EIAE KV QVM+++RQHQ+PLQC ME++
Sbjct: 69  IMLTVHKKGVAVVGVFSHEIAETKVAQVMDFARQHQHPLQCTMEKE 114


>gi|294013244|ref|YP_003546704.1| ATP-dependent Clp protease adaptor protein ClpS [Sphingobium
           japonicum UT26S]
 gi|292676574|dbj|BAI98092.1| ATP-dependent Clp protease adaptor protein ClpS [Sphingobium
           japonicum UT26S]
          Length = 135

 Score =  154 bits (389), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 80/122 (65%)

Query: 16  DGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFV 75
                +   + MA    + +G       +    R  ++ + P LY+VL++ND+YTPMEFV
Sbjct: 13  SSSTTMAYSVTMAGRDQDDQGDGSGGPNVGIATRTRARTKKPSLYKVLMLNDDYTPMEFV 72

Query: 76  IHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
           +HVLQ FF  D E A  +ML VH +G+G CG+++YE+AE KVNQVM+++RQ+Q+PLQC +
Sbjct: 73  VHVLQQFFRMDMEEATRVMLHVHQRGVGVCGIFSYEVAETKVNQVMDFARQNQHPLQCTL 132

Query: 136 EQ 137
           E+
Sbjct: 133 EK 134


>gi|161898748|ref|YP_191042.2| ATP-dependent Clp protease adaptor protein ClpS [Gluconobacter
           oxydans 621H]
          Length = 143

 Score =  154 bits (389), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 56/132 (42%), Positives = 83/132 (62%), Gaps = 7/132 (5%)

Query: 13  VKRDGILALMSFIFMADSRMN------KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVN 66
           + R     L S +   +S  +        G  + D  +   VR  ++ R P +Y+VL++N
Sbjct: 13  LPRAAFPRLASRMG-PESPDSIPPHGPGNGDGDQDLDIGVVVRPRTRTRKPSMYKVLMLN 71

Query: 67  DNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQ 126
           D+YTPMEFV+HVL+ FF K  + A  IML+VH +G+G CGV+ YE+AE KV QVM+ +RQ
Sbjct: 72  DDYTPMEFVVHVLERFFAKTRDEATSIMLQVHQRGVGICGVFTYEVAESKVTQVMDLARQ 131

Query: 127 HQYPLQCIMEQK 138
           +Q+PLQC +E+ 
Sbjct: 132 NQHPLQCTIEKD 143


>gi|83310221|ref|YP_420485.1| ATP-dependent Clp protease adaptor protein ClpS [Magnetospirillum
           magneticum AMB-1]
 gi|123542818|sp|Q2W899|CLPS_MAGSA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|82945062|dbj|BAE49926.1| ATP-dependent Clp protease adaptor protein clpS [Magnetospirillum
           magneticum AMB-1]
          Length = 119

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 72/111 (64%)

Query: 28  ADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
             S          D      ++   K + P +Y+VL++ND+YTPMEFV+HVL+ FF K  
Sbjct: 9   GMSENGNDKRDGDDGQTGVVIKTRPKTKKPSMYKVLMLNDDYTPMEFVVHVLERFFNKSR 68

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           E A  +ML VH +G+G CGVY YE+AE KV QVM+ +RQ+Q+PLQC +E++
Sbjct: 69  EDATRVMLHVHTRGVGICGVYTYEVAETKVTQVMDLARQNQHPLQCTIEKE 119


>gi|254509526|ref|ZP_05121593.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacteraceae
           bacterium KLH11]
 gi|221533237|gb|EEE36225.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacteraceae
           bacterium KLH11]
          Length = 113

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 75/112 (66%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M + +       + D+     V+   K + P LY+VLL+ND+YTPMEFV+HVL+ FF   
Sbjct: 1   MRNDQWMMSDNPDEDDDTSILVQTRPKTQRPPLYKVLLLNDDYTPMEFVVHVLERFFGMT 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  IML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 61  HAQAFEIMLTVHKKGVAVVGVFSHEIAETKVGQVMDFARRHQHPLQCTMERE 112


>gi|16126706|ref|NP_421270.1| ATP-dependent Clp protease adaptor protein ClpS [Caulobacter
           crescentus CB15]
 gi|21542323|sp|Q9A5I0|CLPS_CAUCR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|13424016|gb|AAK24438.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 119

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 53/107 (49%), Positives = 69/107 (64%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
             K+G                K + P LYRVL++ND+YTPMEFV++VL+ FF K  E A 
Sbjct: 13  ERKQGGQGNGVGSSVVTEVKPKTQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDAT 72

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML VH  G+G CGVY YE+AE KV QV++ +R+HQ+PLQC ME+ 
Sbjct: 73  RIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD 119


>gi|88703373|ref|ZP_01101089.1| ATP-dependent Clp protease adaptor protein ClpS [Congregibacter
           litoralis KT71]
 gi|88702087|gb|EAQ99190.1| ATP-dependent Clp protease adaptor protein ClpS [Congregibacter
           litoralis KT71]
          Length = 169

 Score =  153 bits (388), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 47/104 (45%), Positives = 64/104 (61%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
           +K      D+   +      KV+ P LY+V+L+ND+YTPMEFV+ +L+ FF  + E A  
Sbjct: 62  DKNEEHGGDDGGLALQEAKPKVKRPPLYKVVLLNDDYTPMEFVVEILEVFFKMNREQATQ 121

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           IML VH  G G CG+Y  +IAE K  QV  Y+R HQ+PL C +E
Sbjct: 122 IMLTVHTHGKGVCGIYTKDIAETKSAQVNQYARDHQHPLLCEIE 165


>gi|94495922|ref|ZP_01302501.1| hypothetical protein SKA58_15107 [Sphingomonas sp. SKA58]
 gi|94424614|gb|EAT09636.1| hypothetical protein SKA58_15107 [Sphingomonas sp. SKA58]
          Length = 124

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 53/113 (46%), Positives = 80/113 (70%)

Query: 25  IFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFY 84
           + MA    + +G       +    R  ++ + P LY+VL++ND+YTPMEFV+HVLQ+FF 
Sbjct: 11  VNMAGRDQDDQGEGPGGPNVGIATRTRTRTKKPSLYKVLMLNDDYTPMEFVVHVLQSFFR 70

Query: 85  KDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            D E A  +ML VH +G+G CG+++YE+AE KVNQVM+++RQ+Q+PLQC +E+
Sbjct: 71  MDMEEATRVMLHVHQRGVGICGIFSYEVAETKVNQVMDFARQNQHPLQCTLEK 123


>gi|209884899|ref|YP_002288756.1| ATP-dependent Clp protease adaptor protein ClpS [Oligotropha
           carboxidovorans OM5]
 gi|209873095|gb|ACI92891.1| ATP-dependent Clp protease adaptor protein ClpS [Oligotropha
           carboxidovorans OM5]
          Length = 179

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 82/124 (66%), Gaps = 2/124 (1%)

Query: 15  RDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEF 74
            + +    + + M+ +     G +          R   + + P LYRVL++ND+YTPMEF
Sbjct: 58  GESVRRAAATVRMSKNDDRPDGTSG--PGTSVITRTKPRAKRPSLYRVLILNDDYTPMEF 115

Query: 75  VIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCI 134
           V+HVL+ FF KD E A  IML VHH GIGECGV+ YEIAE KV QVM+++R+HQ+PLQC+
Sbjct: 116 VVHVLEKFFQKDVEAATKIMLHVHHHGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCV 175

Query: 135 MEQK 138
           ME+K
Sbjct: 176 MEKK 179


>gi|146282647|ref|YP_001172800.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           stutzeri A1501]
 gi|145570852|gb|ABP79958.1| ATP-dependent Clp protease adaptor protein clpS [Pseudomonas
           stutzeri A1501]
          Length = 167

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 69/136 (50%), Gaps = 1/136 (0%)

Query: 3   LFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRV 62
           +    +   R +    +   + I +  ++         D    +      +++ P +Y+V
Sbjct: 32  VHIYLAPAPRPRTVMRMHAFAQIRLTFNQDRPL-EDGDDASGLAVEEAKPQLKAPPMYKV 90

Query: 63  LLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           ++ ND+YTPM+FV+ VL+  F    E A  IML VH +G   CGVY  ++AE K  QV  
Sbjct: 91  VMFNDDYTPMDFVVEVLEGIFNHSREQATKIMLAVHTEGQAVCGVYTRDVAETKAMQVNQ 150

Query: 123 YSRQHQYPLQCIMEQK 138
           Y+R+ Q+PL C +E+ 
Sbjct: 151 YARECQHPLLCEIEKD 166


>gi|254465322|ref|ZP_05078733.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacterales
           bacterium Y4I]
 gi|206686230|gb|EDZ46712.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacterales
           bacterium Y4I]
          Length = 121

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 48/114 (42%), Positives = 72/114 (63%)

Query: 25  IFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFY 84
           + M    +     ++ D       +   K + P  Y+VLL+ND+YTPMEFV+ VL+ FF 
Sbjct: 7   LLMPLQPIMMTDHSDDDTEAGVLTKTRPKTKRPPRYKVLLLNDDYTPMEFVVMVLERFFG 66

Query: 85  KDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             H  A  IML VH +G+   GV+++E+AE KV QVM+++R+HQ+PLQC ME++
Sbjct: 67  MTHAQAFEIMLTVHKKGVAVVGVFSHEVAETKVGQVMDFARRHQHPLQCTMEKE 120


>gi|260426993|ref|ZP_05780972.1| ATP-dependent Clp protease adapter protein ClpS [Citreicella sp.
           SE45]
 gi|260421485|gb|EEX14736.1| ATP-dependent Clp protease adapter protein ClpS [Citreicella sp.
           SE45]
          Length = 120

 Score =  153 bits (387), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 51/107 (47%), Positives = 71/107 (66%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
                     +  D  V+   K + P LY+VLL+ND+YTPMEFV+HVL+ FF   H  A 
Sbjct: 14  NTPSFDDGDGSDADVVVQTKPKTKRPPLYKVLLLNDDYTPMEFVVHVLERFFGMSHAQAF 73

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 74  EIMLTVHKKGVAVVGVFSHEIAETKVGQVMDFARRHQHPLQCTMEKE 120


>gi|239832059|ref|ZP_04680388.1| ATP-dependent Clp protease adapter protein clpS [Ochrobactrum
           intermedium LMG 3301]
 gi|239824326|gb|EEQ95894.1| ATP-dependent Clp protease adapter protein clpS [Ochrobactrum
           intermedium LMG 3301]
          Length = 148

 Score =  153 bits (387), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 87/137 (63%), Gaps = 2/137 (1%)

Query: 4   FDDGSMYHRVKRDGILALMSFIFMADSRM--NKKGIAEFDNCLDSEVRFSSKVRVPKLYR 61
            DD        R   + ++ F+   D  M     G    +N      R   K + P LYR
Sbjct: 12  HDDLHNRASWVRQMGIRVIGFMRHLDIVMQSKTDGGNGPENGTVVVTRTQPKTKKPSLYR 71

Query: 62  VLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVM 121
           VLL+ND+YTPMEFV+HVLQ FF K+ + A  IML VH+ G+GECGV+ YE+AE KV+QVM
Sbjct: 72  VLLLNDDYTPMEFVVHVLQRFFQKNRDDATRIMLHVHNHGVGECGVFTYEVAETKVSQVM 131

Query: 122 NYSRQHQYPLQCIMEQK 138
           +++RQ+Q+PLQC+ME+K
Sbjct: 132 DFARQNQHPLQCVMEKK 148


>gi|295917937|gb|ADG60244.1| ATP-dependent Clp protease adaptor protein ClpS [uncultured
           bacterium]
          Length = 133

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 47/104 (45%), Positives = 71/104 (68%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                +    +    R  +K + P  Y+VL++ND+YTPMEFV+ VL+ FF  D E A  +
Sbjct: 29  GNDDGDGQGQVGLATRTRAKPKKPSQYKVLMLNDDYTPMEFVVMVLKRFFRMDLEQATRV 88

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH +G+G CG++ YE+AE KV+QVM+++RQ+Q+PLQC +E+
Sbjct: 89  MLHVHQRGVGVCGIFPYEVAETKVSQVMDFARQNQHPLQCTLEK 132


>gi|221235488|ref|YP_002517925.1| ATP-dependent Clp protease adaptor protein ClpS [Caulobacter
           crescentus NA1000]
 gi|254763812|sp|B8GZM8|CLPS_CAUCN RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|220964661|gb|ACL96017.1| ATP-dependent Clp protease adaptor protein ClpS [Caulobacter
           crescentus NA1000]
          Length = 109

 Score =  153 bits (386), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 53/107 (49%), Positives = 69/107 (64%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
             K+G                K + P LYRVL++ND+YTPMEFV++VL+ FF K  E A 
Sbjct: 3   ERKQGGQGNGVGSSVVTEVKPKTQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDAT 62

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML VH  G+G CGVY YE+AE KV QV++ +R+HQ+PLQC ME+ 
Sbjct: 63  RIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD 109


>gi|260432448|ref|ZP_05786419.1| ATP-dependent Clp protease adaptor protein ClpS [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416276|gb|EEX09535.1| ATP-dependent Clp protease adaptor protein ClpS [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 113

 Score =  153 bits (386), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 76/112 (67%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M  +R    G ++ D      V+   K + P LY+VLL+ND+YTPMEFV+HVL+ FF   
Sbjct: 1   MLTARWMMAGKSDDDGDTSILVQTKPKTKRPPLYKVLLLNDDYTPMEFVVHVLERFFGMS 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  IML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 61  HAQAFEIMLTVHKKGVAVVGVFSHEIAETKVGQVMDFARRHQHPLQCTMERE 112


>gi|126732062|ref|ZP_01747864.1| ATP-dependent Clp protease adaptor protein ClpS [Sagittula stellata
           E-37]
 gi|126707351|gb|EBA06415.1| ATP-dependent Clp protease adaptor protein ClpS [Sagittula stellata
           E-37]
          Length = 116

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 70/107 (65%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M      +         +   K + P LY+VLL+ND+YTPMEFV+HVL+ FF   H  A 
Sbjct: 10  MAADEPDDGQGETGVVTKTKPKTKRPPLYKVLLLNDDYTPMEFVVHVLERFFGMTHAQAF 69

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +ML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 70  EVMLTVHKKGVAVVGVFSHEIAETKVGQVMDFARRHQHPLQCTMEKE 116


>gi|89056376|ref|YP_511827.1| ATP-dependent Clp protease adaptor protein ClpS [Jannaschia sp.
           CCS1]
 gi|88865925|gb|ABD56802.1| ATP-dependent Clp protease adaptor protein ClpS [Jannaschia sp.
           CCS1]
          Length = 116

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 72/107 (67%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
                +   D  +    +  +K + P +Y+V+L+ND+YTPMEFV+HVL+ FF   H  A 
Sbjct: 9   DEPDNVDGGDGDVSVATKTKTKTQRPPMYKVMLLNDDYTPMEFVVHVLERFFGITHSQAV 68

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML VH +G+   GV+++EIAE KV QVM+++R++Q+PLQC ME++
Sbjct: 69  EIMLVVHKKGLAVVGVFSHEIAETKVAQVMDFARRNQHPLQCTMEKE 115


>gi|295690174|ref|YP_003593867.1| ATP-dependent Clp protease adaptor protein ClpS [Caulobacter segnis
           ATCC 21756]
 gi|295432077|gb|ADG11249.1| ATP-dependent Clp protease adaptor protein ClpS [Caulobacter segnis
           ATCC 21756]
          Length = 109

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 53/107 (49%), Positives = 69/107 (64%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
             K+G                K + P LYRVL++ND+YTPMEFV++VL+ FF K  E A 
Sbjct: 3   ERKQGGQSNGAGSSVVTEVKPKTQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDAT 62

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML VH  G+G CGVY YE+AE KV QV++ +R+HQ+PLQC ME+ 
Sbjct: 63  RIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD 109


>gi|296116796|ref|ZP_06835402.1| ATP-dependent Clp protease adaptor protein ClpS [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976597|gb|EFG83369.1| ATP-dependent Clp protease adaptor protein ClpS [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 134

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 52/129 (40%), Positives = 72/129 (55%)

Query: 10  YHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNY 69
            H       +                     D      +R   + R P +Y+VL++ND+Y
Sbjct: 6   LHDRGTSPRVRAHGGNTPPRRPDGTGENGNDDGMAGVVIRTRPQTRKPAMYKVLMLNDDY 65

Query: 70  TPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQY 129
           TPMEFV+HVL+ FF K  E A  IML VH +G+G CGV+ YE+AE KV QVM+ +RQ+Q+
Sbjct: 66  TPMEFVVHVLERFFQKSREEATDIMLHVHKRGVGVCGVFTYEVAETKVTQVMDLARQNQH 125

Query: 130 PLQCIMEQK 138
           PLQC +E+ 
Sbjct: 126 PLQCTIEKD 134


>gi|329114968|ref|ZP_08243723.1| ATP-dependent Clp protease adapter protein ClpS [Acetobacter
           pomorum DM001]
 gi|326695411|gb|EGE47097.1| ATP-dependent Clp protease adapter protein ClpS [Acetobacter
           pomorum DM001]
          Length = 117

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 51/103 (49%), Positives = 73/103 (70%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
             ++    +   VR   K R P +Y+VL++ND+YTPMEFV++VL+ FF K+ E A  IML
Sbjct: 15  DSSDDGADIGVVVRAKPKTRKPAMYKVLMLNDDYTPMEFVVYVLERFFQKNREEATDIML 74

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            VH +G+G CGV+ YE+AE KV QVM+ +RQ+Q+PLQC +E+ 
Sbjct: 75  NVHRRGVGVCGVFTYEVAETKVAQVMDLARQNQHPLQCTIEKD 117


>gi|258541379|ref|YP_003186812.1| Clp protease adaptor protein ClpS [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632457|dbj|BAH98432.1| Clp protease adaptor protein ClpS [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635514|dbj|BAI01483.1| Clp protease adaptor protein ClpS [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638569|dbj|BAI04531.1| Clp protease adaptor protein ClpS [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641623|dbj|BAI07578.1| Clp protease adaptor protein ClpS [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644678|dbj|BAI10626.1| Clp protease adaptor protein ClpS [Acetobacter pasteurianus IFO
           3283-26]
 gi|256647733|dbj|BAI13674.1| Clp protease adaptor protein ClpS [Acetobacter pasteurianus IFO
           3283-32]
 gi|256650786|dbj|BAI16720.1| Clp protease adaptor protein ClpS [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653777|dbj|BAI19704.1| Clp protease adaptor protein ClpS [Acetobacter pasteurianus IFO
           3283-12]
          Length = 125

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 51/103 (49%), Positives = 73/103 (70%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
             ++    +   VR   K R P +Y+VL++ND+YTPMEFV++VL+ FF K+ E A  IML
Sbjct: 23  DSSDDGADIGVVVRAKPKTRKPAMYKVLMLNDDYTPMEFVVYVLERFFQKNREEATDIML 82

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            VH +G+G CGV+ YE+AE KV QVM+ +RQ+Q+PLQC +E+ 
Sbjct: 83  NVHRRGVGVCGVFTYEVAETKVAQVMDLARQNQHPLQCTIEKD 125


>gi|149913907|ref|ZP_01902439.1| ATP-dependent Clp protease, putative [Roseobacter sp. AzwK-3b]
 gi|149812191|gb|EDM72022.1| ATP-dependent Clp protease, putative [Roseobacter sp. AzwK-3b]
          Length = 107

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 72/107 (67%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M        +      V+  +K + P LY+VLL+ND+YTPMEFV+ VL+ FF  +H  A 
Sbjct: 1   MTGDDENGDEGDTSVVVKTRAKTKRPPLYKVLLLNDDYTPMEFVVAVLERFFGMNHAQAF 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +ML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 61  EVMLTVHKKGVAVVGVFSHEIAETKVAQVMDFARRHQHPLQCTMEKE 107


>gi|148261528|ref|YP_001235655.1| ATP-dependent Clp protease adaptor protein ClpS [Acidiphilium
           cryptum JF-5]
 gi|326405016|ref|YP_004285098.1| ATP-dependent Clp protease adaptor protein ClpS [Acidiphilium
           multivorum AIU301]
 gi|146403209|gb|ABQ31736.1| ATP-dependent Clp protease adaptor protein ClpS [Acidiphilium
           cryptum JF-5]
 gi|325051878|dbj|BAJ82216.1| ATP-dependent Clp protease adaptor protein ClpS [Acidiphilium
           multivorum AIU301]
          Length = 118

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 53/116 (45%), Positives = 76/116 (65%), Gaps = 2/116 (1%)

Query: 25  IFMADSRMNKKGIAEFDNC--LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
           +   ++ M+        N        R  +K R P LY+VL++ND+YTPMEFV+HVL+ F
Sbjct: 3   VRTENTLMSGSDRRGTGNGLGTGVATRTRTKTRKPSLYKVLMLNDDYTPMEFVVHVLERF 62

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           F K  + A+ IML VH +G+G CGV+ YE+AE KV QVM+ +RQ Q+PLQC +E++
Sbjct: 63  FGKSRQEAERIMLHVHRRGVGVCGVFTYEVAETKVTQVMDLARQSQHPLQCTIEKE 118


>gi|77464259|ref|YP_353763.1| ATP-dependent Clp protease adaptor protein clpS [Rhodobacter
           sphaeroides 2.4.1]
 gi|126463101|ref|YP_001044215.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221640143|ref|YP_002526405.1| ATP-dependent Clp protease adapter protein clpS [Rhodobacter
           sphaeroides KD131]
 gi|77388677|gb|ABA79862.1| ATP-dependent Clp protease adaptor protein clpS [Rhodobacter
           sphaeroides 2.4.1]
 gi|126104765|gb|ABN77443.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221160924|gb|ACM01904.1| ATP-dependent Clp protease adapter protein clpS [Rhodobacter
           sphaeroides KD131]
          Length = 106

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 70/104 (67%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
                  +      +  SK + P LY+VLL+ND+YTPMEFV+HVL+ FF   H  A  IM
Sbjct: 3   DKTGGPGDDTSILTKTRSKTQRPPLYKVLLLNDDYTPMEFVVHVLERFFGLSHAQAFEIM 62

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L VH +G+   GV+++E+AE KV QVM+++R+HQ+PLQC ME++
Sbjct: 63  LTVHKKGLAVVGVFSFEVAETKVAQVMDFARRHQHPLQCTMEKE 106


>gi|299135164|ref|ZP_07028355.1| ATP-dependent Clp protease adaptor protein ClpS [Afipia sp. 1NLS2]
 gi|298590141|gb|EFI50345.1| ATP-dependent Clp protease adaptor protein ClpS [Afipia sp. 1NLS2]
          Length = 228

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 76/109 (69%), Gaps = 2/109 (1%)

Query: 32  MNKKG--IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET 89
           M+K                +   + + P LYRVL++ND+YTPMEFV+HVL+ FF KD E 
Sbjct: 120 MSKDDGRPDGTGPGTSVITKTKPRTKRPSLYRVLILNDDYTPMEFVVHVLERFFQKDVEA 179

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           A  IML VHH GIGECG++ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 180 ATKIMLHVHHHGIGECGIFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 228


>gi|329851348|ref|ZP_08266105.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Asticcacaulis biprosthecum C19]
 gi|328840194|gb|EGF89766.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Asticcacaulis biprosthecum C19]
          Length = 161

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 52/91 (57%), Positives = 67/91 (73%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
           V    K + P LYRVL++ND+YTPMEFV++VL+ FF K  E A  IML VH  G+G CGV
Sbjct: 71  VETKPKPQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQTGVGVCGV 130

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           Y YE+AE KV QV++ +R+HQ+PLQC ME+ 
Sbjct: 131 YTYEVAETKVAQVVDMARRHQHPLQCTMEKD 161


>gi|162149242|ref|YP_001603703.1| ATP-dependent Clp protease adaptor protein ClpS [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787819|emb|CAP57417.1| putative ATP-dependent Clp protease adaptor protein clpS
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 146

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 50/116 (43%), Positives = 74/116 (63%), Gaps = 1/116 (0%)

Query: 23  SFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
                  ++  +    +    +   VR   + R P +Y+VL++ND+YTPMEFV+HVL+ F
Sbjct: 32  PTRREGGNQDGQSDNPD-SPTIGVVVRTRPQTRKPAMYKVLMLNDDYTPMEFVVHVLERF 90

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           F K  + A  IML VH +G+G CGV+ YE+AE KV QVM+ +RQ+Q+PLQC +E+ 
Sbjct: 91  FQKSRDEATDIMLHVHKRGVGVCGVFTYEVAETKVTQVMDLARQNQHPLQCTIEKD 146


>gi|90419585|ref|ZP_01227495.1| ATP-dependent Clp protease adaptor protein [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336522|gb|EAS50263.1| ATP-dependent Clp protease adaptor protein [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 122

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 60/104 (57%), Positives = 75/104 (72%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
           K      D   +   R   K + P LYRVLL+ND+YTPMEFVIHVL+ FF KD E A  I
Sbjct: 18  KDDDQVPDRGTEVITRTKPKTQKPSLYRVLLLNDDYTPMEFVIHVLERFFQKDREAATRI 77

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+ G+GECGV+ YE+AE KV QVM+++RQHQ+PLQC+ME+
Sbjct: 78  MLHVHNHGVGECGVFTYEVAETKVTQVMDFARQHQHPLQCVMEK 121


>gi|288957528|ref|YP_003447869.1| ATP-dependent Clp protease adaptor protein [Azospirillum sp. B510]
 gi|288909836|dbj|BAI71325.1| ATP-dependent Clp protease adaptor protein [Azospirillum sp. B510]
          Length = 108

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 73/112 (65%), Gaps = 4/112 (3%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           MADS                 V+   K + P +Y+VL++ND+YTPMEFV+ VL+ FF K 
Sbjct: 1   MADSDKRGNDG----TNSGVVVKAKPKTKKPSMYKVLMLNDDYTPMEFVVLVLERFFSKS 56

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            E A  IML VH +G+G CGV+ YE+AE KV QVM+++RQHQ+PLQC +E+ 
Sbjct: 57  REEATQIMLHVHRRGVGLCGVFTYEVAETKVTQVMDFARQHQHPLQCTLEKD 108


>gi|163744786|ref|ZP_02152146.1| ATP-dependent Clp protease, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161381604|gb|EDQ06013.1| ATP-dependent Clp protease, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 130

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 46/103 (44%), Positives = 71/103 (68%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
              +  +  +   +   K + P LY+V+L+ND++TPMEFV+ VL+ FF  +H  A  IML
Sbjct: 27  NGPKDSDDTELLTKTRPKTKRPPLYKVMLLNDDFTPMEFVVLVLERFFGLNHAQAFEIML 86

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 87  TVHKKGLAVVGVFSHEIAETKVAQVMDFARRHQHPLQCTMEKE 129


>gi|209545021|ref|YP_002277250.1| ATP-dependent Clp protease adaptor protein ClpS [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532698|gb|ACI52635.1| ATP-dependent Clp protease adaptor protein ClpS [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 135

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 50/116 (43%), Positives = 74/116 (63%), Gaps = 1/116 (0%)

Query: 23  SFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
                  ++  +    +    +   VR   + R P +Y+VL++ND+YTPMEFV+HVL+ F
Sbjct: 21  PTRREGGNQDGQSDNPD-SPTIGVVVRTRPQTRKPAMYKVLMLNDDYTPMEFVVHVLERF 79

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           F K  + A  IML VH +G+G CGV+ YE+AE KV QVM+ +RQ+Q+PLQC +E+ 
Sbjct: 80  FQKSRDEATDIMLHVHKRGVGVCGVFTYEVAETKVTQVMDLARQNQHPLQCTIEKD 135


>gi|182678642|ref|YP_001832788.1| ATP-dependent Clp protease adaptor protein ClpS [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182634525|gb|ACB95299.1| ATP-dependent Clp protease adaptor protein ClpS [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 137

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 58/131 (44%), Positives = 84/131 (64%)

Query: 8   SMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVND 67
           S   R      LA+ + + +  +  + +   +  +      R  ++ R P +YRVLL+ND
Sbjct: 7   SAIRRPPLLARLAVFAGLRIRGAGKDPQKGGDGGSGTAVITRPKTQTRRPSMYRVLLLND 66

Query: 68  NYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQH 127
           +YTPMEFV+ VL+ +F K  E A  IML VH  G+GECG++ YE+AE KV QVM+Y+R+H
Sbjct: 67  DYTPMEFVVSVLKKYFNKGPEEATRIMLHVHQHGVGECGIFTYEVAETKVTQVMDYARKH 126

Query: 128 QYPLQCIMEQK 138
           Q+PLQCIME+K
Sbjct: 127 QHPLQCIMEKK 137


>gi|87198523|ref|YP_495780.1| ATP-dependent Clp protease adaptor protein ClpS [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134204|gb|ABD24946.1| ATP-dependent Clp protease adaptor protein ClpS [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 126

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 71/106 (66%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
                    D  +    +  ++ + P  ++VL++ND+YTPMEFV+ VL+ FF  D E A 
Sbjct: 20  DEDTRGPGGDEQIGIATKTRARPKKPSQFKVLMLNDDYTPMEFVVMVLKRFFNMDLEQAT 79

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH +G+G CG++ YEIAE KVNQVM+++RQ+Q+PLQC +E+
Sbjct: 80  RVMLHVHQRGVGVCGIFPYEIAETKVNQVMDFARQNQHPLQCTLEK 125


>gi|23502048|ref|NP_698175.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella suis
           1330]
 gi|62290083|ref|YP_221876.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella abortus
           bv. 1 str. 9-941]
 gi|82700008|ref|YP_414582.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella
           melitensis biovar Abortus 2308]
 gi|148559927|ref|YP_001259088.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella ovis ATCC
           25840]
 gi|225627638|ref|ZP_03785675.1| ATP-dependent Clp protease adapter protein clpS [Brucella ceti str.
           Cudo]
 gi|237815589|ref|ZP_04594586.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           str. 2308 A]
 gi|256369595|ref|YP_003107105.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella microti
           CCM 4915]
 gi|297248480|ref|ZP_06932198.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella abortus
           bv. 5 str. B3196]
 gi|23348003|gb|AAN30090.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62196215|gb|AAX74515.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616109|emb|CAJ11148.1| Protein of unknown function DUF174 [Brucella melitensis biovar
           Abortus 2308]
 gi|148371184|gb|ABQ61163.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella ovis ATCC
           25840]
 gi|225617643|gb|EEH14688.1| ATP-dependent Clp protease adapter protein clpS [Brucella ceti str.
           Cudo]
 gi|237788887|gb|EEP63098.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           str. 2308 A]
 gi|255999757|gb|ACU48156.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella microti
           CCM 4915]
 gi|297175649|gb|EFH34996.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella abortus
           bv. 5 str. B3196]
          Length = 136

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 62/137 (45%), Positives = 85/137 (62%), Gaps = 4/137 (2%)

Query: 2   YLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYR 61
           Y+      Y     D  +  ++ I          G    ++      R   K R P LYR
Sbjct: 4   YILGQAEPYEWASSDRFMRRINTIMQG----KTNGGNGPESGTVVVTRTQPKTRKPSLYR 59

Query: 62  VLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVM 121
           VLL+ND+YTPMEFV+HVLQ FF K+ + A  IML VH+ G+GECGV+ YE+AE KV+QVM
Sbjct: 60  VLLLNDDYTPMEFVVHVLQRFFQKNLDDATRIMLHVHNHGVGECGVFTYEVAETKVSQVM 119

Query: 122 NYSRQHQYPLQCIMEQK 138
           +++RQ+Q+PLQC+ME+K
Sbjct: 120 DFARQNQHPLQCVMEKK 136


>gi|163733946|ref|ZP_02141388.1| ATP-dependent Clp protease, putative [Roseobacter litoralis Och
           149]
 gi|161393057|gb|EDQ17384.1| ATP-dependent Clp protease, putative [Roseobacter litoralis Och
           149]
          Length = 113

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 51/112 (45%), Positives = 72/112 (64%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M          +E D           K + P LY+VLL+ND++TPMEFV+HVL+ FF  +
Sbjct: 1   MHRDLYMMSDRSEDDGDTSILTATKPKTKRPPLYKVLLLNDDFTPMEFVVHVLERFFGLN 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  IML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 61  HAQAFEIMLTVHKKGVAVVGVFSHEIAETKVAQVMDFARRHQHPLQCTMEKE 112


>gi|146276596|ref|YP_001166755.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacter
           sphaeroides ATCC 17025]
 gi|166214741|sp|A4WPY6|CLPS_RHOS5 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|145554837|gb|ABP69450.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 113

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 70/104 (67%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
                  +      +  SK + P LY+VLL+ND+YTPMEFV+HVL+ FF   H  A  IM
Sbjct: 10  DKTGGTGDDTSILTKTRSKTQRPPLYKVLLLNDDYTPMEFVVHVLERFFGLSHAQAFEIM 69

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L VH +G+   GV+++E+AE KV QVM+++R+HQ+PLQC ME++
Sbjct: 70  LTVHKKGLAVVGVFSFEVAETKVAQVMDFARRHQHPLQCTMEKE 113


>gi|17987098|ref|NP_539732.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella
           melitensis bv. 1 str. 16M]
 gi|17982759|gb|AAL51996.1| protein ylja [Brucella melitensis bv. 1 str. 16M]
          Length = 136

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 62/137 (45%), Positives = 84/137 (61%), Gaps = 4/137 (2%)

Query: 2   YLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYR 61
           Y+      Y     D  +   + I          G    ++      R   K R P LYR
Sbjct: 4   YILGQAEPYEWASSDRFMRRFNTIMQG----KTNGGNGPESGTVVVTRTQPKTRKPSLYR 59

Query: 62  VLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVM 121
           VLL+ND+YTPMEFV+HVLQ FF K+ + A  IML VH+ G+GECGV+ YE+AE KV+QVM
Sbjct: 60  VLLLNDDYTPMEFVVHVLQRFFQKNLDDATRIMLHVHNHGVGECGVFTYEVAETKVSQVM 119

Query: 122 NYSRQHQYPLQCIMEQK 138
           +++RQ+Q+PLQC+ME+K
Sbjct: 120 DFARQNQHPLQCVMEKK 136


>gi|89069767|ref|ZP_01157103.1| ATP-dependent Clp protease adaptor protein clpS [Oceanicola
           granulosus HTCC2516]
 gi|89044713|gb|EAR50824.1| ATP-dependent Clp protease adaptor protein clpS [Oceanicola
           granulosus HTCC2516]
          Length = 113

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 50/112 (44%), Positives = 74/112 (66%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           +AD  M      +       +V    K + P LY+VL++ND+YTPMEFV+HVL+ FF   
Sbjct: 2   LADHNMMADNDDDGGTDAGVKVETRPKTKRPPLYKVLILNDDYTPMEFVVHVLERFFGLS 61

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  +ML VH +G+   GV+++EIAE KV QVM+++++HQ+PLQC ME++
Sbjct: 62  HAQAFDLMLTVHKKGLAVVGVFSFEIAETKVAQVMDFAQRHQHPLQCTMEKE 113


>gi|296533024|ref|ZP_06895672.1| ATP-dependent Clp protease [Roseomonas cervicalis ATCC 49957]
 gi|296266653|gb|EFH12630.1| ATP-dependent Clp protease [Roseomonas cervicalis ATCC 49957]
          Length = 120

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 75/110 (68%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
           DS  N  G           V+   + R P +Y+VL++ND+YTPMEFV+HVL+ FF K+ E
Sbjct: 11  DSGQNGNGQTGDGAATGVVVKTRPRTRKPAMYKVLMLNDDYTPMEFVVHVLERFFQKNRE 70

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            A  IML VH +G+G CGVY YE+AE KV QVM+ +RQ+Q+PLQC +E++
Sbjct: 71  EATRIMLHVHRRGVGVCGVYTYEVAETKVTQVMDLARQNQHPLQCTIEKE 120


>gi|150396335|ref|YP_001326802.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           medicae WSM419]
 gi|150027850|gb|ABR59967.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           medicae WSM419]
          Length = 117

 Score =  150 bits (379), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 76/116 (65%), Gaps = 2/116 (1%)

Query: 25  IFMADSRMNKKGI--AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
           I M               +       R   K + P LYRVLL+ND+YTPMEFVIH+L+ F
Sbjct: 2   IAMPVRMQQGSDGNGGGPNRGTSVITRTKPKTKKPSLYRVLLLNDDYTPMEFVIHILERF 61

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           F KD E A  IML VH+ G+GECGV+ YE+AE KV QVM+++RQHQ+PLQC+ME+K
Sbjct: 62  FQKDREEATTIMLHVHNHGVGECGVFTYEVAETKVTQVMDFARQHQHPLQCVMEKK 117


>gi|254486976|ref|ZP_05100181.1| ATP-dependent Clp protease adaptor protein ClpS [Roseobacter sp.
           GAI101]
 gi|214043845|gb|EEB84483.1| ATP-dependent Clp protease adaptor protein ClpS [Roseobacter sp.
           GAI101]
          Length = 113

 Score =  150 bits (379), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 51/112 (45%), Positives = 75/112 (66%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M    +   G    D+  D   +   K + P LY+V+L+ND++TPMEFV+HVL+ FF  +
Sbjct: 1   MRLDDLMMAGKDRDDDETDLLTKTKPKTKRPPLYKVMLLNDDFTPMEFVVHVLERFFGLN 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  IML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 61  HAQAFEIMLTVHKKGLAVVGVFSHEIAETKVAQVMDFARRHQHPLQCTMEKE 112


>gi|167647097|ref|YP_001684760.1| ATP-dependent Clp protease adaptor protein ClpS [Caulobacter sp.
           K31]
 gi|254763813|sp|B0T2L1|CLPS_CAUSK RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|167349527|gb|ABZ72262.1| ATP-dependent Clp protease adaptor protein ClpS [Caulobacter sp.
           K31]
          Length = 109

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 52/107 (48%), Positives = 69/107 (64%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
             K+G                K + P LYRVL++ND+YTPMEFV++VL+ FF K  E A 
Sbjct: 3   ERKQGGQNNGAGSSVITEVKPKTQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDAT 62

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML VH  G+G CGV+ YE+AE KV QV++ +R+HQ+PLQC ME+ 
Sbjct: 63  RIMLHVHQHGVGVCGVFTYEVAETKVAQVIDSARRHQHPLQCTMEKD 109


>gi|110678604|ref|YP_681611.1| ATP-dependent Clp protease, putative [Roseobacter denitrificans OCh
           114]
 gi|123362148|sp|Q16AR8|CLPS_ROSDO RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|109454720|gb|ABG30925.1| ATP-dependent Clp protease, putative [Roseobacter denitrificans OCh
           114]
          Length = 113

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 51/112 (45%), Positives = 72/112 (64%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M          +E D           K + P LY+VLL+ND++TPMEFV+HVL+ FF  +
Sbjct: 1   MHRDLHMMSDRSEDDGDTSILTATKPKTKRPPLYKVLLLNDDFTPMEFVVHVLERFFGLN 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  IML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 61  HAQAFEIMLTVHKKGVAVVGVFSHEIAETKVAQVMDFARRHQHPLQCTMEKE 112


>gi|162452665|ref|YP_001615032.1| hypothetical protein sce4389 [Sorangium cellulosum 'So ce 56']
 gi|161163247|emb|CAN94552.1| hypothetical protein sce4389 [Sorangium cellulosum 'So ce 56']
          Length = 132

 Score =  149 bits (378), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 47/125 (37%), Positives = 70/125 (56%), Gaps = 5/125 (4%)

Query: 14  KRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPME 73
           +R G LA++   FM +    ++     D   D       KV  P+ Y+V+  ND+YT ME
Sbjct: 13  RRGGALAILPDGFMPNDPEERE-----DRQGDLATERERKVEKPRRYKVVFHNDDYTTME 67

Query: 74  FVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQC 133
           FV+ VL  FF++    A  IML VHH+G G  GVY  ++AE KV QV +++++H  PL+ 
Sbjct: 68  FVVLVLMKFFHRTETEATHIMLSVHHRGHGVAGVYTKDVAETKVAQVQDFAKEHGMPLRL 127

Query: 134 IMEQK 138
             E +
Sbjct: 128 TAEPE 132


>gi|307294031|ref|ZP_07573875.1| ATP-dependent Clp protease adaptor protein ClpS [Sphingobium
           chlorophenolicum L-1]
 gi|306880182|gb|EFN11399.1| ATP-dependent Clp protease adaptor protein ClpS [Sphingobium
           chlorophenolicum L-1]
          Length = 112

 Score =  149 bits (378), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 53/111 (47%), Positives = 78/111 (70%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           MA    + +G       +    R  ++ + P LY+VL++ND+YTPMEFV+HVLQ FF  D
Sbjct: 1   MAGRDQDDQGDGSGGPNVGIATRTRARTKKPSLYKVLMLNDDYTPMEFVVHVLQQFFRMD 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            E A  +ML VH +G+G CG+++YE+AE KVNQVM+++RQ+Q+PLQC +E+
Sbjct: 61  MEEATRVMLHVHQRGVGVCGIFSYEVAETKVNQVMDFARQNQHPLQCTLEK 111


>gi|163797886|ref|ZP_02191830.1| ATP-dependent Clp protease adaptor protein clpS [alpha
           proteobacterium BAL199]
 gi|159176848|gb|EDP61416.1| ATP-dependent Clp protease adaptor protein clpS [alpha
           proteobacterium BAL199]
          Length = 108

 Score =  149 bits (378), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 70/100 (70%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
                    V+   K + P +Y+V+++ND+YTPMEFV+H+++ FF K  E A  IML VH
Sbjct: 9   GGRPTTGVVVKTRPKTKKPSMYKVIMLNDDYTPMEFVVHIIERFFAKSREEATQIMLHVH 68

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +G+G CGVY YE+AE KV QVM+++RQHQ+PLQC +E+ 
Sbjct: 69  QRGVGICGVYTYEVAETKVTQVMDFARQHQHPLQCTLEKD 108


>gi|99082374|ref|YP_614528.1| ATP-dependent Clp protease adaptor protein ClpS [Ruegeria sp.
           TM1040]
 gi|122397582|sp|Q1GDK0|CLPS_SILST RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|99038654|gb|ABF65266.1| ATP-dependent Clp protease adaptor protein ClpS [Ruegeria sp.
           TM1040]
          Length = 113

 Score =  149 bits (378), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 72/112 (64%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M    +      + ++ L    +   + + P  Y+VLL+ND+YTPMEFV+ VL+ FF  +
Sbjct: 1   MLMQPLMMSDNPDDESDLGLLTKTRPRTQRPPRYKVLLLNDDYTPMEFVVIVLERFFGLN 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  IML VH +G+   GV+++E+AE KV QVM+Y+R+HQ+PLQC ME+ 
Sbjct: 61  HAQAFEIMLTVHKKGLAVVGVFSHEVAETKVAQVMDYARRHQHPLQCTMEKD 112


>gi|83855083|ref|ZP_00948613.1| ATP-dependent Clp protease, adaptor protein ClpS [Sulfitobacter sp.
           NAS-14.1]
 gi|83941607|ref|ZP_00954069.1| ATP-dependent Clp protease, adaptor protein ClpS [Sulfitobacter sp.
           EE-36]
 gi|83842926|gb|EAP82093.1| ATP-dependent Clp protease, adaptor protein ClpS [Sulfitobacter sp.
           NAS-14.1]
 gi|83847427|gb|EAP85302.1| ATP-dependent Clp protease, adaptor protein ClpS [Sulfitobacter sp.
           EE-36]
          Length = 113

 Score =  149 bits (378), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 50/112 (44%), Positives = 74/112 (66%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M    +   G    D+  D   +   K + P LY+V+L+ND++TPMEFV+ VL+ FF  +
Sbjct: 1   MRLDDLMMAGKDRDDDETDLLTKTKPKTKRPPLYKVMLLNDDFTPMEFVVIVLERFFGLN 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  IML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 61  HAQAFEIMLTVHKKGLAVVGVFSHEIAETKVAQVMDFARRHQHPLQCTMEKE 112


>gi|86357527|ref|YP_469419.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium etli CFN
           42]
 gi|218460323|ref|ZP_03500414.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium etli Kim
           5]
 gi|86281629|gb|ABC90692.1| ATP-dependent Clp protease adaptor protein [Rhizobium etli CFN 42]
          Length = 117

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 83/118 (70%), Gaps = 2/118 (1%)

Query: 21  LMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ 80
           +   I M +   +++     +       R   K + P LYRVLL+ND+YTPMEFVIH+L+
Sbjct: 2   IAKPIRMQN--DSERNGDNGNRGTSVITRTKPKTKKPNLYRVLLLNDDYTPMEFVIHILE 59

Query: 81  NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            FF KD E+A  IML VH+ G+GECG++ YE+AE KV+QVM+++RQHQ+PLQC+ME+K
Sbjct: 60  RFFQKDRESATRIMLHVHNHGVGECGIFTYEVAETKVSQVMDFARQHQHPLQCVMEKK 117


>gi|85704460|ref|ZP_01035562.1| ATP-dependent Clp protease, adaptor protein ClpS [Roseovarius sp.
           217]
 gi|85670868|gb|EAQ25727.1| ATP-dependent Clp protease, adaptor protein ClpS [Roseovarius sp.
           217]
          Length = 112

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 71/112 (63%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M    +   G  E        V    K + P LY+VLL+ND+YTPMEFV+ VL+ FF   
Sbjct: 1   MIQHPITMAGPDEDAGDPAVVVATRPKTKRPPLYKVLLLNDDYTPMEFVVAVLERFFGMS 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  IML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 61  HAQAFEIMLTVHKKGLAVVGVFSHEIAETKVAQVMDFARRHQHPLQCTMEKE 112


>gi|190891596|ref|YP_001978138.1| ATP-dependent Clp protease adaptor protein [Rhizobium etli CIAT
           652]
 gi|190696875|gb|ACE90960.1| ATP-dependent Clp protease adaptor protein [Rhizobium etli CIAT
           652]
          Length = 117

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 81/118 (68%), Gaps = 2/118 (1%)

Query: 21  LMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ 80
           +   I M ++          +       R   K + P LYRVLL+ND+YTPMEFVIH+L+
Sbjct: 2   IAKPIRMQNNGERNGD--NGNRGTSVITRTKPKTKKPNLYRVLLLNDDYTPMEFVIHILE 59

Query: 81  NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            FF KD E+A  IML VH+ G+GECG++ YE+AE KV+QVM+++RQHQ+PLQC+ME+K
Sbjct: 60  RFFQKDRESATRIMLHVHNHGVGECGIFTYEVAETKVSQVMDFARQHQHPLQCVMEKK 117


>gi|315498280|ref|YP_004087084.1| ATP-dependent clp protease adaptor protein clps [Asticcacaulis
           excentricus CB 48]
 gi|315416292|gb|ADU12933.1| ATP-dependent Clp protease adaptor protein ClpS [Asticcacaulis
           excentricus CB 48]
          Length = 132

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/103 (50%), Positives = 70/103 (67%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
            + +  N   + +    K   P LYRVL++ND+YTPMEFV++VL+ FF K  E A  IML
Sbjct: 30  DVDKPANAPFAVIDAKPKAAKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIML 89

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            VH  G+G CGVY YE+AE KV QV++ +R+HQ+PLQC ME+ 
Sbjct: 90  HVHQTGVGVCGVYTYEVAETKVAQVVDMARRHQHPLQCTMEKD 132


>gi|197104769|ref|YP_002130146.1| hypothetical protein PHZ_c1303 [Phenylobacterium zucineum HLK1]
 gi|238690132|sp|B4R947|CLPS_PHEZH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|196478189|gb|ACG77717.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 109

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 71/108 (65%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
              K+G +          +   K + P +YRVLL+ND+YTPMEFV++VL+ FF K  E A
Sbjct: 2   SERKEGDSGAGVRSAVITQTKPKTQKPAMYRVLLLNDDYTPMEFVVYVLEQFFNKSREDA 61

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             IML VH  G+G CGVY YE+AE KV QV++ +R+HQ+PLQC ME+ 
Sbjct: 62  TRIMLHVHQHGVGVCGVYTYEVAETKVAQVVDTARRHQHPLQCTMEKD 109


>gi|209964988|ref|YP_002297903.1| ATP-dependent Clp protease adaptor protein ClpS,putative
           [Rhodospirillum centenum SW]
 gi|259491250|sp|B6INJ3|CLPS_RHOCS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|209958454|gb|ACI99090.1| ATP-dependent Clp protease adaptor protein ClpS,putative
           [Rhodospirillum centenum SW]
          Length = 108

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/112 (49%), Positives = 76/112 (67%), Gaps = 4/112 (3%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           MADS  +              V+   K + P +Y+VL++ND+YTPMEFV+HVL+ FF K+
Sbjct: 1   MADSDKHGDEGP----STGVVVKAKPKTKKPSMYKVLMLNDDYTPMEFVVHVLERFFNKN 56

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            E A  IML VH +G+G CGV+ YE+AE KV QVM+++RQHQ+PLQC +E+ 
Sbjct: 57  REEATRIMLHVHRRGVGVCGVFTYEVAETKVTQVMDFARQHQHPLQCTLEKD 108


>gi|154248457|ref|YP_001419415.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthobacter
           autotrophicus Py2]
 gi|154162542|gb|ABS69758.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthobacter
           autotrophicus Py2]
          Length = 124

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/108 (50%), Positives = 73/108 (67%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
                             R   + + P LYRVLL+ND+YTPMEFV+HVL+ FF KD + A
Sbjct: 17  PDTPPRRGGDGPGTAVISRTKPQTKRPSLYRVLLLNDDYTPMEFVVHVLERFFNKDRDQA 76

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             IML VH+ G+GECGV+ YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 77  NTIMLHVHNHGVGECGVFTYEVAETKVTQVMDFARKHQHPLQCVMEKK 124


>gi|227821888|ref|YP_002825858.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           fredii NGR234]
 gi|227340887|gb|ACP25105.1| ATP-dependent Clp protease adaptor protein ClpS 1 [Sinorhizobium
           fredii NGR234]
          Length = 117

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 78/116 (67%), Gaps = 2/116 (1%)

Query: 25  IFMA--DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
           I M     + ++              R   K + P LYRVLL+ND+YTPMEFV+H+L+ F
Sbjct: 2   IAMPVRMQQGSEGNGGGPSRGTSVITRTKPKTKKPSLYRVLLLNDDYTPMEFVVHILERF 61

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           F KD E A  IML VH+ G+GECGV+ YE+AE KV QVM+++RQHQ+PLQC+ME+K
Sbjct: 62  FQKDREQATVIMLHVHNHGVGECGVFTYEVAETKVTQVMDFARQHQHPLQCVMEKK 117


>gi|15965239|ref|NP_385592.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           meliloti 1021]
 gi|307309262|ref|ZP_07588930.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           meliloti BL225C]
 gi|307317004|ref|ZP_07596445.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           meliloti AK83]
 gi|21542320|sp|Q92Q63|CLPS1_RHIME RecName: Full=ATP-dependent Clp protease adapter protein ClpS 1
 gi|15074419|emb|CAC46065.1| Putative ATP-dependent Clp protease adapter protein clpS 1
           [Sinorhizobium meliloti 1021]
 gi|306897092|gb|EFN27837.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           meliloti AK83]
 gi|306900263|gb|EFN30880.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           meliloti BL225C]
          Length = 117

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 78/116 (67%), Gaps = 2/116 (1%)

Query: 25  IFMA--DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
           I M     + ++              R   K + P LYRVLL+ND+YTPMEFVIH+L+ F
Sbjct: 2   IAMPVRMQQGSEGDGGGPSRGTSVITRTKPKTKKPSLYRVLLLNDDYTPMEFVIHILERF 61

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           F K+ E A  IML VH+ G+GECGV+ YE+AE KV QVM+++RQHQ+PLQC+ME+K
Sbjct: 62  FQKNREEATVIMLHVHNHGVGECGVFTYEVAETKVTQVMDFARQHQHPLQCVMEKK 117


>gi|153009350|ref|YP_001370565.1| ATP-dependent Clp protease adaptor protein ClpS [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561238|gb|ABS14736.1| ATP-dependent Clp protease adaptor protein ClpS [Ochrobactrum
           anthropi ATCC 49188]
          Length = 124

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 58/108 (53%), Positives = 78/108 (72%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
           +    G    +N      R   K + P LYRVLL+ND+YTPMEFV+HVLQ FF K+ + A
Sbjct: 17  QSKTDGGNGPENGTVLVTRTQPKTKKPSLYRVLLLNDDYTPMEFVVHVLQRFFQKNQDDA 76

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             IML VH+ G+GECGV+ YE+AE KV+QVM+++RQ+Q+PLQC+ME+K
Sbjct: 77  TRIMLHVHNHGVGECGVFTYEVAETKVSQVMDFARQNQHPLQCVMEKK 124


>gi|67460154|sp|Q5FTB0|CLPS_GLUOX RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|58001492|gb|AAW60386.1| Hypothetical protein GOX0608 [Gluconobacter oxydans 621H]
          Length = 119

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/116 (44%), Positives = 75/116 (64%), Gaps = 2/116 (1%)

Query: 23  SFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
                        G  + D  +   VR  ++ R P +Y+VL++ND+YTPMEFV+HVL+ F
Sbjct: 6   PDSIPPHGP--GNGDGDQDLDIGVVVRPRTRTRKPSMYKVLMLNDDYTPMEFVVHVLERF 63

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           F K  + A  IML+VH +G+G CGV+ YE+AE KV QVM+ +RQ+Q+PLQC +E+ 
Sbjct: 64  FAKTRDEATSIMLQVHQRGVGICGVFTYEVAESKVTQVMDLARQNQHPLQCTIEKD 119


>gi|149186435|ref|ZP_01864748.1| hypothetical protein ED21_23138 [Erythrobacter sp. SD-21]
 gi|148830024|gb|EDL48462.1| hypothetical protein ED21_23138 [Erythrobacter sp. SD-21]
          Length = 121

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/103 (48%), Positives = 72/103 (69%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
               E D  +    +  +K + P  Y+VLL+ND+YTPMEFV+ VL+ FF  D E A  +M
Sbjct: 18  DDRREGDGQVAIATKTRAKPKKPSQYKVLLLNDDYTPMEFVVIVLKRFFRMDMEEATRVM 77

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L VH +G+G CG++ YE+AE KVNQVM+++RQ+Q+PLQC +E+
Sbjct: 78  LHVHQKGVGVCGIFPYEVAETKVNQVMDFARQNQHPLQCTLEK 120


>gi|149201108|ref|ZP_01878083.1| ATP-dependent Clp protease adaptor protein ClpS [Roseovarius sp.
           TM1035]
 gi|149145441|gb|EDM33467.1| ATP-dependent Clp protease adaptor protein ClpS [Roseovarius sp.
           TM1035]
          Length = 112

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 71/112 (63%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M    +   G  E        V    K + P LY+VLL+ND+YTPMEFV+ VL+ FF   
Sbjct: 1   MIQHPITMTGPKEDAGDPAVVVATRPKTKRPPLYKVLLLNDDYTPMEFVVAVLERFFGMS 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  IML VH +G+   GV+++EIAE KV QVM+++R+HQ+PLQC ME++
Sbjct: 61  HAQAFEIMLTVHKKGLAVVGVFSHEIAETKVAQVMDFARRHQHPLQCTMEKE 112


>gi|92117938|ref|YP_577667.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrobacter
           hamburgensis X14]
 gi|91800832|gb|ABE63207.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrobacter
           hamburgensis X14]
          Length = 124

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 61/120 (50%), Positives = 78/120 (65%), Gaps = 2/120 (1%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +       M +      G    D       +   K + P LYRVL++ND+YTPMEFV+HV
Sbjct: 7   IRSAPAPRMGNDEDRTDGR--GDPAASVITKVKPKTKRPNLYRVLILNDDYTPMEFVVHV 64

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF KD E A  IML VHH GIGECGV+ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 65  LEKFFQKDVEAATEIMLHVHHHGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 124


>gi|84685218|ref|ZP_01013117.1| ATP-dependent Clp protease adaptor protein clpS [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666950|gb|EAQ13421.1| ATP-dependent Clp protease adaptor protein clpS [Rhodobacterales
           bacterium HTCC2654]
          Length = 118

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/107 (49%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
               G    D      VR  +K + P LY+VLL+ND++TPMEFV+ VL+ FF  +H  A 
Sbjct: 14  DEPNGPPGGDTQ--LAVRPKAKSKRPPLYKVLLINDDFTPMEFVVMVLERFFSMNHAQAF 71

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML VH +G+   GV++YEIAE KVNQVM  +RQ+Q+PLQC ME++
Sbjct: 72  EIMLTVHKKGLAVVGVFSYEIAETKVNQVMEMARQYQHPLQCTMERE 118


>gi|255264828|ref|ZP_05344170.1| ATP-dependent Clp protease adaptor protein ClpS [Thalassiobium sp.
           R2A62]
 gi|255107163|gb|EET49837.1| ATP-dependent Clp protease adaptor protein ClpS [Thalassiobium sp.
           R2A62]
          Length = 113

 Score =  148 bits (374), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 72/107 (67%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M        D+ +   V    K + P LY+V+++ND+YTPMEFV+ VL+ FF  +H  + 
Sbjct: 7   MMADDPGGDDSDVGLAVETRPKTKRPPLYKVMILNDDYTPMEFVVMVLERFFGMNHAQSF 66

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +ML VH +G+   GV++YEIAE KV QVM++++QHQ+PLQC ME++
Sbjct: 67  ELMLTVHKKGLAVVGVFSYEIAETKVAQVMDFAQQHQHPLQCTMEKE 113


>gi|302382575|ref|YP_003818398.1| ATP-dependent Clp protease adaptor protein ClpS [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193203|gb|ADL00775.1| ATP-dependent Clp protease adaptor protein ClpS [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 110

 Score =  148 bits (374), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 2/112 (1%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M   R  ++          +      K++ P LYRVL++ND+YTPMEFV++VL+ FF K 
Sbjct: 1   MPTRRPGEQNGGG--QGAATITETKPKLQKPSLYRVLILNDDYTPMEFVVYVLERFFQKS 58

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            E A  IML VH  G+G CGV+ YE+AE KV QV+  +R+HQ+PLQC ME+ 
Sbjct: 59  REDATRIMLHVHQHGVGVCGVFTYEVAETKVAQVVETARRHQHPLQCTMEKD 110


>gi|126740638|ref|ZP_01756325.1| ATP-dependent Clp protease, adaptor protein ClpS [Roseobacter sp.
           SK209-2-6]
 gi|126718439|gb|EBA15154.1| ATP-dependent Clp protease, adaptor protein ClpS [Roseobacter sp.
           SK209-2-6]
          Length = 121

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 48/113 (42%), Positives = 68/113 (60%)

Query: 26  FMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYK 85
            M    +      + D       +   K + P  Y+VLL+ND+YTPMEFV+ VL+ FF  
Sbjct: 8   PMPLQPVMMSQYPDDDADTGVLTKTRPKTKRPPRYKVLLLNDDYTPMEFVVMVLERFFSM 67

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H  A  IML VH +G+   GV+ +EIAE KV QVM+++ +HQ+PLQC ME++
Sbjct: 68  THAEAFDIMLTVHKKGLAVVGVFTHEIAETKVAQVMDFAGRHQHPLQCTMEKE 120


>gi|288941931|ref|YP_003444171.1| ATP-dependent Clp protease adaptor protein ClpS [Allochromatium
           vinosum DSM 180]
 gi|288897303|gb|ADC63139.1| ATP-dependent Clp protease adaptor protein ClpS [Allochromatium
           vinosum DSM 180]
          Length = 107

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 67/106 (63%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M      E      S      K+R P LY+VLL+ND+YTPMEFV+ VL+ FF  + E A 
Sbjct: 1   MTNPRSGEERESGLSVQEARPKLRRPPLYKVLLLNDDYTPMEFVVLVLEIFFGMNREKAT 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH +G+G CGV+  +IAE KV QV +Y+R +Q+PL C ME+
Sbjct: 61  QVMLHVHTRGVGVCGVFTKDIAETKVAQVNDYARGNQHPLMCTMEE 106


>gi|163760870|ref|ZP_02167949.1| ATP-dependent Clp protease adaptor protein ClpS [Hoeflea
           phototrophica DFL-43]
 gi|162281914|gb|EDQ32206.1| ATP-dependent Clp protease adaptor protein ClpS [Hoeflea
           phototrophica DFL-43]
          Length = 122

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 58/107 (54%), Positives = 75/107 (70%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
             K G    D       R   +V+ P LYRVLL+ND+YTPMEFVIHVL+ FF KD + A 
Sbjct: 16  DKKTGDGGSDRGTSVITRTKPQVKKPSLYRVLLLNDDYTPMEFVIHVLERFFQKDRDQAT 75

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML VH+ G+GECGV+ YE+AE KV QVM+++R + +PLQC+ME+K
Sbjct: 76  RIMLHVHNHGVGECGVFTYEVAETKVTQVMDFARTNHHPLQCVMEKK 122


>gi|304321615|ref|YP_003855258.1| ATP-dependent Clp protease adaptor protein ClpS [Parvularcula
           bermudensis HTCC2503]
 gi|303300517|gb|ADM10116.1| ATP-dependent Clp protease adaptor protein ClpS [Parvularcula
           bermudensis HTCC2503]
          Length = 146

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 76/113 (67%)

Query: 26  FMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYK 85
            M    M++ G  +    + + V+   K + P LY+VLL+ND+YTP EFV+ +L+  F+K
Sbjct: 34  PMRSINMSEDGDEKPGGNVATIVKEKPKAKRPSLYKVLLLNDDYTPQEFVVWLLEAVFHK 93

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H+ A  IML VH+ G+G CGVY YE+AE KV QV+  +R++++PLQC ME++
Sbjct: 94  GHDEALRIMLHVHNHGVGICGVYTYEVAETKVAQVLELARRNEHPLQCTMERE 146


>gi|114704886|ref|ZP_01437794.1| ATP-dependent Clp protease adaptor protein ClpS [Fulvimarina pelagi
           HTCC2506]
 gi|114539671|gb|EAU42791.1| ATP-dependent Clp protease adaptor protein ClpS [Fulvimarina pelagi
           HTCC2506]
          Length = 135

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 61/129 (47%), Positives = 79/129 (61%)

Query: 9   MYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDN 68
           +  +  +   LA  S          +              R   K++ P LYRVLL+ND+
Sbjct: 6   LMRKSHKLTALAPKSAPPFPLVMQGEDEEETRGPGTSVITRSKPKLQKPSLYRVLLLNDD 65

Query: 69  YTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQ 128
           YTPMEFVIHVL+ FF KD E A  IML VH  G+GECGV+ YE+AE KV QVM+++RQHQ
Sbjct: 66  YTPMEFVIHVLERFFQKDREAATQIMLHVHRHGVGECGVFTYEVAETKVTQVMDFARQHQ 125

Query: 129 YPLQCIMEQ 137
           +PLQC+ME+
Sbjct: 126 HPLQCVMEK 134


>gi|260574204|ref|ZP_05842209.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacter sp.
           SW2]
 gi|259023670|gb|EEW26961.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacter sp.
           SW2]
          Length = 117

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 74/117 (63%)

Query: 22  MSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN 81
           M+   +  S          +    +  +  ++   P LY+VLL+ND+YTPMEFV+H+L+ 
Sbjct: 1   MTLRPLQMSGRMSDKPGGTEGDASTLTKTHTRTERPPLYKVLLLNDDYTPMEFVVHILER 60

Query: 82  FFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           FF  +H  A  IML VH +G+   GV+++E+AE KV QVM+++R+HQ+PLQC ME+ 
Sbjct: 61  FFGLNHAQAFEIMLTVHKKGLAVVGVFSFEVAETKVAQVMDFARRHQHPLQCTMEKD 117


>gi|254514303|ref|ZP_05126364.1| Sua5/YciO/YrdC/YwlC [gamma proteobacterium NOR5-3]
 gi|219676546|gb|EED32911.1| Sua5/YciO/YrdC/YwlC [gamma proteobacterium NOR5-3]
          Length = 134

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 43/88 (48%), Positives = 60/88 (68%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
               +++ P LY+V+L+ND+YTPMEFV+ VL+ FF  + E A  +ML VH QG G CG+Y
Sbjct: 43  EAKPQLKRPPLYKVVLLNDDYTPMEFVVEVLEVFFKMNREQATQVMLTVHTQGKGVCGIY 102

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIME 136
             +IAE K  QV  ++R HQ+PL C +E
Sbjct: 103 TKDIAETKSAQVNQFARDHQHPLLCEIE 130


>gi|259417778|ref|ZP_05741697.1| ATP-dependent Clp protease adaptor protein ClpS [Silicibacter sp.
           TrichCH4B]
 gi|259346684|gb|EEW58498.1| ATP-dependent Clp protease adaptor protein ClpS [Silicibacter sp.
           TrichCH4B]
          Length = 107

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 47/104 (45%), Positives = 70/104 (67%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
               + ++ L    +   + + P  Y+VLL+ND+YTPMEFV+ VL+ FF  +H  A  IM
Sbjct: 3   SDNPDDESDLGVLTKTRPRTQRPPRYKVLLLNDDYTPMEFVVIVLERFFGLNHAQAFEIM 62

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L VH +G+   GV+++E+AE KV QVM+Y+R+HQ+PLQC ME+ 
Sbjct: 63  LTVHKKGLAVVGVFSHEVAETKVAQVMDYARRHQHPLQCTMEKD 106


>gi|310815392|ref|YP_003963356.1| ATP-dependent Clp protease adaptor protein clpS [Ketogulonicigenium
           vulgare Y25]
 gi|308754127|gb|ADO42056.1| ATP-dependent Clp protease adaptor protein clpS [Ketogulonicigenium
           vulgare Y25]
          Length = 117

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 49/109 (44%), Positives = 70/109 (64%)

Query: 30  SRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET 89
           S  +  G    +N     ++   K + P LY+V+L+ND+YTPMEFV+ VLQ FF  D   
Sbjct: 9   SSNDNDGTNTPENERGVALKTRPKTKRPPLYKVMLLNDDYTPMEFVVLVLQRFFSLDESR 68

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +  IML VH +G+    V+ YE+AE KV QVM ++R++Q+PLQC MEQ+
Sbjct: 69  SVEIMLAVHTKGVAVVAVFPYEVAETKVAQVMEFARRNQHPLQCTMEQE 117


>gi|254294360|ref|YP_003060383.1| ATP-dependent Clp protease adaptor protein ClpS [Hirschia baltica
           ATCC 49814]
 gi|254042891|gb|ACT59686.1| ATP-dependent Clp protease adaptor protein ClpS [Hirschia baltica
           ATCC 49814]
          Length = 109

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 71/104 (68%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
                 D+      R  +K + P LYRVL++ND++TPMEFV+ +L++FF K  E A  +M
Sbjct: 5   NTPTGPDDETGVATRTETKTKRPSLYRVLILNDDFTPMEFVVLILEHFFNKTREEATKVM 64

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L VH+ G+G CGV+ YE+AE KV QVM+ +R+ ++PLQC ME++
Sbjct: 65  LHVHNTGVGVCGVFTYEVAETKVAQVMDLARRSEHPLQCTMERE 108


>gi|222085850|ref|YP_002544381.1| ATP-dependent Clp protease adaptor protein [Agrobacterium
           radiobacter K84]
 gi|221723298|gb|ACM26454.1| ATP-dependent Clp protease adaptor protein [Agrobacterium
           radiobacter K84]
          Length = 117

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 57/110 (51%), Positives = 81/110 (73%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
             + +++     +       R  +K + P LYRVLL+ND+YTPMEFVIH+L+ FF KD E
Sbjct: 8   MQKDSERNGDNGNRGTSVITRTKAKTKKPNLYRVLLLNDDYTPMEFVIHILERFFQKDLE 67

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +A  IML VH+ G+GECG++ YE+AE KV+QVM+++RQHQ+PLQC+ME+K
Sbjct: 68  SATRIMLHVHNHGVGECGIFTYEVAETKVSQVMDFARQHQHPLQCVMEKK 117


>gi|121998183|ref|YP_001002970.1| ATP-dependent Clp protease adaptor protein ClpS [Halorhodospira
           halophila SL1]
 gi|158514017|sp|A1WWV6|CLPS_HALHL RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|121589588|gb|ABM62168.1| ATP-dependent Clp protease adaptor protein ClpS [Halorhodospira
           halophila SL1]
          Length = 106

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 46/103 (44%), Positives = 67/103 (65%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
               + D            ++ P +Y+V+L+ND+YTPM+FV+ VLQ FF KD   A  IM
Sbjct: 3   DEPNQDDPQGPEVEAAKPSLKQPPMYKVVLLNDDYTPMDFVVEVLQRFFNKDRSQATQIM 62

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L VH +G G CGVY+ ++AE KV+QV +Y+R+H++PL C ME+
Sbjct: 63  LHVHTRGKGVCGVYSRDVAETKVSQVNDYAREHEHPLLCTMEE 105


>gi|84500364|ref|ZP_00998613.1| ATP-dependent Clp protease, adaptor protein ClpS [Oceanicola
           batsensis HTCC2597]
 gi|84391317|gb|EAQ03649.1| ATP-dependent Clp protease, adaptor protein ClpS [Oceanicola
           batsensis HTCC2597]
          Length = 121

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 49/90 (54%), Positives = 67/90 (74%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
               K + P LY+VLL+ND+YTPMEFV+ VL+ FF  +H  A  IML VH +G+   GV+
Sbjct: 32  ETRPKTKRPPLYKVLLLNDDYTPMEFVVAVLERFFGMNHAQAFEIMLTVHKKGVAVVGVF 91

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           ++EIAE KV QVM+++RQHQ+PLQC ME++
Sbjct: 92  SHEIAETKVAQVMDFARQHQHPLQCTMEKE 121


>gi|260566297|ref|ZP_05836767.1| ATP-dependent Clp protease adapter protein clpS [Brucella suis bv.
           4 str. 40]
 gi|261214163|ref|ZP_05928444.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           bv. 3 str. Tulya]
 gi|261222336|ref|ZP_05936617.1| ATP-dependent Clp protease adapter protein clpS [Brucella ceti
           B1/94]
 gi|261314110|ref|ZP_05953307.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           pinnipedialis M163/99/10]
 gi|261317803|ref|ZP_05957000.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           pinnipedialis B2/94]
 gi|261755135|ref|ZP_05998844.1| ATP-dependent Clp protease adapter protein clpS [Brucella suis bv.
           3 str. 686]
 gi|261758359|ref|ZP_06002068.1| ATP-dependent Clp protease adapter protein clpS [Brucella sp.
           F5/99]
 gi|265988834|ref|ZP_06101391.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           pinnipedialis M292/94/1]
 gi|265991249|ref|ZP_06103806.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265995085|ref|ZP_06107642.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           melitensis bv. 3 str. Ether]
 gi|265999441|ref|ZP_05466371.2| ATP-dependent Clp protease adapter protein clpS [Brucella
           melitensis bv. 2 str. 63/9]
 gi|294852509|ref|ZP_06793182.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella sp. NVSL
           07-0026]
 gi|260155815|gb|EEW90895.1| ATP-dependent Clp protease adapter protein clpS [Brucella suis bv.
           4 str. 40]
 gi|260915770|gb|EEX82631.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           bv. 3 str. Tulya]
 gi|260920920|gb|EEX87573.1| ATP-dependent Clp protease adapter protein clpS [Brucella ceti
           B1/94]
 gi|261297026|gb|EEY00523.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           pinnipedialis B2/94]
 gi|261303136|gb|EEY06633.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           pinnipedialis M163/99/10]
 gi|261738343|gb|EEY26339.1| ATP-dependent Clp protease adapter protein clpS [Brucella sp.
           F5/99]
 gi|261744888|gb|EEY32814.1| ATP-dependent Clp protease adapter protein clpS [Brucella suis bv.
           3 str. 686]
 gi|262766198|gb|EEZ11987.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           melitensis bv. 3 str. Ether]
 gi|263002033|gb|EEZ14608.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263093970|gb|EEZ17904.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           melitensis bv. 2 str. 63/9]
 gi|264661031|gb|EEZ31292.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           pinnipedialis M292/94/1]
 gi|294821098|gb|EFG38097.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella sp. NVSL
           07-0026]
          Length = 109

 Score =  146 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 58/106 (54%), Positives = 77/106 (72%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
              G    ++      R   K R P LYRVLL+ND+YTPMEFV+HVLQ FF K+ + A  
Sbjct: 4   KTNGGNGPESGTVVVTRTQPKTRKPSLYRVLLLNDDYTPMEFVVHVLQRFFQKNLDDATR 63

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           IML VH+ G+GECGV+ YE+AE KV+QVM+++RQ+Q+PLQC+ME+K
Sbjct: 64  IMLHVHNHGVGECGVFTYEVAETKVSQVMDFARQNQHPLQCVMEKK 109


>gi|225852667|ref|YP_002732900.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella
           melitensis ATCC 23457]
 gi|256044825|ref|ZP_05447729.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256113730|ref|ZP_05454534.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella
           melitensis bv. 3 str. Ether]
 gi|260565575|ref|ZP_05836059.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           melitensis bv. 1 str. 16M]
 gi|21542304|sp|Q8YHI3|CLPS_BRUME RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|254763811|sp|C0RJD8|CLPS_BRUMB RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|225641032|gb|ACO00946.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           melitensis ATCC 23457]
 gi|260151643|gb|EEW86737.1| ATP-dependent Clp protease adapter protein clpS [Brucella
           melitensis bv. 1 str. 16M]
 gi|326409188|gb|ADZ66253.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella
           melitensis M28]
          Length = 116

 Score =  146 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 58/106 (54%), Positives = 77/106 (72%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
              G    ++      R   K R P LYRVLL+ND+YTPMEFV+HVLQ FF K+ + A  
Sbjct: 11  KTNGGNGPESGTVVVTRTQPKTRKPSLYRVLLLNDDYTPMEFVVHVLQRFFQKNLDDATR 70

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           IML VH+ G+GECGV+ YE+AE KV+QVM+++RQ+Q+PLQC+ME+K
Sbjct: 71  IMLHVHNHGVGECGVFTYEVAETKVSQVMDFARQNQHPLQCVMEKK 116


>gi|56698476|ref|YP_168851.1| ATP-dependent Clp protease, adaptor protein ClpS [Ruegeria pomeroyi
           DSS-3]
 gi|67460174|sp|Q5LMA7|CLPS_SILPO RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|56680213|gb|AAV96879.1| ATP-dependent Clp protease, adaptor protein ClpS [Ruegeria pomeroyi
           DSS-3]
          Length = 113

 Score =  146 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 50/112 (44%), Positives = 74/112 (66%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M           + DN     ++   + + P LY+VLL+ND+YTPMEFV+HVL+ FF  +
Sbjct: 1   MTAQLHMMSDKHDQDNDASVLLQTRPRTKRPPLYKVLLLNDDYTPMEFVVHVLERFFGMN 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  IML VH +G+   GV+++EIAE KV+ VM+++R+HQ+PLQC ME++
Sbjct: 61  HAQAFEIMLTVHKKGVAVVGVFSHEIAETKVSLVMDFARRHQHPLQCTMEKE 112


>gi|220935008|ref|YP_002513907.1| ATP-dependent Clp protease adaptor protein ClpS [Thioalkalivibrio
           sp. HL-EbGR7]
 gi|219996318|gb|ACL72920.1| ATP-dependent Clp protease adaptor protein ClpS [Thioalkalivibrio
           sp. HL-EbGR7]
          Length = 106

 Score =  146 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 53/106 (50%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M ++     D  L  E     K++ P  Y+V+L+ND+YTPMEFV+ VL++FF  D E A 
Sbjct: 1   MGEERKDTPDRGLAVE-EARPKLKPPPQYQVVLLNDDYTPMEFVVEVLESFFGMDREKAT 59

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IML VH +G G CG+Y  +IAE KV QV +Y+RQHQ+PL C MEQ
Sbjct: 60  RIMLHVHTRGKGVCGIYPRDIAETKVAQVNDYARQHQHPLLCAMEQ 105


>gi|161619121|ref|YP_001593008.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella canis
           ATCC 23365]
 gi|163843434|ref|YP_001627838.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella suis ATCC
           23445]
 gi|189024321|ref|YP_001935089.1| Protein of unknown function DUF174 [Brucella abortus S19]
 gi|254689393|ref|ZP_05152647.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella abortus
           bv. 6 str. 870]
 gi|254693877|ref|ZP_05155705.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella abortus
           bv. 3 str. Tulya]
 gi|254697528|ref|ZP_05159356.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254704457|ref|ZP_05166285.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella suis bv.
           3 str. 686]
 gi|254706649|ref|ZP_05168477.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella
           pinnipedialis M163/99/10]
 gi|254710244|ref|ZP_05172055.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella
           pinnipedialis B2/94]
 gi|254714240|ref|ZP_05176051.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella ceti
           M644/93/1]
 gi|254717676|ref|ZP_05179487.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella ceti
           M13/05/1]
 gi|254719232|ref|ZP_05181043.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella sp.
           83/13]
 gi|254730423|ref|ZP_05189001.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella abortus
           bv. 4 str. 292]
 gi|256031738|ref|ZP_05445352.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella
           pinnipedialis M292/94/1]
 gi|256061251|ref|ZP_05451402.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella neotomae
           5K33]
 gi|256159904|ref|ZP_05457626.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella ceti
           M490/95/1]
 gi|256255138|ref|ZP_05460674.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella ceti
           B1/94]
 gi|256257639|ref|ZP_05463175.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella abortus
           bv. 9 str. C68]
 gi|260168871|ref|ZP_05755682.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella sp.
           F5/99]
 gi|260546633|ref|ZP_05822372.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           NCTC 8038]
 gi|260754911|ref|ZP_05867259.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           bv. 6 str. 870]
 gi|260758128|ref|ZP_05870476.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           bv. 4 str. 292]
 gi|260761954|ref|ZP_05874297.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260883923|ref|ZP_05895537.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           bv. 9 str. C68]
 gi|261219517|ref|ZP_05933798.1| ATP-dependent Clp protease adapter protein clpS [Brucella ceti
           M13/05/1]
 gi|261322012|ref|ZP_05961209.1| ATP-dependent Clp protease adapter protein clpS [Brucella ceti
           M644/93/1]
 gi|261325259|ref|ZP_05964456.1| ATP-dependent Clp protease adapter protein clpS [Brucella neotomae
           5K33]
 gi|265984227|ref|ZP_06096962.1| ATP-dependent Clp protease adapter protein clpS [Brucella sp.
           83/13]
 gi|265998300|ref|ZP_06110857.1| ATP-dependent Clp protease adapter protein clpS [Brucella ceti
           M490/95/1]
 gi|306837981|ref|ZP_07470839.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella sp. NF
           2653]
 gi|306841893|ref|ZP_07474573.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella sp. BO2]
 gi|306844034|ref|ZP_07476629.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella sp. BO1]
 gi|37077259|sp|Q8G0C9|CLPS_BRUSU RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|189082472|sp|A9M5I2|CLPS_BRUC2 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|189082473|sp|B0CGW7|CLPS_BRUSI RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238689379|sp|B2S618|CLPS_BRUA1 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|161335932|gb|ABX62237.1| ATP-dependent Clp protease adaptor protein clpS [Brucella canis
           ATCC 23365]
 gi|163674157|gb|ABY38268.1| ATP-dependent Clp protease adaptor protein clpS [Brucella suis ATCC
           23445]
 gi|189019893|gb|ACD72615.1| Protein of unknown function DUF174 [Brucella abortus S19]
 gi|260095683|gb|EEW79560.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           NCTC 8038]
 gi|260668446|gb|EEX55386.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           bv. 4 str. 292]
 gi|260672386|gb|EEX59207.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260675019|gb|EEX61840.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           bv. 6 str. 870]
 gi|260873451|gb|EEX80520.1| ATP-dependent Clp protease adapter protein clpS [Brucella abortus
           bv. 9 str. C68]
 gi|260924606|gb|EEX91174.1| ATP-dependent Clp protease adapter protein clpS [Brucella ceti
           M13/05/1]
 gi|261294702|gb|EEX98198.1| ATP-dependent Clp protease adapter protein clpS [Brucella ceti
           M644/93/1]
 gi|261301239|gb|EEY04736.1| ATP-dependent Clp protease adapter protein clpS [Brucella neotomae
           5K33]
 gi|262552768|gb|EEZ08758.1| ATP-dependent Clp protease adapter protein clpS [Brucella ceti
           M490/95/1]
 gi|264662819|gb|EEZ33080.1| ATP-dependent Clp protease adapter protein clpS [Brucella sp.
           83/13]
 gi|306275789|gb|EFM57513.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella sp. BO1]
 gi|306288023|gb|EFM59425.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella sp. BO2]
 gi|306406905|gb|EFM63126.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella sp. NF
           2653]
          Length = 116

 Score =  146 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 58/106 (54%), Positives = 77/106 (72%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
              G    ++      R   K R P LYRVLL+ND+YTPMEFV+HVLQ FF K+ + A  
Sbjct: 11  KTNGGNGPESGTVVVTRTQPKTRKPSLYRVLLLNDDYTPMEFVVHVLQRFFQKNLDDATR 70

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           IML VH+ G+GECGV+ YE+AE KV+QVM+++RQ+Q+PLQC+ME+K
Sbjct: 71  IMLHVHNHGVGECGVFTYEVAETKVSQVMDFARQNQHPLQCVMEKK 116


>gi|114569835|ref|YP_756515.1| ATP-dependent Clp protease adaptor protein ClpS [Maricaulis maris
           MCS10]
 gi|122316182|sp|Q0AQ60|CLPS_MARMM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|114340297|gb|ABI65577.1| ATP-dependent Clp protease adaptor protein ClpS [Maricaulis maris
           MCS10]
          Length = 109

 Score =  146 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 51/107 (47%), Positives = 65/107 (60%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
             K      +       +     + P LYRVLL+ND+YTPMEFV+ VL   F K  E A 
Sbjct: 3   ERKHDDTGVEEGTGLATKTRPATKKPSLYRVLLLNDDYTPMEFVVEVLARIFRKSPEDAA 62

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML VH  G+G CGVY YE+AE KV QVM+ +R+ Q+PLQC ME++
Sbjct: 63  RIMLHVHQNGVGMCGVYTYEVAETKVAQVMDAARRAQHPLQCTMEKE 109


>gi|110633725|ref|YP_673933.1| ATP-dependent Clp protease adaptor protein ClpS [Mesorhizobium sp.
           BNC1]
 gi|110284709|gb|ABG62768.1| ATP-dependent Clp protease adaptor protein ClpS [Chelativorans sp.
           BNC1]
          Length = 133

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 81/135 (60%), Gaps = 9/135 (6%)

Query: 4   FDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVL 63
             +  +  R      L       M+                    R  +K + P LYRVL
Sbjct: 8   HGNIGIGERKMPGDALR------MSRGDDEGNSTG---RGTAVITRTRTKTKKPSLYRVL 58

Query: 64  LVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123
           L+ND+YTPMEFV+HVL+ FF KD E A  IML VH+ G+GECG+Y +E+AE KV+QVM++
Sbjct: 59  LLNDDYTPMEFVVHVLERFFQKDREAATMIMLHVHNHGVGECGIYTFEVAETKVSQVMDF 118

Query: 124 SRQHQYPLQCIMEQK 138
           +RQHQ+PLQC+ME+K
Sbjct: 119 ARQHQHPLQCVMEKK 133


>gi|254283858|ref|ZP_04958826.1| ATP-dependent Clp protease adaptor protein ClpS [gamma
           proteobacterium NOR51-B]
 gi|219680061|gb|EED36410.1| ATP-dependent Clp protease adaptor protein ClpS [gamma
           proteobacterium NOR51-B]
          Length = 132

 Score =  146 bits (369), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 69/122 (56%), Gaps = 1/122 (0%)

Query: 16  DGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFV 75
           +   A +S      +  + +     D  +        K++ P LYRV+L+ND+YTPMEFV
Sbjct: 6   NAATARLSDPRPRATGDDAERGPGRDEGVAIAP-AKPKLKRPPLYRVILLNDDYTPMEFV 64

Query: 76  IHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
           + VL+ FF  + + A  +ML VH QG G CG+Y  +IAE K  QV   +++HQ+PL C +
Sbjct: 65  VEVLERFFSMNRDKATQVMLAVHTQGKGVCGIYPRDIAETKAAQVNQCAKEHQHPLLCEV 124

Query: 136 EQ 137
           E 
Sbjct: 125 EP 126


>gi|75675888|ref|YP_318309.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrobacter
           winogradskyi Nb-255]
 gi|74420758|gb|ABA04957.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrobacter
           winogradskyi Nb-255]
          Length = 136

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 60/129 (46%), Positives = 83/129 (64%), Gaps = 2/129 (1%)

Query: 12  RVKRDGILALMSFIFMADSRMNKKGIAEF--DNCLDSEVRFSSKVRVPKLYRVLLVNDNY 69
           +     +L + +         ++   A    D       +  +K + P LYRVL++ND+Y
Sbjct: 8   QTPETSVLPVSNNRSAPRMSEDEDDHAGGRGDPAASVITKVRTKTKRPNLYRVLILNDDY 67

Query: 70  TPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQY 129
           TPMEFV+HVL+ FF KD E A  IML VHH GIGECGV+ YE+AE KV QVM+++R+HQ+
Sbjct: 68  TPMEFVVHVLEKFFQKDLEAATQIMLHVHHHGIGECGVFTYEVAETKVTQVMDFARKHQH 127

Query: 130 PLQCIMEQK 138
           PLQC+ME+K
Sbjct: 128 PLQCVMEKK 136


>gi|329889200|ref|ZP_08267543.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328844501|gb|EGF94065.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 109

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 68/108 (62%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
              + G                K++ P LYRVL++ND+YTPMEFVI+VL+ FF K  E A
Sbjct: 2   PNRRPGEQGGGAGAAVVTETKPKLQRPSLYRVLILNDDYTPMEFVIYVLERFFQKSREDA 61

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             IML VH  G+G CGV+ YE+AE KV QV+  +R+HQ+PLQC ME+ 
Sbjct: 62  TRIMLHVHQHGVGVCGVFTYEVAETKVAQVVETARRHQHPLQCTMEKD 109


>gi|292492310|ref|YP_003527749.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosococcus
           halophilus Nc4]
 gi|291580905|gb|ADE15362.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosococcus
           halophilus Nc4]
          Length = 107

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 69/106 (65%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M K    E +    +      K++ P +Y+V+++ND+YTPMEFV+ VLQ FF  D E A 
Sbjct: 1   MGKIDPDEENEGGFAVDTAKPKLKRPPMYKVVMLNDDYTPMEFVVEVLQTFFAMDREKAT 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IM +VH +G G CGV+ YEIAE KV QV  YS  HQ+PL+C++E+
Sbjct: 61  RIMWQVHTEGKGICGVFTYEIAETKVAQVNEYSLNHQHPLKCVLEK 106


>gi|114799620|ref|YP_759751.1| ATP-dependent Clp protease, adaptor protein ClpS [Hyphomonas
           neptunium ATCC 15444]
 gi|123028220|sp|Q0C3E2|CLPS_HYPNA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|114739794|gb|ABI77919.1| ATP-dependent Clp protease, adaptor protein ClpS [Hyphomonas
           neptunium ATCC 15444]
          Length = 118

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 69/94 (73%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           D       K + P LYRVLL+ND+YTPMEFV+ +L+ FF +  E A  IML VH +G+G 
Sbjct: 24  DLATETRIKTKKPSLYRVLLLNDDYTPMEFVVFILERFFNRSREQATRIMLHVHQKGVGL 83

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CGVY YE+AE KV QV++ +R+H++PLQC+ME++
Sbjct: 84  CGVYTYEVAETKVAQVLDLARRHEHPLQCVMEKE 117


>gi|209549170|ref|YP_002281087.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534926|gb|ACI54861.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 116

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 81/118 (68%), Gaps = 3/118 (2%)

Query: 21  LMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ 80
           +   I M +         E  N      R   K + P LYRVLL+ND+YTPMEFVIH+L+
Sbjct: 2   IAKPIRMQNDSDRN---GENGNRTSVITRTKPKTKKPNLYRVLLLNDDYTPMEFVIHILE 58

Query: 81  NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            FF KD E+A  IML VH+ G+GECG++ YE+AE KV+QVM+++RQHQ+PLQC+ME+K
Sbjct: 59  RFFQKDRESATRIMLHVHNHGVGECGIFTYEVAETKVSQVMDFARQHQHPLQCVMEKK 116


>gi|119503235|ref|ZP_01625319.1| substrate modulator for ClpAP, directs protease activity towards
           aggregated proteins [marine gamma proteobacterium
           HTCC2080]
 gi|119460881|gb|EAW41972.1| substrate modulator for ClpAP, directs protease activity towards
           aggregated proteins [marine gamma proteobacterium
           HTCC2080]
          Length = 116

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/112 (41%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVR-FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYK 85
           M   +M     A+ D+  D  V     K++ P L++V+L+ND+YTPMEFV+ +L+++F  
Sbjct: 1   MYSWQMGPPDKADRDDEGDLAVAPAKPKLKRPPLFQVVLLNDDYTPMEFVVEILESYFRL 60

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             E A  IML VH +G G CGVY  +IAE K  QV  Y+R   +PL C +E 
Sbjct: 61  GREQATQIMLMVHTKGKGVCGVYPRDIAESKATQVNTYARDSGHPLLCEVEP 112


>gi|327480905|gb|AEA84215.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           stutzeri DSM 4166]
          Length = 122

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 65/121 (53%), Gaps = 1/121 (0%)

Query: 18  ILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIH 77
            +   + I +  ++         D    +      +++ P +Y+V++ ND+YTPM+FV+ 
Sbjct: 2   RMHAFAQIRLTFNQDRPL-EDGDDASGLAVEEAKPQLKAPPMYKVVMFNDDYTPMDFVVE 60

Query: 78  VLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VL+  F    E A  IML VH +G   CGVY  ++AE K  QV  Y+R+ Q+PL C +E+
Sbjct: 61  VLEGIFNHSREQATKIMLAVHTEGQAVCGVYTRDVAETKAMQVNQYARECQHPLLCEIEK 120

Query: 138 K 138
            
Sbjct: 121 D 121


>gi|254786019|ref|YP_003073448.1| ATP-dependent Clp protease adaptor protein ClpS [Teredinibacter
           turnerae T7901]
 gi|237686070|gb|ACR13334.1| Sua5/YciO/YrdC/YwlC [Teredinibacter turnerae T7901]
          Length = 124

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 66/102 (64%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
             +    +   +      +++ P +Y+V+L+ND+YTPMEFV+HVL++FF  D E A  +M
Sbjct: 15  DDVDSGADSGLALQEAKPRLKKPPMYKVVLLNDDYTPMEFVVHVLESFFNMDREKATHVM 74

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           L VH +G   CGVY+ ++AE K  QV  ++RQ+++PL C +E
Sbjct: 75  LTVHTKGKAVCGVYSRDVAETKAMQVNQFARQNEHPLLCEIE 116


>gi|86749515|ref|YP_486011.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris HaA2]
 gi|86572543|gb|ABD07100.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris HaA2]
          Length = 132

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 61/132 (46%), Positives = 80/132 (60%), Gaps = 2/132 (1%)

Query: 9   MYHRVKRDGILALMSFIFMADSRMNKKG--IAEFDNCLDSEVRFSSKVRVPKLYRVLLVN 66
           M  R      +     +    +RM   G              +   K + P LYRVL++N
Sbjct: 1   MLQRFSSFDSVPASVGLSYRATRMAGDGGRAGSGSPTTSVITKVKPKTKRPNLYRVLILN 60

Query: 67  DNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQ 126
           D+YTPMEFV+HVL+ FF  D E A  +ML VHH GIGECGV+ YEIAE KV QVM+++R+
Sbjct: 61  DDYTPMEFVVHVLEKFFQMDIEAATKVMLHVHHHGIGECGVFTYEIAETKVTQVMDFARK 120

Query: 127 HQYPLQCIMEQK 138
           HQ+PLQC+ME+K
Sbjct: 121 HQHPLQCVMEKK 132


>gi|262376116|ref|ZP_06069346.1| substrate modulator for ClpAP [Acinetobacter lwoffii SH145]
 gi|262308717|gb|EEY89850.1| substrate modulator for ClpAP [Acinetobacter lwoffii SH145]
          Length = 137

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
                       D   D  V+ +  +++ P LY V+L+ND+YTPMEFVI +LQ +F  + 
Sbjct: 26  HISPRLANEPSEDGDSDLAVQTAPPELKRPPLYAVVLLNDDYTPMEFVIEILQQYFAMNL 85

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + A  +ML VH++G G  GVY  +IAE K NQV NY+R   +PL C +E K
Sbjct: 86  DQATQVMLTVHYEGKGVAGVYPRDIAETKANQVNNYARSQGHPLLCQIEPK 136


>gi|146341455|ref|YP_001206503.1| ATP-dependent Clp protease adaptor protein ClpS, modulator of ClpA
           substrate specificity [Bradyrhizobium sp. ORS278]
 gi|146194261|emb|CAL78283.1| ATP-dependent Clp protease adaptor protein ClpS, modulator of ClpA
           substrate specificity [Bradyrhizobium sp. ORS278]
          Length = 110

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/110 (54%), Positives = 76/110 (69%), Gaps = 1/110 (0%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
            +  NK G            +   K + P LYRVL++ND+YTPMEFV+ VL+ FF KD E
Sbjct: 2   SNNDNKSGGPGG-PATSVITKVKPKTKRPNLYRVLILNDDYTPMEFVVLVLEKFFNKDVE 60

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            A  IML VHH GIGECGV+ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 61  AATKIMLHVHHHGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 110


>gi|85374864|ref|YP_458926.1| hypothetical protein ELI_10185 [Erythrobacter litoralis HTCC2594]
 gi|84787947|gb|ABC64129.1| hypothetical protein ELI_10185 [Erythrobacter litoralis HTCC2594]
          Length = 127

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 70/95 (73%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
            +    +  +K + P  Y+VL++ND+YTPMEFV+ VL+ FF  D E A  +ML VH +G+
Sbjct: 32  DVGVATKTRAKPKKPSQYKVLMLNDDYTPMEFVVMVLKRFFKMDLEQATRVMLHVHQKGV 91

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CG++ YE+AE KVNQVM+++RQ+Q+PLQC +E+
Sbjct: 92  GVCGIFPYEVAETKVNQVMDFARQNQHPLQCTLEK 126


>gi|241204496|ref|YP_002975592.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858386|gb|ACS56053.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 118

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 81/118 (68%), Gaps = 3/118 (2%)

Query: 21  LMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ 80
           +   I M +        A   N      R   K + P LYRVLL+ND+YTPMEFVIH+L+
Sbjct: 4   IAKPIRMQNDSERNGDNA---NRTSVITRTKPKTKKPNLYRVLLLNDDYTPMEFVIHILE 60

Query: 81  NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            FF KD E+A  IML VH+ G+GECG++ YE+AE KV+QVM+++RQHQ+PLQC+ME+K
Sbjct: 61  RFFQKDRESATRIMLHVHNHGVGECGIFTYEVAETKVSQVMDFARQHQHPLQCVMEKK 118


>gi|218533142|ref|YP_002423958.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           chloromethanicum CM4]
 gi|218525445|gb|ACK86030.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           chloromethanicum CM4]
          Length = 131

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 77/114 (67%), Gaps = 2/114 (1%)

Query: 25  IFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFY 84
           +  A +  +               R   + + P LYRVLL+ND+YTPMEFV+HV++ FF 
Sbjct: 20  VRAASTPRSPGDDDRS--GTAIITRTKPRAKRPSLYRVLLLNDDYTPMEFVVHVVERFFN 77

Query: 85  KDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           K H+ A  IM+ VHH G+GECGV+ YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 78  KSHDDAYQIMMHVHHNGVGECGVFTYEVAETKVTQVMDFARKHQHPLQCVMEKK 131


>gi|104781332|ref|YP_607830.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           entomophila L48]
 gi|95110319|emb|CAK15026.1| ATP-dependent Clp protease adaptor protein clpS [Pseudomonas
           entomophila L48]
          Length = 124

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 68/121 (56%)

Query: 18  ILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIH 77
           + + +   F  D   + +   E D    +       ++ P +Y+V+L ND+YTPM+FV+ 
Sbjct: 3   VPSEIRLTFNQDRPQSNEDGHEDDGSGLAVQEAKPILQAPPMYKVVLFNDDYTPMDFVVE 62

Query: 78  VLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VL+ FF  + E A  IML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+
Sbjct: 63  VLETFFNLNRELATKIMLTVHTEGRAVCGLFTRDIAETKAMQVNQYARESQHPLLCEIEK 122

Query: 138 K 138
            
Sbjct: 123 D 123


>gi|294676717|ref|YP_003577332.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacter
           capsulatus SB 1003]
 gi|294475537|gb|ADE84925.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacter
           capsulatus SB 1003]
          Length = 117

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 47/93 (50%), Positives = 70/93 (75%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
             V+ + +   P +Y+V+L+ND+YTPMEFV+H+L+ FF   H  A  IML VH +G+   
Sbjct: 25  LAVKTAPRTARPPMYKVMLLNDDYTPMEFVVHILERFFGMTHAQAFEIMLTVHKKGLAVV 84

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           GVY++E+AE KV+QVM++SR+HQ+PLQC ME++
Sbjct: 85  GVYSFEVAETKVSQVMDFSRRHQHPLQCTMEKE 117


>gi|39936211|ref|NP_948487.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris CGA009]
 gi|39650066|emb|CAE28589.1| DUF174 [Rhodopseudomonas palustris CGA009]
          Length = 132

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 3/131 (2%)

Query: 8   SMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVND 67
           S+ H         +   + MA                    +   + + P LYRVL++ND
Sbjct: 5   SLSHSAAGQAGDRINRPLAMAGD---GGRSGPSTPSTSVITKTKPRTKRPNLYRVLILND 61

Query: 68  NYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQH 127
           +YTPMEFV+HVL+ FF  D E A  +ML VHH GIGECGV+ YEIAE KV QVM+++R+H
Sbjct: 62  DYTPMEFVVHVLEKFFQMDVEAATKVMLHVHHHGIGECGVFTYEIAETKVTQVMDFARKH 121

Query: 128 QYPLQCIMEQK 138
           Q+PLQC+ME+K
Sbjct: 122 QHPLQCVMEKK 132


>gi|163737216|ref|ZP_02144634.1| ATP-dependent Clp protease adaptor protein ClpS [Phaeobacter
           gallaeciensis BS107]
 gi|163740373|ref|ZP_02147767.1| ATP-dependent Clp protease, adaptor protein ClpS [Phaeobacter
           gallaeciensis 2.10]
 gi|161386231|gb|EDQ10606.1| ATP-dependent Clp protease, adaptor protein ClpS [Phaeobacter
           gallaeciensis 2.10]
 gi|161389820|gb|EDQ14171.1| ATP-dependent Clp protease adaptor protein ClpS [Phaeobacter
           gallaeciensis BS107]
          Length = 113

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 72/112 (64%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M  + +     ++ D  L    +   K + P  Y+VLL+ND+YTPMEFV+ VL+ FF   
Sbjct: 1   MLPTPVMMSDHSDDDTDLGVLTKTRPKTQRPPRYKVLLLNDDYTPMEFVVMVLERFFNMT 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  A  +ML VH +G+   GV+++EIAE KV QVM+++ +HQ+PLQC ME++
Sbjct: 61  HAEAFEVMLTVHKKGVAVVGVFSHEIAETKVGQVMDFAHRHQHPLQCTMEKE 112


>gi|316933620|ref|YP_004108602.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris DX-1]
 gi|315601334|gb|ADU43869.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris DX-1]
          Length = 132

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 55/98 (56%), Positives = 72/98 (73%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
                   +   + + P LYRVL++ND+YTPMEFV+HVL+ FF  D E A  +ML VHH 
Sbjct: 35  TPSTSVITKTKPRTKRPSLYRVLILNDDYTPMEFVVHVLEKFFQMDVEAATQVMLHVHHH 94

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           GIGECGV+ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 95  GIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 132


>gi|158423218|ref|YP_001524510.1| ATP-dependent Clp protease adaptor protein [Azorhizobium
           caulinodans ORS 571]
 gi|158330107|dbj|BAF87592.1| ATP-dependent Clp protease adaptor protein [Azorhizobium
           caulinodans ORS 571]
          Length = 131

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 76/117 (64%), Gaps = 1/117 (0%)

Query: 22  MSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN 81
                 A     ++             R   +V+ P LYRVLL+ND+YTPM+FV+HVL+ 
Sbjct: 16  APQPRAAGDDDKQRRGPGG-PGTAVITRTKPQVKRPNLYRVLLLNDDYTPMDFVVHVLER 74

Query: 82  FFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           FF K  E A  IML VHH G+GECGVY YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 75  FFSKSREEANTIMLHVHHHGVGECGVYTYEVAETKVTQVMDFARKHQHPLQCVMEKK 131


>gi|148256120|ref|YP_001240705.1| ATP-dependent Clp protease adaptor protein ClpS, modulator of ClpA
           substrate specificity [Bradyrhizobium sp. BTAi1]
 gi|146408293|gb|ABQ36799.1| ATP-dependent Clp protease adaptor protein ClpS, modulator of ClpA
           substrate specificity [Bradyrhizobium sp. BTAi1]
          Length = 110

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 60/110 (54%), Positives = 76/110 (69%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
            S  + K             +   K + P LYRVL++ND+YTPMEFV+HVL+ FF KD E
Sbjct: 1   MSNNDNKSGGTGGPVTSVITKVKPKTKRPNLYRVLILNDDYTPMEFVVHVLEKFFNKDVE 60

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            A  IML VHH GIGECGV+ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 61  AATKIMLHVHHHGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 110


>gi|188991659|ref|YP_001903669.1| hypothetical protein xccb100_2265 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167733419|emb|CAP51620.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 169

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 49/129 (37%), Positives = 70/129 (54%)

Query: 9   MYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDN 68
              ++   G  +  +      +    +  +   +          +V  P  Y+VLL+ND+
Sbjct: 40  NRRKLCGRGAKSSNAEGAGPYNGRMPRKTSHEHDHGLVVETSKPEVAPPPRYQVLLLNDD 99

Query: 69  YTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQ 128
           YTPM+FV+ VLQ FF  D E A  +ML VH +G G CGVY+ E+AE KV QV  +SR +Q
Sbjct: 100 YTPMDFVVTVLQQFFNLDLERATQVMLHVHTRGRGVCGVYSREVAESKVAQVNEFSRMNQ 159

Query: 129 YPLQCIMEQ 137
           +PL C MEQ
Sbjct: 160 HPLLCTMEQ 168


>gi|27380265|ref|NP_771794.1| ATP-dependent Clp protease adaptor protein ClpS [Bradyrhizobium
           japonicum USDA 110]
 gi|27353429|dbj|BAC50419.1| yljA [Bradyrhizobium japonicum USDA 110]
          Length = 130

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 77/114 (67%), Gaps = 2/114 (1%)

Query: 25  IFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFY 84
             M++           +       +   K + P LYRVL++ND+YTPMEFV+HVL+ FF 
Sbjct: 19  PRMSNDENRSGSPTGPNT--SVITKVKPKTKRPNLYRVLILNDDYTPMEFVVHVLEKFFQ 76

Query: 85  KDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           KD E A  IML VHH GIGECGV+ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 77  KDVEAATKIMLHVHHHGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 130


>gi|83945502|ref|ZP_00957849.1| ATP-dependent Clp protease adaptor protein ClpS [Oceanicaulis
           alexandrii HTCC2633]
 gi|83851078|gb|EAP88936.1| ATP-dependent Clp protease adaptor protein ClpS [Oceanicaulis
           alexandrii HTCC2633]
          Length = 108

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 70/110 (63%), Gaps = 2/110 (1%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
            S   K  +   D      V+  ++ + P +Y+VLL+ND+YTPMEFVI VL   F+K  E
Sbjct: 1   MSEPKKPDLP--DQETGVTVKPRARTKRPSMYKVLLLNDDYTPMEFVIEVLVRIFHKGQE 58

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            A  IML VH  G+G CGV+ YE+AE KV QVM+ +R+ Q+PLQC ME+ 
Sbjct: 59  DATRIMLHVHQHGVGVCGVFTYEVAETKVAQVMDAARRAQHPLQCTMEKD 108


>gi|170747222|ref|YP_001753482.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653744|gb|ACB22799.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           radiotolerans JCM 2831]
          Length = 128

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 61/128 (47%), Positives = 80/128 (62%), Gaps = 10/128 (7%)

Query: 11  HRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYT 70
           HR  R  + A  S     D R N               R   + + P LYRVLL+ND+YT
Sbjct: 11  HRPARIAVTASGSRAPGGDDRSN----------TAIITRTKPRTKRPSLYRVLLLNDDYT 60

Query: 71  PMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYP 130
           PMEFV+ V++ FF K HE A  IM+ VH  G+GECGV+ YE+AE KV QVM+++R+HQ+P
Sbjct: 61  PMEFVVLVVERFFNKSHEDAYHIMMHVHQNGVGECGVFTYEVAETKVTQVMDFARKHQHP 120

Query: 131 LQCIMEQK 138
           LQC+ME+K
Sbjct: 121 LQCVMEKK 128


>gi|84516587|ref|ZP_01003946.1| ATP-dependent Clp protease, adaptor protein ClpS [Loktanella
           vestfoldensis SKA53]
 gi|84509623|gb|EAQ06081.1| ATP-dependent Clp protease, adaptor protein ClpS [Loktanella
           vestfoldensis SKA53]
          Length = 118

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 70/107 (65%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M           L   +    K + P +Y+VL++ND++TPMEFV+HVL+ FF   H  A 
Sbjct: 12  MMADKEDRDGGNLGVALETKPKTKRPPMYKVLILNDDFTPMEFVVHVLERFFGLSHAQAF 71

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +ML VH +G+   GV+++EIAE KV QVM+++++HQ+PLQC ME++
Sbjct: 72  ELMLTVHKKGVAVVGVFSHEIAETKVAQVMDFAQRHQHPLQCTMEKE 118


>gi|261752476|ref|ZP_05996185.1| ATP-dependent Clp protease adapter protein clpS [Brucella suis bv.
           5 str. 513]
 gi|261742229|gb|EEY30155.1| ATP-dependent Clp protease adapter protein clpS [Brucella suis bv.
           5 str. 513]
          Length = 109

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 57/106 (53%), Positives = 77/106 (72%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
              G    ++      R   K R P LYRVLL+ND+YTPMEFV+HVLQ FF K+ + A  
Sbjct: 4   KTNGGNGPESGTVVVTRTQPKTRKPSLYRVLLLNDDYTPMEFVVHVLQRFFQKNLDDATR 63

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           IML VH+ G+GECG++ YE+AE KV+QVM+++RQ+Q+PLQC+ME+K
Sbjct: 64  IMLHVHNHGVGECGMFTYEVAETKVSQVMDFARQNQHPLQCVMEKK 109


>gi|330503290|ref|YP_004380159.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           mendocina NK-01]
 gi|328917576|gb|AEB58407.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           mendocina NK-01]
          Length = 120

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 69/120 (57%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++ +     E D+   +       ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHASSQIRLTFNQDHPA-EHEDDSSGIAVQESKPALQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  IML VH +G   CGVY  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LETFFGMNRELATKIMLAVHTEGRAVCGVYTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|192360778|ref|YP_001983029.1| ATP-dependent Clp protease adaptor protein ClpS [Cellvibrio
           japonicus Ueda107]
 gi|190686943|gb|ACE84621.1| ATP-dependent Clp protease adaptor protein clpS [Cellvibrio
           japonicus Ueda107]
          Length = 125

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 64/104 (61%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
           +    A   +   + V    K++ P +Y+V+L+ND+YTPM+FV+H+L+ FF    E A  
Sbjct: 14  DNDDSAGESDGGLAVVTAKPKLKRPSMYKVVLLNDDYTPMDFVVHILETFFSMTREKATH 73

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           +ML VH  G   CG+Y  +IAE K  QV  YSR++Q+PL C +E
Sbjct: 74  VMLTVHVHGKAVCGIYTRDIAETKAAQVNQYSRENQHPLLCEIE 117


>gi|254701912|ref|ZP_05163740.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella suis bv.
           5 str. 513]
          Length = 116

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 57/106 (53%), Positives = 77/106 (72%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
              G    ++      R   K R P LYRVLL+ND+YTPMEFV+HVLQ FF K+ + A  
Sbjct: 11  KTNGGNGPESGTVVVTRTQPKTRKPSLYRVLLLNDDYTPMEFVVHVLQRFFQKNLDDATR 70

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           IML VH+ G+GECG++ YE+AE KV+QVM+++RQ+Q+PLQC+ME+K
Sbjct: 71  IMLHVHNHGVGECGMFTYEVAETKVSQVMDFARQNQHPLQCVMEKK 116


>gi|146307417|ref|YP_001187882.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           mendocina ymp]
 gi|166214739|sp|A4XUY4|CLPS_PSEMY RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|145575618|gb|ABP85150.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           mendocina ymp]
          Length = 120

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 69/120 (57%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++ +     E D+   +       ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHASSQIRLTFNQDHPA-EHEDDSSGIAVQESKPALQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  IML VH +G   CGVY  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LETFFGMNRELATKIMLTVHTEGRAVCGVYTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|229591241|ref|YP_002873360.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           fluorescens SBW25]
 gi|259491249|sp|C3JY63|CLPS_PSEFS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|229363107|emb|CAY50115.1| ATP-dependent clp protease adaptor protein [Pseudomonas fluorescens
           SBW25]
          Length = 122

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 68/121 (56%), Gaps = 1/121 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEV-RFSSKVRVPKLYRVLLVNDNYTPMEFVIH 77
           +  +S I +  ++       + D      V      ++ P +Y+V+L ND+YTPM+FV+ 
Sbjct: 1   MHAISQIRLTFNQDRPDHEHDDDGSAGIAVQEAKPALQAPPMYKVVLFNDDYTPMDFVVE 60

Query: 78  VLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VL+ FF  + E A  +ML VH +G   CGV+  +IAE K  QV  Y+R+ Q+PL C +E+
Sbjct: 61  VLEVFFNLNRELATKVMLAVHTEGRAVCGVFTRDIAETKAMQVNQYARESQHPLLCEIEK 120

Query: 138 K 138
            
Sbjct: 121 D 121


>gi|298291485|ref|YP_003693424.1| ATP-dependent Clp protease adaptor protein ClpS [Starkeya novella
           DSM 506]
 gi|296927996|gb|ADH88805.1| ATP-dependent Clp protease adaptor protein ClpS [Starkeya novella
           DSM 506]
          Length = 123

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 57/110 (51%), Positives = 78/110 (70%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
            +   ++   +         R   +V+ P LYRVLL+ND+YTPMEFV+HVL++FF K+ E
Sbjct: 14  MADEERRRRGDNAPGTAVITRTKPQVKRPSLYRVLLLNDDYTPMEFVVHVLEHFFTKNRE 73

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            A  IML VH  G+GECGVY YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 74  EATQIMLHVHQHGVGECGVYTYEVAETKVTQVMDFARKHQHPLQCVMEKK 123


>gi|304391581|ref|ZP_07373523.1| ATP-dependent Clp protease adapter protein ClpS 1 [Ahrensia sp.
           R2A130]
 gi|303295810|gb|EFL90168.1| ATP-dependent Clp protease adapter protein ClpS 1 [Ahrensia sp.
           R2A130]
          Length = 130

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 54/97 (55%), Positives = 71/97 (73%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           N      R   K++ P LYRVLL+ND++TPMEFVI +L  FF  + E A  +ML VH  G
Sbjct: 34  NDTGVITRTKPKLKKPSLYRVLLLNDDFTPMEFVIEILARFFQMNMEQATQVMLHVHQNG 93

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +GECGVY YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 94  VGECGVYTYEVAETKVTQVMDHARKHQHPLQCVMEKK 130


>gi|188584527|ref|YP_001927972.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           populi BJ001]
 gi|179348025|gb|ACB83437.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           populi BJ001]
          Length = 131

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 77/114 (67%), Gaps = 2/114 (1%)

Query: 25  IFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFY 84
           +  A +  N               R   + + P LYRVLL+ND+YTPMEFV+HV++ FF 
Sbjct: 20  VRAASTPRNPGDDDRS--GTAIITRTKPRAKRPSLYRVLLLNDDYTPMEFVVHVVERFFN 77

Query: 85  KDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           K HE A  IM+ VHH G+GECGV+ YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 78  KSHEDAYQIMMHVHHNGVGECGVFTYEVAETKVTQVMDFARKHQHPLQCVMEKK 131


>gi|241762133|ref|ZP_04760216.1| ATP-dependent Clp protease adaptor protein ClpS [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|260753723|ref|YP_003226616.1| ATP-dependent Clp protease adaptor protein ClpS [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|283856536|ref|YP_163460.2| ATP-dependent Clp protease adaptor protein ClpS [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|67460185|sp|Q5NLR1|CLPS_ZYMMO RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|241373383|gb|EER62983.1| ATP-dependent Clp protease adaptor protein ClpS [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|258553086|gb|ACV76032.1| ATP-dependent Clp protease adaptor protein ClpS [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|283775543|gb|AAV90349.2| ATP-dependent Clp protease adaptor protein ClpS [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 107

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 75/106 (70%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+     + D+ +    R + + + P+ Y+VL++ND+YTPMEFV+  LQ FF    E A 
Sbjct: 1   MSGDKDFDKDSDVTVITRTTPQTKKPQPYKVLMLNDDYTPMEFVVLCLQRFFRMGIEDAT 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML+VH +G+G CGV+ YE+AE KVNQV++++RQHQ+PLQC +E+
Sbjct: 61  KVMLQVHQRGVGICGVFTYEVAETKVNQVVDFARQHQHPLQCTLEK 106


>gi|222148871|ref|YP_002549828.1| ATP-dependent Clp protease adaptor protein ClpS [Agrobacterium
           vitis S4]
 gi|221735857|gb|ACM36820.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 117

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 78/117 (66%)

Query: 22  MSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN 81
           M  I        +      +       R   K + P LYRVLL+ND+YTPMEFVIH+L+ 
Sbjct: 1   MEMIAQPIVMQAQGNNDGPNRGTSVITRTKPKTKKPNLYRVLLLNDDYTPMEFVIHILER 60

Query: 82  FFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           FF KD E A  +ML VH+ G+GECGV+ YE+AE KV+QVM+++RQH++PLQC+ME+K
Sbjct: 61  FFQKDREAATLVMLHVHNHGVGECGVFTYEVAETKVSQVMDFARQHEHPLQCVMEKK 117


>gi|312961674|ref|ZP_07776172.1| ATP-dependent Clp protease adapter protein [Pseudomonas fluorescens
           WH6]
 gi|311283933|gb|EFQ62516.1| ATP-dependent Clp protease adapter protein [Pseudomonas fluorescens
           WH6]
          Length = 122

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 68/121 (56%), Gaps = 1/121 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVR-FSSKVRVPKLYRVLLVNDNYTPMEFVIH 77
           +   S I +  ++       + D      V+     ++ P +Y+V+L ND+YTPM+FV+ 
Sbjct: 1   MHAFSQIRLTFNQDRPDHEHDDDGSAGIAVKEAKPALQAPPMYKVVLFNDDYTPMDFVVE 60

Query: 78  VLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VL+ FF  + E A  +ML VH +G   CGV+  +IAE K  QV  Y+R+ Q+PL C +E+
Sbjct: 61  VLEVFFNLNRELATKVMLAVHTEGRAVCGVFTRDIAETKAMQVNQYARESQHPLLCEIEK 120

Query: 138 K 138
            
Sbjct: 121 D 121


>gi|116251968|ref|YP_767806.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115256616|emb|CAK07704.1| putative ATP-dependent CLP protease adaptor protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 109

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 60/112 (53%), Positives = 79/112 (70%), Gaps = 3/112 (2%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M +        A   N      R   K + P LYRVLL+ND+YTPMEFVIH+L+ FF KD
Sbjct: 1   MQNDSERNGDNA---NRTSVITRTKPKTKKPNLYRVLLLNDDYTPMEFVIHILERFFQKD 57

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            E+A  IML VH+ G+GECG++ YE+AE KV+QVM+++RQHQ+PLQC+ME+K
Sbjct: 58  RESATRIMLHVHNHGVGECGIFTYEVAETKVSQVMDFARQHQHPLQCVMEKK 109


>gi|53804154|ref|YP_114226.1| ATP-dependent Clp protease adaptor protein ClpS [Methylococcus
           capsulatus str. Bath]
 gi|67460232|sp|Q607H2|CLPS_METCA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|53757915|gb|AAU92206.1| ATP-dependent Clp protease adaptor protein ClpS [Methylococcus
           capsulatus str. Bath]
          Length = 106

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 66/102 (64%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                     +      KV+ P LY+V+L+ND++TPMEFV+HVL  FF  + E A  +ML
Sbjct: 4   ESDHGSGDGLALQEAQPKVKRPPLYKVMLLNDDFTPMEFVVHVLMLFFGMNEEKATQVML 63

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            VH +G+G CGV++ ++AE KV QV  ++RQ+Q+PL C ME+
Sbjct: 64  HVHTRGVGVCGVFSKDVAETKVQQVNAHARQNQHPLLCTMEE 105


>gi|119384493|ref|YP_915549.1| ATP-dependent Clp protease adaptor protein ClpS [Paracoccus
           denitrificans PD1222]
 gi|119374260|gb|ABL69853.1| ATP-dependent Clp protease adaptor protein ClpS [Paracoccus
           denitrificans PD1222]
          Length = 105

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 46/103 (44%), Positives = 68/103 (66%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                   ++  V+   + + P +Y+VLL+ND++TPMEFV+HVL+  F  +H  A  IML
Sbjct: 3   NRPGDREEVELGVKTRPRTQRPPMYKVLLLNDDFTPMEFVVHVLERLFNMNHAQAIEIML 62

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            VH +GI   GV+++EIAE KV QVM  +R+ Q+PLQC ME++
Sbjct: 63  TVHRKGIAVVGVFSHEIAETKVAQVMELARRQQHPLQCTMEKE 105


>gi|217976934|ref|YP_002361081.1| ATP-dependent Clp protease adaptor protein ClpS [Methylocella
           silvestris BL2]
 gi|217502310|gb|ACK49719.1| ATP-dependent Clp protease adaptor protein ClpS [Methylocella
           silvestris BL2]
          Length = 169

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 61/138 (44%), Positives = 78/138 (56%), Gaps = 4/138 (2%)

Query: 5   DDGSMYHRVKRDGI----LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLY 60
           D      R   D                D +  K G            R  ++ R P +Y
Sbjct: 32  DPVRPQQRADHDQADPIRARFAPLAAGKDDKEKKGGDGGAGQGTAVITRTKTQTRRPSMY 91

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
           RVLL+ND+YTPMEFV+ VL+ +F K  E A  IML VH  G+GECGV+ YE+AE KV QV
Sbjct: 92  RVLLLNDDYTPMEFVVAVLKKYFNKGPEEATRIMLHVHQHGVGECGVFTYEVAETKVTQV 151

Query: 121 MNYSRQHQYPLQCIMEQK 138
           M+Y+R+HQ+PLQCIME+K
Sbjct: 152 MDYARKHQHPLQCIMEKK 169


>gi|332187681|ref|ZP_08389416.1| ATP-dependent Clp protease adaptor ClpS family protein
           [Sphingomonas sp. S17]
 gi|332012247|gb|EGI54317.1| ATP-dependent Clp protease adaptor ClpS family protein
           [Sphingomonas sp. S17]
          Length = 118

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 46/103 (44%), Positives = 69/103 (66%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
               +  N L    R  ++ + P  YRVL++ND+YTPMEFV+  LQ FF    + A  +M
Sbjct: 15  DHGDDEGNGLGVATRTRARTKQPTPYRVLMLNDDYTPMEFVVLCLQRFFRMSMDDATRVM 74

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L VH +G+G CGV++YE+AE KV QV++++R +Q+PLQC +E+
Sbjct: 75  LHVHQRGVGVCGVFSYEVAETKVAQVIDFARANQHPLQCTLEK 117


>gi|77165887|ref|YP_344412.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosococcus
           oceani ATCC 19707]
 gi|254433959|ref|ZP_05047467.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosococcus
           oceani AFC27]
 gi|76884201|gb|ABA58882.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosococcus
           oceani ATCC 19707]
 gi|207090292|gb|EDZ67563.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosococcus
           oceani AFC27]
          Length = 107

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 70/106 (66%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M K  + E +    +      K++ P LY+V+++ND+YTPMEFV+ VLQ FF  D E A 
Sbjct: 1   MGKINLDEDNEGGFAVDTAKPKLKRPPLYKVVMLNDDYTPMEFVVKVLQAFFAMDREKAT 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +M +VH +G G CGV+ YEIAE K +QV  YS  HQ+PL+C++E+
Sbjct: 61  RVMWQVHTEGKGICGVFTYEIAETKASQVNEYSMNHQHPLKCVLER 106


>gi|325292723|ref|YP_004278587.1| ATP-dependent Clp protease adapter protein clpS 1 [Agrobacterium
           sp. H13-3]
 gi|325060576|gb|ADY64267.1| ATP-dependent Clp protease adapter protein clpS 1 [Agrobacterium
           sp. H13-3]
          Length = 117

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 74/98 (75%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           +       R   K + P LYRVLL+ND+YTPMEFVIH+L+ FF KD E A  IML VH  
Sbjct: 20  NRGTSVITRVKPKTKRPNLYRVLLLNDDYTPMEFVIHILERFFQKDREAATRIMLHVHQH 79

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G+GECGV+ YE+AE KV+QVM+++RQHQ+PLQC+ME+K
Sbjct: 80  GVGECGVFTYEVAETKVSQVMDFARQHQHPLQCVMEKK 117


>gi|297564863|ref|YP_003683835.1| ATP-dependent Clp protease adaptor protein ClpS [Meiothermus
           silvanus DSM 9946]
 gi|296849312|gb|ADH62327.1| ATP-dependent Clp protease adaptor protein ClpS [Meiothermus
           silvanus DSM 9946]
          Length = 100

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 50/99 (50%), Positives = 69/99 (69%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            +   D++ +  S+ R P  Y+VLL+ND+YTPM+FV+ VL  FF K    A  IML+VHH
Sbjct: 2   SNPAGDTKTKTQSRTRTPPQYKVLLLNDDYTPMDFVVEVLMRFFRKSELEATRIMLQVHH 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +G+G CGVY +EIAE KV+QVM  + +  +PLQCIME +
Sbjct: 62  EGVGVCGVYPFEIAETKVHQVMEAAAEEGHPLQCIMEPE 100


>gi|83593445|ref|YP_427197.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodospirillum
           rubrum ATCC 11170]
 gi|83576359|gb|ABC22910.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodospirillum
           rubrum ATCC 11170]
          Length = 137

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 52/93 (55%), Positives = 71/93 (76%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
             V+   K + P +YRVL++ND+YTPMEFV+HVL+ FF K HE A  IML VH +G+G C
Sbjct: 45  VVVKAKPKTKKPSMYRVLMLNDDYTPMEFVVHVLERFFGKTHEEATNIMLHVHQRGVGLC 104

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           GVY YE+AE KV+QVM+ +R+ Q+PLQC +E++
Sbjct: 105 GVYTYEVAETKVSQVMDLARRSQHPLQCTLEKE 137


>gi|50084541|ref|YP_046051.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter sp.
           ADP1]
 gi|49530517|emb|CAG68229.1| substrate modulator for ClpAP, directs protease activity towards
           aggregated proteins [Acinetobacter sp. ADP1]
          Length = 137

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 44/111 (39%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
                       +   D  V+ +  +++ P LY V+L+ND+YTPM+FVI +LQ +F  + 
Sbjct: 26  HINPRLGDSQSDEPEGDIAVQTAPPELKRPPLYAVVLLNDDYTPMDFVIEILQQYFALNL 85

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + A  +ML VH++G G  GVY  +IAE K NQV NY+R   +PL C +E K
Sbjct: 86  DQATQVMLTVHYEGKGVAGVYPRDIAETKANQVNNYARSQGHPLLCQIEPK 136


>gi|15888689|ref|NP_354370.1| ATP-dependent Clp protease adaptor protein ClpS [Agrobacterium
           tumefaciens str. C58]
 gi|24638402|sp|Q8UFN4|CLPS1_AGRT5 RecName: Full=ATP-dependent Clp protease adapter protein ClpS 1
 gi|15156427|gb|AAK87155.1| ATP-dependent Clp protease adaptor protein ClpS [Agrobacterium
           tumefaciens str. C58]
          Length = 117

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 74/98 (75%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           +       R   K + P LYRVLL+ND+YTPMEFVIH+L+ FF KD E A  IML VH  
Sbjct: 20  NRGTSVITRVKPKTKRPNLYRVLLLNDDYTPMEFVIHILERFFQKDREAATRIMLHVHQH 79

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G+GECGV+ YE+AE KV+QVM+++RQHQ+PLQC+ME+K
Sbjct: 80  GVGECGVFTYEVAETKVSQVMDFARQHQHPLQCVMEKK 117


>gi|163854197|ref|YP_001642240.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           extorquens PA1]
 gi|240141657|ref|YP_002966137.1| ATP-dependent Clp protease adaptor protein clpS [Methylobacterium
           extorquens AM1]
 gi|254564165|ref|YP_003071260.1| ATP-dependent Clp protease adaptor protein clpS [Methylobacterium
           extorquens DM4]
 gi|163665802|gb|ABY33169.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           extorquens PA1]
 gi|240011634|gb|ACS42860.1| ATP-dependent Clp protease adaptor protein clpS [Methylobacterium
           extorquens AM1]
 gi|254271443|emb|CAX27458.1| ATP-dependent Clp protease adaptor protein clpS [Methylobacterium
           extorquens DM4]
          Length = 112

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/112 (49%), Positives = 78/112 (69%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M  +   +    +  +      R   + + P LYRVLL+ND+YTPMEFV+HV++ FF K 
Sbjct: 1   MRAASTPRSPGDDDRSGTAIITRTKPRAKRPSLYRVLLLNDDYTPMEFVVHVVERFFNKS 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H+ A  IM+ VHH G+GECGV+ YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 61  HDDAYQIMMHVHHNGVGECGVFTYEVAETKVTQVMDFARKHQHPLQCVMEKK 112


>gi|91977524|ref|YP_570183.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris BisB5]
 gi|91683980|gb|ABE40282.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris BisB5]
          Length = 109

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 56/101 (55%), Positives = 73/101 (72%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
              +       +   K + P LYRVL++ND+YTPMEFV+HVL+ FF  D E A  +ML V
Sbjct: 9   GTGNPATSVITKVKPKTKRPNLYRVLILNDDYTPMEFVVHVLEKFFQMDVEAATQVMLHV 68

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           HH GIGECGV+ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 69  HHHGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 109


>gi|91774864|ref|YP_544620.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacillus
           flagellatus KT]
 gi|91708851|gb|ABE48779.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacillus
           flagellatus KT]
          Length = 128

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 54/130 (41%), Positives = 80/130 (61%), Gaps = 9/130 (6%)

Query: 8   SMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVND 67
           +  H    +  + L     MA  +     I +            + ++ P +Y+V+L+ND
Sbjct: 7   NPTHFRLENFYIRLKIDQRMASIKHQDNLIEKTG---------KANIKPPSMYKVILLND 57

Query: 68  NYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQH 127
           +YTPMEFV+ V+Q FF+K+ E A  IML+VH +G G CGVY + IAE KVNQV++Y+R+H
Sbjct: 58  DYTPMEFVVDVMQRFFHKNREQATQIMLQVHTEGAGVCGVYPHGIAETKVNQVISYAREH 117

Query: 128 QYPLQCIMEQ 137
           Q+PLQC ME+
Sbjct: 118 QHPLQCTMEE 127


>gi|262370290|ref|ZP_06063616.1| substrate modulator for ClpAP [Acinetobacter johnsonii SH046]
 gi|262314632|gb|EEY95673.1| substrate modulator for ClpAP [Acinetobacter johnsonii SH046]
          Length = 138

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 66/110 (60%), Gaps = 1/110 (0%)

Query: 30  SRMNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
           S          +   D  V+ +  +++ P LY V+L+ND+YTPM+FVI +LQ +F  + +
Sbjct: 28  SPRLSNDEPNEEENGDVAVQTAPPELKRPPLYAVVLMNDDYTPMDFVIEILQQYFALNLD 87

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            A  +ML VH++G G  GVY  +IAE K NQV NY+R   +PL C +E K
Sbjct: 88  QATQVMLTVHYEGKGVAGVYPRDIAETKANQVNNYARSQGHPLLCQIEPK 137


>gi|149928085|ref|ZP_01916332.1| ATP-dependent Clp protease adaptor protein ClpS [Limnobacter sp.
           MED105]
 gi|149823171|gb|EDM82408.1| ATP-dependent Clp protease adaptor protein ClpS [Limnobacter sp.
           MED105]
          Length = 134

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 70/110 (63%)

Query: 28  ADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
                  + ++  +N        + K ++P +Y+V+L+ND+YTPMEFV+ VLQ FF K  
Sbjct: 24  PLRSDYNEVMSSQNNPSTVLESQTQKAKLPPMYQVVLLNDDYTPMEFVVIVLQKFFGKGR 83

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           E A  IMLKVH +G G CGVY  +IA  KV  V  +++QHQ+PLQC+ME+
Sbjct: 84  EQATQIMLKVHREGKGVCGVYPKDIASTKVEMVCGFAKQHQHPLQCVMEE 133


>gi|42522812|ref|NP_968192.1| hypothetical protein Bd1289 [Bdellovibrio bacteriovorus HD100]
 gi|67460291|sp|Q6MNG7|CLPS_BDEBA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|39574008|emb|CAE79185.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 114

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 46/113 (40%), Positives = 73/113 (64%), Gaps = 1/113 (0%)

Query: 27  MADSR-MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYK 85
           M +++  +           ++ V+   K+  PK+Y+V+L+ND+YTPM+FV+ VL+ FF K
Sbjct: 1   MGNNKKDSNSNYPFASPEGEAGVQLVPKLDTPKMYKVILLNDDYTPMDFVVLVLRRFFAK 60

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             E A  IML VH +G G  GV++ EIAEMKV QV  +++ +QYPL+  +E++
Sbjct: 61  TEEQATEIMLDVHKKGAGVAGVFSLEIAEMKVMQVNQFAQLNQYPLKSTLEEE 113


>gi|254475794|ref|ZP_05089180.1| ATP-dependent Clp protease adaptor protein ClpS [Ruegeria sp. R11]
 gi|214030037|gb|EEB70872.1| ATP-dependent Clp protease adaptor protein ClpS [Ruegeria sp. R11]
          Length = 107

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 46/104 (44%), Positives = 68/104 (65%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
              ++ D       +   K + P  Y+VLL+ND+YTPMEFV+ VL+ FF   H  A  +M
Sbjct: 3   SDHSDDDTEFGVLTKTRPKTQRPPRYKVLLLNDDYTPMEFVVMVLERFFNMTHAEAFEVM 62

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L VH +G+   GV+++EIAE KV QVM+++ +HQ+PLQC ME++
Sbjct: 63  LTVHKKGVAVVGVFSHEIAETKVGQVMDFAHRHQHPLQCTMEKE 106


>gi|153871083|ref|ZP_02000343.1| ATP-dependent Clp protease adaptor protein ClpS [Beggiatoa sp. PS]
 gi|152072449|gb|EDN69655.1| ATP-dependent Clp protease adaptor protein ClpS [Beggiatoa sp. PS]
          Length = 106

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 47/96 (48%), Positives = 69/96 (71%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
                E    SK++ P +Y+V+L+ND+YTPM+FV+H+L+ FF  + + A  IML+VH +G
Sbjct: 10  EDDVIEEEQKSKLKRPPMYKVILLNDDYTPMDFVVHILEIFFGMEKDLATHIMLQVHTKG 69

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CG Y+ EIAE KV QV NY+R++Q+PL CI+E+
Sbjct: 70  KGICGTYSREIAETKVAQVNNYARENQHPLLCILEK 105


>gi|70731245|ref|YP_260986.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           fluorescens Pf-5]
 gi|123654447|sp|Q4K9U7|CLPS_PSEF5 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|68345544|gb|AAY93150.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           fluorescens Pf-5]
          Length = 120

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 71/120 (59%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +  +S I +  ++  +  + + D+   +       ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHAISQIRLTFNQD-RPDLHDDDSAGLAVQEAKPALQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  +ML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LEMFFNLNRELATKVMLAVHTEGRAVCGLFTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|330810450|ref|YP_004354912.1| ATP-dependent Clp protease adapter protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327378558|gb|AEA69908.1| ATP-dependent Clp protease adapter protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 120

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 69/116 (59%), Gaps = 1/116 (0%)

Query: 23  SFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
           S I +  ++  +  + + D+   +       ++ P +Y+V+L ND+YTPM+FV+ VL+ F
Sbjct: 5   SQIRLTFNQD-RPDLHDDDSAGIAVQEAKPALQAPPMYKVVLFNDDYTPMDFVVEVLEVF 63

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           F  + E A  +ML VH +G   CGV+  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 64  FNLNRELATKVMLAVHTEGRAVCGVFTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|37077096|sp|Q89JW5|CLPS2_BRAJA RecName: Full=ATP-dependent Clp protease adapter protein ClpS 2
          Length = 110

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/110 (53%), Positives = 76/110 (69%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
            S    +  +          +   K + P LYRVL++ND+YTPMEFV+HVL+ FF KD E
Sbjct: 1   MSNDENRSGSPTGPNTSVITKVKPKTKRPNLYRVLILNDDYTPMEFVVHVLEKFFQKDVE 60

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            A  IML VHH GIGECGV+ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 61  AATKIMLHVHHHGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 110


>gi|255320456|ref|ZP_05361637.1| substrate modulator for ClpAP, directs protease activity towards
           aggregated protein [Acinetobacter radioresistens SK82]
 gi|262378352|ref|ZP_06071509.1| substrate modulator for ClpAP [Acinetobacter radioresistens SH164]
 gi|255302428|gb|EET81664.1| substrate modulator for ClpAP, directs protease activity towards
           aggregated protein [Acinetobacter radioresistens SK82]
 gi|262299637|gb|EEY87549.1| substrate modulator for ClpAP [Acinetobacter radioresistens SH164]
          Length = 137

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/111 (37%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
                       +   +  V+ +  +++ P LY V+L+ND+YTPM+FVI +LQ +F  + 
Sbjct: 26  HLNPRLSDSQNDEADGEIAVKPAPPQLKKPPLYAVVLLNDDYTPMDFVIEILQQYFALNL 85

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + A  +ML VH++G G  G+Y  +IAE K NQV NY+R   +PL C +E K
Sbjct: 86  DQATQVMLTVHYEGKGVAGIYPRDIAETKANQVNNYARSQGHPLLCQIEPK 136


>gi|110834145|ref|YP_693004.1| hypothetical protein ABO_1284 [Alcanivorax borkumensis SK2]
 gi|110647256|emb|CAL16732.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 124

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 1/104 (0%)

Query: 35  KGIAEFDNCLDSEVR-FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
              ++ D   D  V     K++ P +Y+VL++ND+YTPM+FV+ +L++FF  D E A  +
Sbjct: 20  DSSSDPDRHGDLAVEEAKPKLKPPSMYKVLMLNDDYTPMDFVVEILEDFFNLDREQATRV 79

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH +G   CGVY  +IAE K  QV+ Y+R++Q+PL C +EQ
Sbjct: 80  MLTVHTEGKAVCGVYPQDIAETKATQVVEYARENQHPLMCQVEQ 123


>gi|85716350|ref|ZP_01047323.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrobacter sp.
           Nb-311A]
 gi|85696866|gb|EAQ34751.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrobacter sp.
           Nb-311A]
          Length = 110

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 60/112 (53%), Positives = 78/112 (69%), Gaps = 2/112 (1%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M++      G    D       +   K + P LYRVL++ND+YTPMEFV+HVL+ FF KD
Sbjct: 1   MSEDDDRAGGR--GDPAASVITKVRPKTKRPNLYRVLILNDDYTPMEFVVHVLEKFFQKD 58

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            E A  IML VHH GIGECGV+ YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 59  LEAATQIMLHVHHHGIGECGVFTYEVAETKVTQVMDFARKHQHPLQCVMEKK 110


>gi|300113413|ref|YP_003759988.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosococcus
           watsonii C-113]
 gi|299539350|gb|ADJ27667.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosococcus
           watsonii C-113]
          Length = 107

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 67/106 (63%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M K    E +           K++ P LY+V+++ND+YTPMEFV+ VLQ FF  D   A 
Sbjct: 1   MGKINPDEENEGGFVVDTAKPKLKRPPLYKVVMLNDDYTPMEFVVKVLQTFFAMDRGKAT 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +M +VH +G G CGV+ YEIAE K +QV  YS  HQ+PL+C++E+
Sbjct: 61  RVMWQVHTEGRGICGVFTYEIAETKASQVNEYSMNHQHPLKCVLER 106


>gi|26990714|ref|NP_746139.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas putida
           KT2440]
 gi|148547059|ref|YP_001267161.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas putida
           F1]
 gi|167034610|ref|YP_001669841.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas putida
           GB-1]
 gi|37077092|sp|Q88FS4|CLPS_PSEPK RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214740|sp|A5W1G7|CLPS_PSEP1 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|189082475|sp|B0KLX7|CLPS_PSEPG RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|24985707|gb|AAN69603.1|AE016593_11 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|148511117|gb|ABQ77977.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas putida
           F1]
 gi|166861098|gb|ABY99505.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas putida
           GB-1]
          Length = 120

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 68/120 (56%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++  +    E D    +       ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHAPSEIRLTFNQD-RPQSNEDDGSGLAVQEAKPILQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  IML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LETFFSLNRELATKIMLTVHTEGRAVCGLFTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|115525406|ref|YP_782317.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris BisA53]
 gi|115519353|gb|ABJ07337.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris BisA53]
          Length = 109

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 74/107 (69%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
              +  +          +   + + P +YRVL++ND+YTPMEFV+HVL+ FF  D E A 
Sbjct: 3   DENRSGSPGSPATSVITKTKPRTKRPSMYRVLILNDDYTPMEFVVHVLEKFFQMDVEAAT 62

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +ML VHH GIGECGV+ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 63  KVMLHVHHHGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 109


>gi|170740498|ref|YP_001769153.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           sp. 4-46]
 gi|168194772|gb|ACA16719.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           sp. 4-46]
          Length = 142

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 54/96 (56%), Positives = 70/96 (72%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R     + P LYRVLL+ND+YTPMEFV+HV++ FF K  E A  IML VH  G+
Sbjct: 47  GTAVITRTRPVTKRPNLYRVLLLNDDYTPMEFVVHVVERFFNKSREDATRIMLHVHQNGV 106

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           GECGV+ YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 107 GECGVFTYEVAETKVTQVMDFARKHQHPLQCVMEKK 142


>gi|170722578|ref|YP_001750266.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas putida
           W619]
 gi|229889823|sp|B1JBE9|CLPS_PSEPW RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|169760581|gb|ACA73897.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas putida
           W619]
          Length = 120

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 67/116 (57%), Gaps = 1/116 (0%)

Query: 23  SFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
           S I +  ++  +    E D    +       ++ P +Y+V+L ND+YTPM+FV+ VL+ F
Sbjct: 5   SEIRLTFNQD-RPQSNEDDGSGLAVQEAKPILQAPPMYKVVLFNDDYTPMDFVVEVLETF 63

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           F  + E A  IML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 64  FSLNRELATKIMLTVHTEGRAVCGLFTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|325273424|ref|ZP_08139676.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas sp.
           TJI-51]
 gi|324101437|gb|EGB99031.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas sp.
           TJI-51]
          Length = 120

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 67/116 (57%), Gaps = 1/116 (0%)

Query: 23  SFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
           S I +  ++  +    E D    +       ++ P +Y+V+L ND+YTPM+FV+ VL+ F
Sbjct: 5   SQIRLTFNQD-RPQSNEDDGSGLAVQEAKPILQAPPMYKVVLFNDDYTPMDFVVEVLETF 63

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           F  + E A  IML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 64  FSLNRELATKIMLTVHTEGRAVCGLFTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|117925058|ref|YP_865675.1| ATP-dependent Clp protease adaptor protein ClpS [Magnetococcus sp.
           MC-1]
 gi|117608814|gb|ABK44269.1| ATP-dependent Clp protease adaptor protein ClpS [Magnetococcus sp.
           MC-1]
          Length = 113

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 47/99 (47%), Positives = 64/99 (64%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
             D+     V     VR P +YRV+L+ND++TPMEFV+ +L +FF K  E A  IML +H
Sbjct: 14  NIDHDTSVAVHLDVVVREPPMYRVVLLNDDFTPMEFVVELLMHFFRKTAEQATQIMLNIH 73

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H+G+G CG Y  EIAE KV QV  ++R + +PL+C ME 
Sbjct: 74  HEGVGVCGTYPREIAETKVAQVHQHARTNGHPLKCRMEP 112


>gi|166712083|ref|ZP_02243290.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas oryzae
           pv. oryzicola BLS256]
          Length = 112

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 66/111 (59%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M  +  ++       +          +V  P  Y+VLL+ND+YTPM+FV+ VLQ FF  +
Sbjct: 1   MPRNTSHEHEHEHEHDHGLMVEASKPEVAPPPRYQVLLLNDDYTPMDFVVTVLQQFFNLN 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            E A  IML VH +G G CGVY+ E+AE KV QV  +SR +Q+PL C MEQ
Sbjct: 61  LEQATQIMLHVHTRGRGVCGVYSREVAESKVAQVNEFSRMNQHPLLCTMEQ 111


>gi|220920395|ref|YP_002495696.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           nodulans ORS 2060]
 gi|219945001|gb|ACL55393.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacterium
           nodulans ORS 2060]
          Length = 135

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 55/111 (49%), Positives = 74/111 (66%)

Query: 28  ADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
             +  N     +  +      R     + P LYRVLL+ND+YTPMEFV+HV++ FF K  
Sbjct: 25  PRAPGNGGNGGDGRSGTAVITRTRPITKRPNLYRVLLLNDDYTPMEFVVHVVERFFNKSR 84

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           E A  IML VH  G+GECGV+ YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 85  EDATRIMLHVHQNGVGECGVFTYEVAETKVTQVMDFARKHQHPLQCVMEKK 135


>gi|28897787|ref|NP_797392.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153837344|ref|ZP_01990011.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus AQ3810]
 gi|260365333|ref|ZP_05777884.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus K5030]
 gi|260876951|ref|ZP_05889306.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus AN-5034]
 gi|260897908|ref|ZP_05906404.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus Peru-466]
 gi|260901417|ref|ZP_05909812.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus AQ4037]
 gi|33301900|sp|Q87QY5|CLPS_VIBPA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|28806000|dbj|BAC59276.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149749375|gb|EDM60148.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus AQ3810]
 gi|308085449|gb|EFO35144.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus Peru-466]
 gi|308093908|gb|EFO43603.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus AN-5034]
 gi|308107509|gb|EFO45049.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus AQ4037]
 gi|308112689|gb|EFO50229.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus K5030]
 gi|328473237|gb|EGF44085.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus 10329]
          Length = 106

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 52/98 (53%), Positives = 67/98 (68%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                D   R S+KV+ PKLY V+L ND+YTPM+FVI VL+ FF  D + A  IMLKVH+
Sbjct: 8   VTPDSDLLERESTKVQPPKLYNVVLNNDDYTPMDFVIEVLERFFSHDIDKATQIMLKVHY 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CG Y+ EIAE KV QV  Y+R++++PL C MEQ
Sbjct: 68  EGKAVCGTYSAEIAETKVAQVTMYARENEHPLLCTMEQ 105


>gi|213424208|pdb|3DNJ|A Chain A, The Structure Of The Caulobacter Crescentus Clps Protease
           Adaptor Protein In Complex With A N-End Rule Peptide
 gi|213424209|pdb|3DNJ|B Chain B, The Structure Of The Caulobacter Crescentus Clps Protease
           Adaptor Protein In Complex With A N-End Rule Peptide
 gi|228312130|pdb|3G19|A Chain A, The Structure Of The Caulobacter Crescentus Clps Protease
           Adaptor Protein In Complex With Lll Tripeptide
 gi|228312330|pdb|3GQ0|A Chain A, The Structure Of The Caulobacter Crescentus Clps Protease
           Adaptor Protein - Apo Structure With No Peptide
 gi|228312331|pdb|3GQ0|B Chain B, The Structure Of The Caulobacter Crescentus Clps Protease
           Adaptor Protein - Apo Structure With No Peptide
 gi|229597899|pdb|3GQ1|A Chain A, The Structure Of The Caulobacter Crescentus Clps Protease
           Adaptor Protein In Complex With A Wlfvqrdske Decapeptide
 gi|229597900|pdb|3GQ1|B Chain B, The Structure Of The Caulobacter Crescentus Clps Protease
           Adaptor Protein In Complex With A Wlfvqrdske Decapeptide
 gi|229597907|pdb|3GW1|A Chain A, The Structure Of The Caulobacter Crescentus Clps Protease
           Adaptor Protein In Complex With Fgg Tripeptide
 gi|229597908|pdb|3GW1|B Chain B, The Structure Of The Caulobacter Crescentus Clps Protease
           Adaptor Protein In Complex With Fgg Tripeptide
          Length = 85

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 50/85 (58%), Positives = 65/85 (76%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
            + P LYRVL++ND+YTPMEFV++VL+ FF K  E A  IML VH  G+G CGVY YE+A
Sbjct: 1   TQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVA 60

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQK 138
           E KV QV++ +R+HQ+PLQC ME+ 
Sbjct: 61  ETKVAQVIDSARRHQHPLQCTMEKD 85


>gi|126733462|ref|ZP_01749209.1| ATP-dependent Clp protease, putative [Roseobacter sp. CCS2]
 gi|126716328|gb|EBA13192.1| ATP-dependent Clp protease, putative [Roseobacter sp. CCS2]
          Length = 113

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 68/91 (74%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
           +    K + P +Y+VL++ND++TPMEFV+HVL+ FF   H  A  +ML VH +G+   GV
Sbjct: 23  LETKPKTKRPPMYKVLILNDDFTPMEFVVHVLERFFGLSHAQAFELMLTVHKKGVAVVGV 82

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +++EIAE KV QVM+++++HQ+PLQC ME++
Sbjct: 83  FSHEIAETKVAQVMDFAQRHQHPLQCTMEKE 113


>gi|91229058|ref|ZP_01262884.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           alginolyticus 12G01]
 gi|269967653|ref|ZP_06181703.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           alginolyticus 40B]
 gi|91187451|gb|EAS73791.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           alginolyticus 12G01]
 gi|269827740|gb|EEZ82024.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           alginolyticus 40B]
          Length = 106

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 51/98 (52%), Positives = 67/98 (68%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                D   R S+KV+ PKLY V+L ND+YTPM+FVI VL+ FF  D + A  IML+VH+
Sbjct: 8   VTPDSDLLERESTKVQPPKLYNVVLNNDDYTPMDFVIEVLERFFSHDIDKATQIMLQVHY 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CG Y+ EIAE KV QV  Y+R++++PL C MEQ
Sbjct: 68  EGKAICGTYSAEIAETKVAQVTMYARENEHPLLCTMEQ 105


>gi|237809064|ref|YP_002893504.1| ATP-dependent Clp protease adaptor protein ClpS [Tolumonas auensis
           DSM 9187]
 gi|237501325|gb|ACQ93918.1| ATP-dependent Clp protease adaptor protein ClpS [Tolumonas auensis
           DSM 9187]
          Length = 104

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 47/102 (46%), Positives = 68/102 (66%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
           G         +     ++++ P +Y+V+L+ND+YTPM+FV+ VLQ FF  D E A  +ML
Sbjct: 2   GKTRVSPTPGTAAESKTEIQPPSMYKVVLLNDDYTPMDFVVEVLQRFFRMDLEKATQVML 61

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            VH+ G G CGVY  +IAE KV+QV +Y+R+H++PL C MEQ
Sbjct: 62  AVHYDGKGICGVYTADIAETKVDQVNHYARKHEHPLLCTMEQ 103


>gi|77459813|ref|YP_349320.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           fluorescens Pf0-1]
 gi|77383816|gb|ABA75329.1| ATP-dependent clp protease adaptor protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 127

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 69/126 (54%), Gaps = 6/126 (4%)

Query: 19  LALMSFIFMADSRMNK------KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPM 72
           +  +S I +  ++             + D+   +       ++ P +Y+V+L ND+YTPM
Sbjct: 1   MHAISQIRLTFNQDRPLLQKDLPQEHDDDSAGVAVQEAKPALQAPPMYKVVLFNDDYTPM 60

Query: 73  EFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQ 132
           +FV+ VL+ FF  + E A  +ML VH +G   CGV+  +IAE K  QV  Y+R+ Q+PL 
Sbjct: 61  DFVVEVLEVFFNLNRELATKVMLAVHTEGRAVCGVFTRDIAETKAMQVNQYARESQHPLL 120

Query: 133 CIMEQK 138
           C +E+ 
Sbjct: 121 CEIEKD 126


>gi|192291927|ref|YP_001992532.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris TIE-1]
 gi|192285676|gb|ACF02057.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris TIE-1]
          Length = 115

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 55/99 (55%), Positives = 72/99 (72%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                    +   + + P LYRVL++ND+YTPMEFV+HVL+ FF  D E A  +ML VHH
Sbjct: 17  STPSTSVITKTKPRTKRPNLYRVLILNDDYTPMEFVVHVLEKFFQMDVEAATKVMLHVHH 76

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            GIGECGV+ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 77  HGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 115


>gi|289208442|ref|YP_003460508.1| ATP-dependent Clp protease adaptor protein ClpS [Thioalkalivibrio
           sp. K90mix]
 gi|288944073|gb|ADC71772.1| ATP-dependent Clp protease adaptor protein ClpS [Thioalkalivibrio
           sp. K90mix]
          Length = 108

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
              K  I + D+    E     +++ P+ Y+V+L+ND++TPMEFV+ VL+ FF  D E A
Sbjct: 2   SEKKPQIPDHDSNTAVE-ESRPELKPPRQYKVVLLNDDFTPMEFVVEVLETFFSMDREKA 60

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             +ML VH +G G CG+Y  ++AE KV QV +Y+R HQ+PL C ME+
Sbjct: 61  TQVMLHVHTRGKGICGIYTRDVAETKVAQVNDYARSHQHPLLCSMEE 107


>gi|117619917|ref|YP_856387.1| ATP-dependent Clp protease adaptor protein ClpS [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|158512298|sp|A0KJD6|CLPS_AERHH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|117561324|gb|ABK38272.1| ATP-dependent Clp protease adaptor protein ClpS [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 105

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 62/93 (66%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           +      +K++ P +Y+V+L ND+YTPMEFV+ VLQ FF  D + A  +ML VH+ G G 
Sbjct: 12  EIAEAEKTKLQPPPMYKVVLNNDDYTPMEFVVEVLQKFFGMDLDKATQVMLSVHYSGKGV 71

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           CG +  EIAE KV QV  Y+R +++PL C ME+
Sbjct: 72  CGTFTAEIAETKVVQVNTYARNNEHPLLCTMEK 104


>gi|256822682|ref|YP_003146645.1| ATP-dependent Clp protease adaptor protein ClpS [Kangiella
           koreensis DSM 16069]
 gi|256796221|gb|ACV26877.1| ATP-dependent Clp protease adaptor protein ClpS [Kangiella
           koreensis DSM 16069]
          Length = 115

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 71/112 (63%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M++ + + +          +      K++ P +Y+VL++ND+YTPM+FV+ VL+ FF  D
Sbjct: 1   MSNDQNHNQNHDHEHEHGLAVADAKPKLKQPPMYKVLILNDDYTPMDFVVDVLRKFFTMD 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            E A  +ML+VHH+G G CG +  +IAE KV QV  ++R +Q+PL C+ME +
Sbjct: 61  TEQATRVMLQVHHEGQGVCGTFTPDIAETKVVQVNEFARANQHPLLCVMEPE 112


>gi|116050608|ref|YP_790573.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|152987145|ref|YP_001347950.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           aeruginosa PA7]
 gi|296388919|ref|ZP_06878394.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           aeruginosa PAb1]
 gi|12230856|sp|Q9I0L7|CLPS_PSEAE RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|122259731|sp|Q02NB3|CLPS_PSEAB RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214738|sp|A6V4G5|CLPS_PSEA7 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|115585829|gb|ABJ11844.1| ATP-dependent Clp protease adaptor protein clpS [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|150962303|gb|ABR84328.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 122

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 1/121 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEV-RFSSKVRVPKLYRVLLVNDNYTPMEFVIH 77
           +   S I +  ++ + +     D      V      ++ P LY+V+L ND+YTPM+FV+ 
Sbjct: 1   MHAPSQIRLTFNQDHPEPHEHEDEGAGLAVQESKPVLQPPPLYKVVLFNDDYTPMDFVVE 60

Query: 78  VLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VL+ FF  D E A  IML VH QG   CG++  ++AE K  QV  Y+R+ Q+PL C +E+
Sbjct: 61  VLEVFFNMDREKATKIMLTVHTQGKAVCGLFTRDVAETKAMQVNQYARESQHPLLCEIEK 120

Query: 138 K 138
            
Sbjct: 121 D 121


>gi|126725142|ref|ZP_01740985.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacterales
           bacterium HTCC2150]
 gi|126706306|gb|EBA05396.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacterales
           bacterium HTCC2150]
          Length = 115

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 70/104 (67%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
                 ++  D   +  ++ + P +Y+VLL+ND+YTPMEFV+HVL+ FF  ++  A  IM
Sbjct: 11  SDDDGDNSEGDVATKTRARTKRPPMYKVLLLNDDYTPMEFVVHVLERFFGINNAQAVEIM 70

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L VH +G+   GV+++EIAEMKV QVM+ + Q ++PLQC  E++
Sbjct: 71  LTVHKKGMAVVGVFSHEIAEMKVTQVMDLAHQQEHPLQCTFEKE 114


>gi|67460482|sp|Q6N535|CLPS2_RHOPA RecName: Full=ATP-dependent Clp protease adapter protein ClpS 2
          Length = 109

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 55/99 (55%), Positives = 72/99 (72%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                    +   + + P LYRVL++ND+YTPMEFV+HVL+ FF  D E A  +ML VHH
Sbjct: 11  STPSTSVITKTKPRTKRPNLYRVLILNDDYTPMEFVVHVLEKFFQMDVEAATKVMLHVHH 70

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            GIGECGV+ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 71  HGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 109


>gi|296446322|ref|ZP_06888268.1| ATP-dependent Clp protease adaptor protein ClpS [Methylosinus
           trichosporium OB3b]
 gi|296256223|gb|EFH03304.1| ATP-dependent Clp protease adaptor protein ClpS [Methylosinus
           trichosporium OB3b]
          Length = 141

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 79/127 (62%)

Query: 12  RVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTP 71
           RV R G     +    A     K G  +         R  ++ R P +YRVLL+ND+YT 
Sbjct: 15  RVTRRGAPPRAAGRTRASKEPRKSGGGDGGAGTALITRTRTQTRRPNMYRVLLLNDDYTT 74

Query: 72  MEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPL 131
            EFV+ VL+ +F K  E A  IML VH+ G+GECGVY YE+AE KV QVM+Y+R+HQ+PL
Sbjct: 75  QEFVVIVLRKYFNKSLEEATRIMLHVHNHGVGECGVYTYEVAETKVTQVMDYARKHQHPL 134

Query: 132 QCIMEQK 138
           QCIME+K
Sbjct: 135 QCIMEKK 141


>gi|74317254|ref|YP_314994.1| ATP-dependent Clp protease adaptor protein ClpS [Thiobacillus
           denitrificans ATCC 25259]
 gi|74056749|gb|AAZ97189.1| ATP-dependent Clp protease adaptor protein ClpS [Thiobacillus
           denitrificans ATCC 25259]
          Length = 102

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 68/85 (80%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           KV+ P LY+VLL+ND+YTPMEFV+HVL+ FF  D E A  IMLKVH +G+G CGV+  +I
Sbjct: 17  KVKPPPLYKVLLLNDDYTPMEFVVHVLRKFFGIDEERATQIMLKVHTEGVGVCGVFTRDI 76

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  KV QV++++RQHQ+PLQC ME+
Sbjct: 77  AHTKVEQVVDFARQHQHPLQCTMEE 101


>gi|67460271|sp|Q6FCI2|CLPS_ACIAD RecName: Full=ATP-dependent Clp protease adapter protein ClpS
          Length = 107

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 36  GIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
                +   D  V+ +  +++ P LY V+L+ND+YTPM+FVI +LQ +F  + + A  +M
Sbjct: 3   DSQSDEPEGDIAVQTAPPELKRPPLYAVVLLNDDYTPMDFVIEILQQYFALNLDQATQVM 62

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L VH++G G  GVY  +IAE K NQV NY+R   +PL C +E K
Sbjct: 63  LTVHYEGKGVAGVYPRDIAETKANQVNNYARSQGHPLLCQIEPK 106


>gi|330875785|gb|EGH09934.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
          Length = 120

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 68/120 (56%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++       E D+   +       ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHAFSKIRLTFNQD-GPQSHEDDSAGIAVQDAKPTLQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  +ML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LEAFFNLNRELATKVMLAVHTEGRAVCGLFTRDIAETKAAQVNQYARESQHPLLCEIEKD 119


>gi|291613434|ref|YP_003523591.1| ATP-dependent Clp protease adaptor protein ClpS [Sideroxydans
           lithotrophicus ES-1]
 gi|291583546|gb|ADE11204.1| ATP-dependent Clp protease adaptor protein ClpS [Sideroxydans
           lithotrophicus ES-1]
          Length = 100

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 43/95 (45%), Positives = 65/95 (68%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             +  +   SK + PKLY+V+L+ND++T MEFVI VL+ FF    E A  +ML++H++G 
Sbjct: 5   QENVNLLERSKTKPPKLYKVILLNDDFTTMEFVIEVLRIFFSMGQERATQVMLQIHNEGS 64

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             CGVY  +IAE KV+QV  +++QH +PL+C  E+
Sbjct: 65  AVCGVYPKDIAETKVSQVSEFAKQHGHPLRCQTEE 99


>gi|145299397|ref|YP_001142238.1| ATP-dependent Clp protease adaptor protein ClpS [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|158514051|sp|A4SNL8|CLPS_AERS4 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|142852169|gb|ABO90490.1| ATP-dependent Clp protease adaptor protein ClpS [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 105

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 62/93 (66%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           +      +K++ P +Y+V+L ND+YTPMEFV+ VLQ FF  D + A  +ML VH+ G G 
Sbjct: 12  EIAQAEKTKLQPPPMYKVVLNNDDYTPMEFVVEVLQKFFGMDLDKATQVMLSVHYSGKGV 71

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           CG +  EIAE KV QV  YSR +++PL C ME+
Sbjct: 72  CGTFTAEIAETKVVQVNTYSRNNEHPLLCTMEK 104


>gi|90021331|ref|YP_527158.1| ATP-dependent Clp protease adaptor protein ClpS [Saccharophagus
           degradans 2-40]
 gi|89950931|gb|ABD80946.1| ATP-dependent Clp protease adaptor protein ClpS [Saccharophagus
           degradans 2-40]
          Length = 124

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 38/104 (36%), Positives = 66/104 (63%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
            +       +   +      +++ P +Y+V+++ND+YTPMEFV+ VL+ FF  + E+A  
Sbjct: 13  KESDEDTTFDGGVAVQAEKPRLKRPPMYKVVMLNDDYTPMEFVVEVLELFFSMNRESATR 72

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           IML+VH +G   CGV++ ++AE K  QV  Y++Q+++PL C +E
Sbjct: 73  IMLRVHTEGKAVCGVFSRDVAETKAAQVNQYAKQNEHPLLCEIE 116


>gi|153864221|ref|ZP_01997190.1| ATP-dependent Clp protease adaptor protein ClpS [Beggiatoa sp. SS]
 gi|152146285|gb|EDN72811.1| ATP-dependent Clp protease adaptor protein ClpS [Beggiatoa sp. SS]
          Length = 106

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 44/96 (45%), Positives = 66/96 (68%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           +          K++ P LY+V+L+ND+YTPM+FV+HVL+NFF  + + A  +ML+VH +G
Sbjct: 10  DDDVVVEETKPKLKRPPLYKVVLLNDDYTPMDFVVHVLENFFGMNQDLANHVMLQVHLEG 69

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CG Y  ++AE KV QV  Y+R++Q+PL C ME+
Sbjct: 70  KGICGTYTRDVAETKVTQVNTYARENQHPLLCTMEK 105


>gi|28870518|ref|NP_793137.1| hypothetical protein PSPTO_3354 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213970047|ref|ZP_03398179.1| hypothetical protein PSPTOT1_5283 [Pseudomonas syringae pv. tomato
           T1]
 gi|301381402|ref|ZP_07229820.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. tomato Max13]
 gi|302058400|ref|ZP_07249941.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. tomato K40]
 gi|302130351|ref|ZP_07256341.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|37077076|sp|Q87ZS0|CLPS_PSESM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|28853766|gb|AAO56832.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213925151|gb|EEB58714.1| hypothetical protein PSPTOT1_5283 [Pseudomonas syringae pv. tomato
           T1]
 gi|330965608|gb|EGH65868.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. actinidiae str. M302091]
 gi|331017259|gb|EGH97315.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 120

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 68/120 (56%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++       E D+   +       ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHAFSKIRLTFNQD-GPQSHEDDSAGIAVQDAKPTLQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  +ML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LEVFFNLNRELATKVMLAVHTEGRAVCGLFTRDIAETKAAQVNQYARESQHPLLCEIEKD 119


>gi|320323776|gb|EFW79860.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320327916|gb|EFW83921.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330881201|gb|EGH15350.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 120

 Score =  139 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 68/120 (56%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++ +     E D    +       +R P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHAFSKIRLTFNQDSP-QSHEDDAAGIAVQDAKPTLRAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  +ML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LEVFFNLNRELATKVMLAVHTEGRAVCGLFTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|323138622|ref|ZP_08073689.1| ATP-dependent Clp protease adaptor protein ClpS [Methylocystis sp.
           ATCC 49242]
 gi|322396110|gb|EFX98644.1| ATP-dependent Clp protease adaptor protein ClpS [Methylocystis sp.
           ATCC 49242]
          Length = 130

 Score =  139 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 71/106 (66%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
            +   +          +   + R P +YRVLL+ND+YT  EFV+ VL+ +F K  E A  
Sbjct: 25  REPRKSGDGAGTALITQARQQTRRPNMYRVLLLNDDYTTQEFVVIVLRKYFNKSVEEATR 84

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           IML VH+ G+GECGVY YE+AE KV QVM+++R+HQ+PLQCIME+K
Sbjct: 85  IMLHVHNHGVGECGVYTYEVAETKVTQVMDFARKHQHPLQCIMEKK 130


>gi|71735262|ref|YP_275268.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|257485425|ref|ZP_05639466.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|289625413|ref|ZP_06458367.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289649304|ref|ZP_06480647.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|298487537|ref|ZP_07005579.1| ATP-dependent Clp protease adaptor protein clpS [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|123635959|sp|Q48H65|CLPS_PSE14 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|71555815|gb|AAZ35026.1| ATP-dependent Clp protease adaptor protein clpS [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298157921|gb|EFH98999.1| ATP-dependent Clp protease adaptor protein clpS [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|330866850|gb|EGH01559.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. aesculi str. 0893_23]
 gi|330889671|gb|EGH22332.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. mori str. 301020]
 gi|331010739|gb|EGH90795.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 120

 Score =  139 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 68/120 (56%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++ +     E D    +       ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHAFSKIRLTFNQDSP-QSHEDDAAGIAVQDAKPTLQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  +ML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LEVFFNLNRELATKVMLAVHTEGRAVCGLFTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|153835790|ref|ZP_01988457.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio harveyi
           HY01]
 gi|156973856|ref|YP_001444763.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio harveyi
           ATCC BAA-1116]
 gi|269960956|ref|ZP_06175325.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio harveyi
           1DA3]
 gi|166214749|sp|A7N1L5|CLPS_VIBHB RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|148867478|gb|EDL66853.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio harveyi
           HY01]
 gi|156525450|gb|ABU70536.1| hypothetical protein VIBHAR_01566 [Vibrio harveyi ATCC BAA-1116]
 gi|269834175|gb|EEZ88265.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio harveyi
           1DA3]
          Length = 106

 Score =  139 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 52/98 (53%), Positives = 67/98 (68%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                D   R S+KV+ PKLY V+L ND+YTPM+FVI VL+ FF  D + A  IMLK+H+
Sbjct: 8   VTPDSDLLERESTKVQPPKLYNVVLNNDDYTPMDFVIEVLERFFSHDIDKATQIMLKIHY 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CG Y+ EIAE KV QV  YSR++++PL C MEQ
Sbjct: 68  EGKAICGTYSAEIAETKVAQVTMYSRENEHPLLCTMEQ 105


>gi|58582177|ref|YP_201193.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|58426771|gb|AAW75808.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 126

 Score =  139 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 65/110 (59%)

Query: 28  ADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
             +    +  +   +          +V  P  Y+VLL+ND+YTPM+FV+ VL+ FF  + 
Sbjct: 16  PYNGRMPRNTSHEHDHGLMVEASKPEVAPPPRYQVLLLNDDYTPMDFVVTVLEQFFNLNL 75

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           E A  IML VH +G G CGVY+ E+AE KV QV  +SR +Q+PL C MEQ
Sbjct: 76  EQATQIMLHVHTRGRGVCGVYSREVAESKVAQVNEFSRMNQHPLLCTMEQ 125


>gi|237800558|ref|ZP_04589019.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|330958173|gb|EGH58433.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. maculicola str. ES4326]
 gi|331023418|gb|EGI03475.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 120

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 68/120 (56%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++       E D+   +       ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHAFSKIRLTFNQD-GPQSHEDDSAGIAVQDAKPTLQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  +ML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LEVFFNLNRELATKVMLAVHTEGRAVCGLFTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|315122668|ref|YP_004063157.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496070|gb|ADR52669.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 120

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 87/115 (75%), Positives = 105/115 (91%)

Query: 22  MSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN 81
           +SF+FMA + MN+KG+A  D+C++++   SSKVR P+LYRVLLVND+YTPMEFVIHVLQ 
Sbjct: 4   ISFVFMAKNHMNEKGVARTDSCINTKEEISSKVRAPRLYRVLLVNDDYTPMEFVIHVLQK 63

Query: 82  FFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           FF+KDHE++K IMLK+HHQGIGECGVYAYEIAEMKVNQVMNYSRQ+Q+PLQCIME
Sbjct: 64  FFHKDHESSKSIMLKIHHQGIGECGVYAYEIAEMKVNQVMNYSRQNQHPLQCIME 118


>gi|163802085|ref|ZP_02195981.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sp. AND4]
 gi|159174226|gb|EDP59034.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sp. AND4]
          Length = 106

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 52/98 (53%), Positives = 66/98 (67%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                D   R S+KV+ PKLY V+L ND+YTPM+FVI VL+ FF  D + A  IMLK+H+
Sbjct: 8   VTPDSDLLERESTKVQPPKLYNVVLNNDDYTPMDFVIEVLERFFSHDIDKATQIMLKIHY 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G   CG Y+ EIAE KV QV  YSR++++PL C MEQ
Sbjct: 68  DGKAICGTYSAEIAETKVAQVTMYSRENEHPLLCTMEQ 105


>gi|56459784|ref|YP_155065.1| ATP-dependent Clp protease adaptor protein ClpS [Idiomarina
           loihiensis L2TR]
 gi|67460203|sp|Q5R0C3|CLPS_IDILO RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|56178794|gb|AAV81516.1| Uncharacterized conserved protein [Idiomarina loihiensis L2TR]
          Length = 102

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 48/102 (47%), Positives = 71/102 (69%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++FD+   S+     +++ P +Y+V++ ND+YTPM+FVI VL  FF  D E A   ML+
Sbjct: 1   MSQFDHQHLSDTEEKQELKPPSMYKVIINNDDYTPMDFVIEVLMRFFKMDQERATDTMLQ 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           VH++G   CGVY+ EIAE KV QV  Y+R++Q+PL C MEQ+
Sbjct: 61  VHYKGKAVCGVYSAEIAETKVVQVNQYARENQHPLLCTMEQE 102


>gi|254474220|ref|ZP_05087611.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudovibrio sp.
           JE062]
 gi|211956750|gb|EEA91959.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudovibrio sp.
           JE062]
          Length = 109

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 56/91 (61%), Positives = 74/91 (81%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
            +   K + P LYRVLL+ND+YTPMEFVIHV++ FF+ D E+A  IML VHH G+GECGV
Sbjct: 19  TKPKPKTKRPSLYRVLLLNDDYTPMEFVIHVVERFFHLDRESATQIMLHVHHHGVGECGV 78

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 79  FTYEVAETKVTQVMDFARKHQHPLQCVMEKK 109


>gi|228312133|pdb|3G1B|A Chain A, The Structure Of The M53a Mutant Of Caulobacter Crescentus
           Clps Protease Adaptor Protein In Complex With Wlfvqrdske
           Peptide
 gi|228312134|pdb|3G1B|B Chain B, The Structure Of The M53a Mutant Of Caulobacter Crescentus
           Clps Protease Adaptor Protein In Complex With Wlfvqrdske
           Peptide
 gi|290789973|pdb|3G3P|A Chain A, The Structure Of The M53a Mutant Of The Caulobacter
           Crescentus Clps In Complex With A Peptide Containing An
           Amino-Terminal Norleucine Residue
 gi|290789974|pdb|3G3P|B Chain B, The Structure Of The M53a Mutant Of The Caulobacter
           Crescentus Clps In Complex With A Peptide Containing An
           Amino-Terminal Norleucine Residue
          Length = 85

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 49/85 (57%), Positives = 64/85 (75%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
            + P LYRVL++ND+YTP EFV++VL+ FF K  E A  IML VH  G+G CGVY YE+A
Sbjct: 1   TQKPSLYRVLILNDDYTPAEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVA 60

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQK 138
           E KV QV++ +R+HQ+PLQC ME+ 
Sbjct: 61  ETKVAQVIDSARRHQHPLQCTMEKD 85


>gi|66046413|ref|YP_236254.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. syringae B728a]
 gi|302185010|ref|ZP_07261683.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. syringae 642]
 gi|75501532|sp|Q4ZRK6|CLPS_PSEU2 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|63257120|gb|AAY38216.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. syringae B728a]
 gi|330972894|gb|EGH72960.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 120

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 69/120 (57%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++ + +   +    +  +      ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHAFSKIRLTFNQDDPQSHEDDSAGIAVQ-DAKPTLQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  +ML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LEVFFNLNRELATKVMLAVHTEGRAVCGLFTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|330900612|gb|EGH32031.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. japonica str. M301072PT]
 gi|330940301|gb|EGH43421.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. pisi str. 1704B]
 gi|330981384|gb|EGH79487.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 120

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 69/120 (57%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++ + +   +    +  +      ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHAFSKIRLTFNQDDPQSHEDDSAGIAVQ-DAKPALQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  +ML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LEVFFNLNRELATKVMLAVHTEGRAVCGLFTRDIAETKAMQVNQYARESQHPLLCEIEKD 119


>gi|209695650|ref|YP_002263579.1| ATP-dependent Clp protease adaptor protein ClpS [Aliivibrio
           salmonicida LFI1238]
 gi|238066649|sp|B6EIX3|CLPS_ALISL RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|208009602|emb|CAQ79898.1| ATP-dependent Clp protease adaptor protein ClpS [Aliivibrio
           salmonicida LFI1238]
          Length = 106

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 61/97 (62%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D      + ++ P +Y+V+L ND+YTPMEFV+ VL  FF  D E A  +ML VH++
Sbjct: 9   SPDSDVLELEKTGLKPPPMYKVVLNNDDYTPMEFVVEVLDKFFSMDLEKATQLMLTVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV QV  YSR +++PL C MEQ
Sbjct: 69  GKAVCGVFTAEVAETKVAQVNIYSRDNEHPLLCTMEQ 105


>gi|330829987|ref|YP_004392939.1| ATP-dependent Clp protease adapter protein clpS [Aeromonas veronii
           B565]
 gi|328805123|gb|AEB50322.1| ATP-dependent Clp protease adapter protein clpS [Aeromonas veronii
           B565]
          Length = 105

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 63/93 (67%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           +      +K++ P +Y+V+L ND+YTPMEFV+ VLQ FF  D + A  +ML VH+ G G 
Sbjct: 12  EIAEAEKTKLQPPPMYKVVLNNDDYTPMEFVVEVLQKFFGMDLDKATQVMLSVHYSGKGV 71

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           CG++  EIAE KV QV  Y+R +++PL C ME+
Sbjct: 72  CGMFTAEIAETKVVQVNTYARNNEHPLLCTMEK 104


>gi|330954576|gb|EGH54836.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae Cit 7]
          Length = 120

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 69/120 (57%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++ + +   +    +  +      ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHAFSKIRLTFNQDDPQSHEDDSAGIAVQ-DAKPTLQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  +ML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 60  LEVFFNLNRELATKVMLAVHTEGRAVCGLFTRDIAETKAMQVNQYAREGQHPLLCEIEKD 119


>gi|262274511|ref|ZP_06052322.1| ATP-dependent Clp protease adaptor protein ClpS [Grimontia hollisae
           CIP 101886]
 gi|262221074|gb|EEY72388.1| ATP-dependent Clp protease adaptor protein ClpS [Grimontia hollisae
           CIP 101886]
          Length = 106

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 67/96 (69%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              D +    +K++ P LY+V+L ND+YTPMEFV+ VLQ FF  D + A  +ML VH++G
Sbjct: 10  PDSDVKEAEETKLKPPSLYKVVLNNDDYTPMEFVVEVLQRFFSMDIDKATQLMLTVHYEG 69

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
              CG+Y  E+AEMKV QVM Y+++HQ+PL C ME+
Sbjct: 70  RAVCGIYTAEVAEMKVAQVMMYAKEHQHPLLCTMEK 105


>gi|197284584|ref|YP_002150456.1| ATP-dependent Clp protease adaptor protein [Proteus mirabilis
           HI4320]
 gi|227356766|ref|ZP_03841151.1| ATP-dependent Clp protease adaptor protein [Proteus mirabilis ATCC
           29906]
 gi|194682071|emb|CAR41609.1| ATP-dependent Clp protease adaptor protein [Proteus mirabilis
           HI4320]
 gi|227163056|gb|EEI47991.1| ATP-dependent Clp protease adaptor protein [Proteus mirabilis ATCC
           29906]
          Length = 104

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/96 (44%), Positives = 62/96 (64%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
                  + S     P +Y+V+L ND+YTPM+FV+ VL  +F+ + E A  IML VHH+G
Sbjct: 8   TETTLGEKVSQLNEPPAMYKVILNNDDYTPMDFVVEVLTMYFFLNEEKATQIMLDVHHKG 67

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CGVY+ +IAE KV QV  Y+R++ +PL C +E+
Sbjct: 68  KGVCGVYSADIAETKVAQVNQYARENGHPLLCTLEK 103


>gi|296135869|ref|YP_003643111.1| ATP-dependent Clp protease adaptor protein ClpS [Thiomonas
           intermedia K12]
 gi|294340063|emb|CAZ88431.1| ATP-dependent Clp protease adaptor protein clpS [Thiomonas sp. 3As]
 gi|295795991|gb|ADG30781.1| ATP-dependent Clp protease adaptor protein ClpS [Thiomonas
           intermedia K12]
          Length = 108

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 32  MNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
           M+        +     V   + +++ P +Y+V+L+NDN+TPMEFV+ V+Q++F KD ETA
Sbjct: 1   MSASHSPPPADGGAVVVERQTLRLKPPAMYQVILLNDNFTPMEFVVVVIQHYFNKDRETA 60

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
             IMLKVH  G G CGVY  +IA  KV QV+  +RQ  +PLQC+ME
Sbjct: 61  TQIMLKVHRDGRGVCGVYTRDIAATKVEQVIGAARQAGHPLQCVME 106


>gi|255020026|ref|ZP_05292099.1| ATP-dependent Clp protease adaptor protein ClpS [Acidithiobacillus
           caldus ATCC 51756]
 gi|254970555|gb|EET28044.1| ATP-dependent Clp protease adaptor protein ClpS [Acidithiobacillus
           caldus ATCC 51756]
          Length = 102

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/102 (46%), Positives = 68/102 (66%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +          +    +++ P  YRVLL+ND++TPM++V+ VLQ +F+K HE A  IML+
Sbjct: 1   MPSRKEHRQPLLEREPRLKEPSRYRVLLLNDDFTPMDYVVQVLQQYFHKTHEEAVQIMLE 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           VHH G G CGVY Y++AE KV  V   +RQHQ+PL+C ME++
Sbjct: 61  VHHSGRGICGVYPYDMAETKVALVTADARQHQHPLRCTMEKE 102


>gi|86139108|ref|ZP_01057679.1| ATP-dependent Clp protease, adaptor protein ClpS [Roseobacter sp.
           MED193]
 gi|85824339|gb|EAQ44543.1| ATP-dependent Clp protease, adaptor protein ClpS [Roseobacter sp.
           MED193]
          Length = 114

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 45/90 (50%), Positives = 64/90 (71%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
           +   K + P  Y+VLL+ND+YTPMEFV+ VL+ FF   H  +  IML VH +G+   GV+
Sbjct: 24  KTRPKTQRPPRYKVLLLNDDYTPMEFVVMVLERFFGMTHAQSFEIMLTVHKKGVAVVGVF 83

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +EIAE KV QVM+++ +HQ+PLQC ME++
Sbjct: 84  THEIAETKVAQVMDFANRHQHPLQCTMEKE 113


>gi|330987929|gb|EGH86032.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 120

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 67/120 (55%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +   S I +  ++ +     E D    +       ++ P +Y+V+L ND+YTPM+FV+ V
Sbjct: 1   MHAFSKIRLTFNQDSP-QSHEDDAAGIAVQDAKPTLQAPPMYKVVLFNDDYTPMDFVVEV 59

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ FF  + E A  +ML VH +G   CG++  +IAE K  QV  Y+R+ Q+PL C  E+ 
Sbjct: 60  LEVFFNLNRELATKVMLAVHTEGRAVCGLFTRDIAETKAMQVNQYARESQHPLLCETEKD 119


>gi|90579120|ref|ZP_01234930.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio angustum
           S14]
 gi|90439953|gb|EAS65134.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio angustum
           S14]
          Length = 106

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 64/97 (65%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D   +   +V+ P +Y+V+L ND+YTPM+FVI VLQ FF  D E A  +ML VH++
Sbjct: 9   SPDSDILEKEEIQVKPPSMYKVILNNDDYTPMDFVIEVLQTFFSMDLEKAAQLMLAVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG +  E+AE KV QVM Y+R+H++PL C ME+
Sbjct: 69  GKAICGTFTAEVAETKVAQVMMYAREHEHPLLCTMEK 105


>gi|307822307|ref|ZP_07652539.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacter
           tundripaludum SV96]
 gi|307736873|gb|EFO07718.1| ATP-dependent Clp protease adaptor protein ClpS [Methylobacter
           tundripaludum SV96]
          Length = 107

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 67/102 (65%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
              +  +   +      K++ P LY+V+L+ND++TPM+FVI +L +FF    E A  +ML
Sbjct: 5   DPFKDKDGGLAVQEAKPKLKRPPLYKVILLNDDFTPMDFVIEILMDFFAMSEEKATQVML 64

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +VH QG+G CG+Y+ ++AE KV  V +YSR+H +PL C ME+
Sbjct: 65  QVHTQGVGVCGMYSKDVAETKVYIVNDYSREHHHPLMCSMEE 106


>gi|88798703|ref|ZP_01114286.1| substrate modulator for ClpAP, directs protease activity towards
           aggregated proteins [Reinekea sp. MED297]
 gi|88778466|gb|EAR09658.1| substrate modulator for ClpAP, directs protease activity towards
           aggregated proteins [Reinekea sp. MED297]
          Length = 113

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 32  MNKKGIAEFDNCLDSEVRF-SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
           M     +  +   D   +    +++ P LYRV+L+ND+YTPMEFV+H+L+ FF  + E A
Sbjct: 1   MGDDDQSSREGEGDVAFQTADPELKRPSLYRVVLLNDDYTPMEFVVHILEQFFAMNREKA 60

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             +ML VH QG G CGVY  +IAE K   V +YSR++Q+PL C +E+
Sbjct: 61  TQVMLAVHTQGKGVCGVYTKDIAETKAALVNDYSRENQHPLLCEVEE 107


>gi|329298246|ref|ZP_08255582.1| ATP-dependent Clp protease adaptor protein ClpS [Plautia stali
           symbiont]
          Length = 106

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/91 (51%), Positives = 64/91 (70%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E +    ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +MLKVH+ G   CG
Sbjct: 15  EDKVREGLKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDVERATQLMLKVHYHGKAICG 74

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           V+  E+AE KV QV NY+R++Q+PL C +E+
Sbjct: 75  VFTAEVAETKVAQVNNYARENQHPLLCTLEK 105


>gi|78047604|ref|YP_363779.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|78036034|emb|CAJ23725.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 128

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 69/110 (62%), Gaps = 1/110 (0%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRF-SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
           + RM +    E ++     V     +V  P  Y+VLL+ND+YTPM+FV+ VL+ FF  + 
Sbjct: 18  NGRMPRNTSHEHEHDHGLMVEASKPEVAPPPRYQVLLLNDDYTPMDFVVTVLEQFFNLNL 77

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           E A  IML VH +G G CGVY+ E+AE KV QV  +SR +Q+PL C MEQ
Sbjct: 78  EQATQIMLHVHTRGRGVCGVYSREVAESKVAQVNEFSRMNQHPLLCTMEQ 127


>gi|330446454|ref|ZP_08310106.1| specificity factor for ClpA-ClpP chaperone-protease complex
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328490645|dbj|GAA04603.1| specificity factor for ClpA-ClpP chaperone-protease complex
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 106

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 63/97 (64%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D       +V+ P +Y+V+L ND+YTPM+FVI VLQ FF  D E A  +ML VH++
Sbjct: 9   SPDSDILEEEEIQVKPPSMYKVILNNDDYTPMDFVIDVLQTFFSMDLEKAAQLMLAVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG +  E+AE KV QVM Y+R+H++PL C ME+
Sbjct: 69  GKAVCGTFTAEVAETKVAQVMMYAREHEHPLLCTMEK 105


>gi|326388617|ref|ZP_08210210.1| ATP-dependent Clp protease adaptor protein ClpS [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206868|gb|EGD57692.1| ATP-dependent Clp protease adaptor protein ClpS [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 118

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/95 (48%), Positives = 71/95 (74%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                +   ++ + P ++RVL++ND+YTPMEFV+ VL+ FF+ D E A  +ML VH +G+
Sbjct: 23  DGLVGIATRARPKKPSMFRVLMLNDDYTPMEFVVMVLKRFFHMDLEQATRVMLHVHQRGV 82

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGV+ YEIAE KVNQVM++++Q+Q+PL+C +E+
Sbjct: 83  GVCGVFPYEIAETKVNQVMDFAKQNQHPLRCTLEK 117


>gi|89073385|ref|ZP_01159909.1| ATP-dependent Clp protease adaptor protein ClpS [Photobacterium sp.
           SKA34]
 gi|89050872|gb|EAR56346.1| ATP-dependent Clp protease adaptor protein ClpS [Photobacterium sp.
           SKA34]
          Length = 106

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 63/97 (64%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D       +V+ P +Y+V+L ND+YTPM+FVI VLQ FF  D E A  +ML VH++
Sbjct: 9   SPDSDILEEEEIQVKPPSMYKVILNNDDYTPMDFVIEVLQTFFSMDLEKAAQLMLAVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG +  E+AE KV QVM Y+R+H++PL C ME+
Sbjct: 69  GKAICGTFTAEVAETKVAQVMMYAREHEHPLLCTMEK 105


>gi|330719866|gb|EGG98352.1| ATP-dependent Clp protease adaptor protein ClpS [gamma
           proteobacterium IMCC2047]
          Length = 131

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 42/103 (40%), Positives = 65/103 (63%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
               + D+   +  +   K++ P +Y+V++ ND+YTPM+FV+ +L++FF  + E A  IM
Sbjct: 27  NHDHQGDDGNLAVEQAKPKLKPPPMYKVVMYNDDYTPMDFVVEILESFFNLNREKATQIM 86

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L VH QG   CGV+  +IAE KV QV  YS  +++PL C M+Q
Sbjct: 87  LTVHTQGKAVCGVFTRDIAETKVTQVNQYSSDNEHPLLCGMDQ 129


>gi|10442011|gb|AAG17283.1|AF254897_2 YljA [Bradyrhizobium japonicum USDA 110]
          Length = 97

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 73/97 (75%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
                  +   K + P LYRVL++ND+YTPMEFV+HVL+ FF KD E A  IML VHH G
Sbjct: 1   PNTSVITKVKPKTKRPNLYRVLILNDDYTPMEFVVHVLEKFFQKDVEAATKIMLHVHHHG 60

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           IGECGV+ YEIAE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 61  IGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK 97


>gi|49474301|ref|YP_032343.1| hypothetical protein BQ07060 [Bartonella quintana str. Toulouse]
 gi|49239805|emb|CAF26195.1| hypothetical protein BQ07060 [Bartonella quintana str. Toulouse]
          Length = 123

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 58/128 (45%), Positives = 79/128 (61%), Gaps = 7/128 (5%)

Query: 9   MYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDN 68
           M  ++  + IL +M            K   E  +      +  SK++ PKLYRV L ND+
Sbjct: 1   MLQKLMTNSILRIM-------QNEKGKNWDESRHDAVIIPKMRSKLQKPKLYRVFLFNDD 53

Query: 69  YTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQ 128
           YTPM+FV+ VL+NFF K  E A  IML VH  G+GECG+Y+YE+AEMKV QV   + Q++
Sbjct: 54  YTPMDFVVFVLKNFFKKSFEEATHIMLNVHQNGVGECGIYSYEVAEMKVIQVRECAHQNE 113

Query: 129 YPLQCIME 136
           +PLQC+ME
Sbjct: 114 HPLQCVME 121


>gi|86146449|ref|ZP_01064772.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sp. MED222]
 gi|218709067|ref|YP_002416688.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio splendidus
           LGP32]
 gi|254763826|sp|B7VM32|CLPS_VIBSL RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|85835712|gb|EAQ53847.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sp. MED222]
 gi|218322086|emb|CAV18173.1| ATP-dependent Clp protease adaptor protein clpS [Vibrio splendidus
           LGP32]
          Length = 106

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D   +  +KV+ P +Y V+L ND+YTPM+FVI +L+ FF  D E A  +MLKVH++
Sbjct: 9   SPGSDLLEKERTKVKPPAMYNVVLHNDDYTPMDFVIEILERFFSLDIEKATEVMLKVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG Y+ EIAE KV QV  YS+++++PL C MEQ
Sbjct: 69  GKAICGTYSAEIAETKVAQVTMYSKENEHPLLCTMEQ 105


>gi|109898690|ref|YP_661945.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudoalteromonas
           atlantica T6c]
 gi|123064521|sp|Q15T97|CLPS_PSEA6 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|109700971|gb|ABG40891.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudoalteromonas
           atlantica T6c]
 gi|332173682|gb|AEE22936.1| ATP-dependent Clp protease adaptor protein ClpS [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 106

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 65/106 (61%), Gaps = 1/106 (0%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+K      +     +     K+  P +Y+VLL ND+YTPM+FVI VL  FF  D E A 
Sbjct: 1   MSKDNTINIEREKQLDT-VKQKLAPPPMYKVLLNNDDYTPMDFVIEVLVRFFNLDSEKAH 59

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IML VH++G   CGVY  EIAE KV QV  Y+++HQ+PL C MEQ
Sbjct: 60  QIMLTVHYRGRAVCGVYTAEIAETKVMQVTQYAKKHQHPLMCTMEQ 105


>gi|325915388|ref|ZP_08177705.1| hypothetical protein XVE_1596 [Xanthomonas vesicatoria ATCC 35937]
 gi|325538435|gb|EGD10114.1| hypothetical protein XVE_1596 [Xanthomonas vesicatoria ATCC 35937]
          Length = 126

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 55/109 (50%), Positives = 71/109 (65%), Gaps = 1/109 (0%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
           + RM +K   E D+ L  E     +V  P  Y+VLL+ND+YTPM+FV+ VLQ FF  D E
Sbjct: 18  NGRMPRKTSHEHDHGLTVEA-SKPEVAPPPRYQVLLLNDDYTPMDFVVTVLQQFFNLDLE 76

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            A  +ML VH +G G CGVY+ E+AE KV QV  +SR +Q+PL C MEQ
Sbjct: 77  RATQVMLHVHTRGRGVCGVYSREVAESKVAQVNEFSRMNQHPLLCTMEQ 125


>gi|227112014|ref|ZP_03825670.1| ATP-dependent Clp protease adaptor protein ClpS [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
 gi|253688098|ref|YP_003017288.1| ATP-dependent Clp protease adaptor protein ClpS [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|261821257|ref|YP_003259363.1| ATP-dependent Clp protease adaptor protein ClpS [Pectobacterium
           wasabiae WPP163]
 gi|259491248|sp|C6DF43|CLPS_PECCP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|251754676|gb|ACT12752.1| ATP-dependent Clp protease adaptor protein ClpS [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|261605270|gb|ACX87756.1| ATP-dependent Clp protease adaptor protein ClpS [Pectobacterium
           wasabiae WPP163]
          Length = 106

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 65/104 (62%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                   +   +  +   K++ P +Y V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GNNSTWSQSENLTADKQKEKLQPPSMYNVVLNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+QG   CGV++ E+AE KV QV  Y+R++++PL C +E+
Sbjct: 62  MLTVHYQGKAICGVFSAEVAETKVVQVNRYARENEHPLLCTLEK 105


>gi|170727045|ref|YP_001761071.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella woodyi
           ATCC 51908]
 gi|238688675|sp|B1KIC5|CLPS_SHEWM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|169812392|gb|ACA86976.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella woodyi
           ATCC 51908]
          Length = 102

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 65/92 (70%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E R  S+V  P +Y+V+L ND+YTPM+FVI VLQ FF K  E A  IML +HHQG G C
Sbjct: 10  VEERVESEVMPPSMYKVILNNDDYTPMDFVIEVLQLFFKKTEEQATDIMLAIHHQGKGIC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G++ + IAE KV QV  ++RQ+Q+PL C +E+
Sbjct: 70  GIFPFGIAETKVAQVNQFARQNQHPLLCSLEK 101


>gi|157375024|ref|YP_001473624.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           sediminis HAW-EB3]
 gi|189082481|sp|A8FUH3|CLPS_SHESH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|157317398|gb|ABV36496.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           sediminis HAW-EB3]
          Length = 102

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 66/92 (71%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E R  S++  P +Y+V+L ND+YTPM+FVI VLQ FF K+ + A  IML +H+QG G C
Sbjct: 10  VEERVESELMPPPMYKVILNNDDYTPMDFVIEVLQLFFKKNEQDATDIMLAIHNQGKGIC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           GV+ + IAE KV QV  ++RQ+Q+PL C +E+
Sbjct: 70  GVFPFGIAETKVAQVNQFARQNQHPLLCSLEK 101


>gi|253999942|ref|YP_003052005.1| ATP-dependent Clp protease adaptor protein ClpS [Methylovorus sp.
           SIP3-4]
 gi|253986621|gb|ACT51478.1| ATP-dependent Clp protease adaptor protein ClpS [Methylovorus sp.
           SIP3-4]
          Length = 103

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 49/95 (51%), Positives = 70/95 (73%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 + +++ + P +Y+V+L+ND+YTPMEFV+ V+Q FF K  E A  IMLKVH +G 
Sbjct: 8   EGIVTEKQTARPKPPSMYKVILLNDDYTPMEFVVEVIQRFFNKSREQATQIMLKVHTEGA 67

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGVY ++IAE KVNQV+ Y+R++Q+PLQC ME+
Sbjct: 68  GICGVYPHDIAETKVNQVLGYAREYQHPLQCAMEE 102


>gi|262372530|ref|ZP_06065809.1| substrate modulator for ClpAP [Acinetobacter junii SH205]
 gi|262312555|gb|EEY93640.1| substrate modulator for ClpAP [Acinetobacter junii SH205]
          Length = 136

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 45/103 (43%), Positives = 68/103 (66%), Gaps = 1/103 (0%)

Query: 37  IAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
            +  D+  +  V+ +  +++ P LY V+L+ND+YTPM+FVI +LQ++F  D + A  +ML
Sbjct: 33  DSHEDHEGEVVVQTAPPELKRPPLYAVVLLNDDYTPMDFVIEILQSYFGMDFDQASQVML 92

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            VH++G G  GVY  +IAE K NQV NY+R   +PL C +E K
Sbjct: 93  TVHYEGKGTAGVYPRDIAETKANQVNNYARSQGHPLLCQIEPK 135


>gi|59712373|ref|YP_205149.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio fischeri
           ES114]
 gi|197335290|ref|YP_002156588.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio fischeri
           MJ11]
 gi|67460142|sp|Q5E3Y5|CLPS_VIBF1 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238690298|sp|B5FG65|CLPS_VIBFM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|59480474|gb|AAW86261.1| specificity factor for ClpA-ClpP chaperone-protease complex [Vibrio
           fischeri ES114]
 gi|197316780|gb|ACH66227.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio fischeri
           MJ11]
          Length = 106

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 62/97 (63%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D   +  +++R P +Y+V+L ND+YTPMEFV+ VL  FF  D E A  +ML VH++
Sbjct: 9   SPDSDVLEQEKTELRPPSMYKVVLNNDDYTPMEFVVEVLDKFFSMDLEKATQLMLTVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG +  E+AE KV QV  YSR +++PL C MEQ
Sbjct: 69  GKAVCGTFTAEVAETKVAQVNTYSRDNEHPLLCTMEQ 105


>gi|227329247|ref|ZP_03833271.1| ATP-dependent Clp protease adaptor protein ClpS [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 106

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 45/89 (50%), Positives = 63/89 (70%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
           +   K++ P +Y V+L ND+YTPMEFVI VLQ FF  D E A  +ML VH+QG   CGV+
Sbjct: 17  KQKEKLQPPSMYNVVLNNDDYTPMEFVIDVLQKFFSYDIERATQLMLTVHYQGKAICGVF 76

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           + E+AE KV QV  Y+R++++PL C +E+
Sbjct: 77  SAEVAETKVVQVNRYARENEHPLLCTLEK 105


>gi|188576738|ref|YP_001913667.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188576929|ref|YP_001913858.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|325927856|ref|ZP_08189080.1| hypothetical protein XPE_3120 [Xanthomonas perforans 91-118]
 gi|188521190|gb|ACD59135.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188521381|gb|ACD59326.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|325541696|gb|EGD13214.1| hypothetical protein XPE_3120 [Xanthomonas perforans 91-118]
          Length = 93

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 61/87 (70%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
             +V  P  Y+VLL+ND+YTPM+FV+ VL+ FF  + E A  IML VH +G G CGVY+ 
Sbjct: 6   KPEVAPPPRYQVLLLNDDYTPMDFVVTVLEQFFNLNLEQATQIMLHVHTRGRGVCGVYSR 65

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           E+AE KV QV  +SR +Q+PL C MEQ
Sbjct: 66  EVAESKVAQVNEFSRMNQHPLLCTMEQ 92


>gi|126641956|ref|YP_001084940.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter
           baumannii ATCC 17978]
 gi|169633633|ref|YP_001707369.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter
           baumannii SDF]
 gi|169795754|ref|YP_001713547.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter
           baumannii AYE]
 gi|213157554|ref|YP_002319599.1| ATP-dependent Clp protease adaptor protein [Acinetobacter baumannii
           AB0057]
 gi|215483239|ref|YP_002325446.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Acinetobacter baumannii AB307-0294]
 gi|239503974|ref|ZP_04663284.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter
           baumannii AB900]
 gi|260554817|ref|ZP_05827038.1| substrate modulator for ClpAP [Acinetobacter baumannii ATCC 19606]
 gi|294837620|ref|ZP_06782303.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter sp.
           6013113]
 gi|294840916|ref|ZP_06785599.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter sp.
           6014059]
 gi|294856990|ref|ZP_06794759.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter sp.
           6013150]
 gi|301344683|ref|ZP_07225424.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter
           baumannii AB056]
 gi|301511220|ref|ZP_07236457.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter
           baumannii AB058]
 gi|301595568|ref|ZP_07240576.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter
           baumannii AB059]
 gi|126387840|gb|ABO12338.1| putative protease [Acinetobacter baumannii ATCC 17978]
 gi|169148681|emb|CAM86547.1| substrate modulator for ClpAP, directs protease activity towards
           aggregated proteins [Acinetobacter baumannii AYE]
 gi|169152425|emb|CAP01380.1| substrate modulator for ClpAP, directs protease activity towards
           aggregated proteins [Acinetobacter baumannii]
 gi|213056714|gb|ACJ41616.1| ATP-dependent Clp protease adaptor protein [Acinetobacter baumannii
           AB0057]
 gi|213988872|gb|ACJ59171.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Acinetobacter baumannii AB307-0294]
 gi|260411359|gb|EEX04656.1| substrate modulator for ClpAP [Acinetobacter baumannii ATCC 19606]
 gi|322508668|gb|ADX04122.1| clpS [Acinetobacter baumannii 1656-2]
 gi|323518276|gb|ADX92657.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 137

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 65/109 (59%), Gaps = 1/109 (0%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET 89
                     D+  +  V+ +  +++ P LY V+L+ND+YTPM+FVI +LQ +F  + + 
Sbjct: 28  NPRLSDSQNEDHDGEVVVQTAPPELKRPPLYAVVLLNDDYTPMDFVIEILQQYFAMNLDQ 87

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           A  +ML VH++G G  GVY  +IAE K N V NY+R   +PL C +E K
Sbjct: 88  ATQVMLTVHYEGKGTAGVYPRDIAETKANLVNNYARSQGHPLLCQIEPK 136


>gi|226944902|ref|YP_002799975.1| ATP-dependent Clp protease adaptor protein ClpS [Azotobacter
           vinelandii DJ]
 gi|259491243|sp|C1DKZ8|CLPS_AZOVD RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|226719829|gb|ACO79000.1| ATP-dependent clp protease adaptor protein, ClpS [Azotobacter
           vinelandii DJ]
          Length = 120

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 64/106 (60%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
           ++    E D+           ++VP +Y+V++ ND+YTPM+FV+ VL+ FF  + E A  
Sbjct: 14  DRPEPREDDSYGVVVQESKPALKVPPMYKVVMFNDDYTPMDFVVEVLEKFFNLNRELATK 73

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +ML VH +G   CG++  ++AE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 74  VMLTVHTEGRAVCGMFTRDVAETKAMQVNQYARECQHPLLCEIEKD 119


>gi|88812888|ref|ZP_01128132.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrococcus
           mobilis Nb-231]
 gi|88789810|gb|EAR20933.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrococcus
           mobilis Nb-231]
          Length = 106

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 68/106 (64%), Gaps = 1/106 (0%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M++      +  L  + +   +V+ P LYRV+L+ND+YTPMEFV+ VLQ FF+ D   A 
Sbjct: 1   MSRDKAPRREGDLSVK-QAEPQVKRPPLYRVVLLNDDYTPMEFVVEVLQIFFHMDRGKAT 59

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IML VH +G G CGVY  ++AE KV+ V  ++R++ +PL C ME 
Sbjct: 60  QIMLHVHTRGKGVCGVYNRDVAETKVDLVNEHARKNDHPLMCTMEP 105


>gi|82703365|ref|YP_412931.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosospira
           multiformis ATCC 25196]
 gi|123544045|sp|Q2Y6T2|CLPS_NITMU RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|82411430|gb|ABB75539.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosospira
           multiformis ATCC 25196]
          Length = 102

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 69/97 (71%), Gaps = 1/97 (1%)

Query: 42  NCLDSEVR-FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           N  +  +    SK++ P +++V+L+ND++TPM+FV+ VLQ FF  + E A  IMLKVH  
Sbjct: 5   NHGEVVLEAKKSKLKPPPMFKVILLNDDFTPMDFVVTVLQTFFSMNREQATQIMLKVHMD 64

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G G CGVY  ++A  KV QV+ ++RQHQ+PLQC+ME+
Sbjct: 65  GAGVCGVYPNDVASTKVEQVVAFARQHQHPLQCVMEE 101


>gi|212709755|ref|ZP_03317883.1| hypothetical protein PROVALCAL_00803 [Providencia alcalifaciens DSM
           30120]
 gi|212687566|gb|EEB47094.1| hypothetical protein PROVALCAL_00803 [Providencia alcalifaciens DSM
           30120]
          Length = 106

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 62/100 (62%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
             F      +      ++ P +Y+VLL ND+YTPM+FV+ VLQ +F  D E A  IML V
Sbjct: 6   GTFKTDTIFKDEVEKALQPPSMYKVLLNNDDYTPMDFVVEVLQKYFSFDEERATQIMLDV 65

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H QG G CGVY  EIAE K  QV  ++R+H+YPL C +E+
Sbjct: 66  HFQGKGVCGVYTAEIAETKAAQVNAFAREHEYPLLCTIEK 105


>gi|158522493|ref|YP_001530363.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfococcus
           oleovorans Hxd3]
 gi|158511319|gb|ABW68286.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfococcus
           oleovorans Hxd3]
          Length = 104

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 44/96 (45%), Positives = 64/96 (66%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 +  ++V+ P LY+VLL ND+YT MEFV+ +L++ F K  E A  IML VH  G+
Sbjct: 9   QTGRLQKTGTRVKPPSLYKVLLHNDDYTTMEFVVEILRHIFRKSLEDATTIMLNVHRNGV 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G CG++ YEIAE K++ V  Y+R+  +PLQC ME++
Sbjct: 69  GCCGLFTYEIAETKIDLVHGYARERGFPLQCSMERE 104


>gi|21242744|ref|NP_642326.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|84624070|ref|YP_451442.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|289666027|ref|ZP_06487608.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas
           campestris pv. vasculorum NCPPB702]
 gi|289670485|ref|ZP_06491560.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas
           campestris pv. musacearum NCPPB4381]
 gi|294625258|ref|ZP_06703897.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|294666594|ref|ZP_06731833.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|24638421|sp|Q8PL06|CLPS_XANAC RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|67460158|sp|Q5GZR3|CLPS_XANOR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|123521875|sp|Q2P2Q9|CLPS_XANOM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|21108222|gb|AAM36862.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|84368010|dbj|BAE69168.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|292600432|gb|EFF44530.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292603614|gb|EFF47026.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 106

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 47/104 (45%), Positives = 64/104 (61%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
            +  +   +          +V  P  Y+VLL+ND+YTPM+FV+ VL+ FF  + E A  I
Sbjct: 2   PRNTSHEHDHGLMVEASKPEVAPPPRYQVLLLNDDYTPMDFVVTVLEQFFNLNLEQATQI 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH +G G CGVY+ E+AE KV QV  +SR +Q+PL C MEQ
Sbjct: 62  MLHVHTRGRGVCGVYSREVAESKVAQVNEFSRMNQHPLLCTMEQ 105


>gi|127512494|ref|YP_001093691.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella loihica
           PV-4]
 gi|166214745|sp|A3QD84|CLPS_SHELP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|126637789|gb|ABO23432.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella loihica
           PV-4]
          Length = 102

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 66/92 (71%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E R  +++  P +Y+V+L ND+YTPM+FVI VLQ FF K+ + A  IML +HHQG G C
Sbjct: 10  IEERAETELMPPSMYKVILNNDDYTPMDFVIEVLQLFFNKNEQEATDIMLAIHHQGKGIC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           GV+ + IAE KV QV  ++RQ+Q+PL C +E+
Sbjct: 70  GVFPFGIAETKVAQVNQFARQNQHPLLCSLEK 101


>gi|329894886|ref|ZP_08270685.1| ATP-dependent Clp protease adaptor protein ClpS [gamma
           proteobacterium IMCC3088]
 gi|328922615|gb|EGG29950.1| ATP-dependent Clp protease adaptor protein ClpS [gamma
           proteobacterium IMCC3088]
          Length = 113

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 32  MNKKGIAEFDNCLDSEVR-FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
           M+++   + D+     V      ++ P LY+V+L+ND+YTPMEFV+ VL+ FF  + E A
Sbjct: 1   MSEQHPDQHDDGTGLAVAPAKPALKKPPLYKVVLMNDDYTPMEFVVLVLERFFRMNREKA 60

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             IML VH QG G CG+Y  ++AE K  +V  +SR++Q+PL C +E 
Sbjct: 61  TQIMLAVHTQGKGVCGIYPRDVAETKAYEVNEFSRENQHPLLCEVEP 107


>gi|307946408|ref|ZP_07661743.1| ATP-dependent Clp protease adaptor protein ClpS [Roseibium sp.
           TrichSKD4]
 gi|307770072|gb|EFO29298.1| ATP-dependent Clp protease adaptor protein ClpS [Roseibium sp.
           TrichSKD4]
          Length = 110

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 75/93 (80%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
              R   K + P LYRVLL+ND+YTPMEFVIHV+++FF K+ E A  IML VHH G+GEC
Sbjct: 18  VVTRTKPKTKRPNLYRVLLLNDDYTPMEFVIHVVESFFQKNREEATHIMLHVHHHGVGEC 77

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G+Y+YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 78  GIYSYEVAETKVTQVMDFARKHQHPLQCVMEKK 110


>gi|328543445|ref|YP_004303554.1| ATP-dependent Clp protease adaptor protein ClpS [Polymorphum gilvum
           SL003B-26A1]
 gi|326413189|gb|ADZ70252.1| ATP-dependent Clp protease adaptor protein ClpS [Polymorphum gilvum
           SL003B-26A1]
          Length = 109

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 75/102 (73%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
             + D       +  +  + P LYRVLL+ND+YTPMEFVIHV++ FF K+ E A  IML 
Sbjct: 8   DEDADAGTVVVPKTRTVTKRPNLYRVLLLNDDYTPMEFVIHVVERFFQKNREEATRIMLH 67

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           VHH G+GECGVY YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 68  VHHHGVGECGVYTYEVAETKVTQVMDFARKHQHPLQCVMEKK 109


>gi|283832492|ref|ZP_06352233.1| ATP-dependent Clp protease adaptor protein ClpS [Citrobacter
           youngae ATCC 29220]
 gi|291072152|gb|EFE10261.1| ATP-dependent Clp protease adaptor protein ClpS [Citrobacter
           youngae ATCC 29220]
          Length = 106

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 66/97 (68%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D  L +E +    ++ P +Y+V+L+ND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDLLAEDKLRDALKPPSMYKVILINDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|167623651|ref|YP_001673945.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           halifaxensis HAW-EB4]
 gi|189082479|sp|B0TQ07|CLPS_SHEHH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|167353673|gb|ABZ76286.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           halifaxensis HAW-EB4]
          Length = 102

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 46/101 (45%), Positives = 69/101 (68%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           ++  +N    E    ++ + P +Y+V+L ND+YTPM+FVI +LQ FF KD + A  IML 
Sbjct: 1   MSRTENIEQIEESVEAEFKQPSMYKVILNNDDYTPMDFVIEILQLFFKKDEQQATEIMLA 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +HH+G G CG+Y + IAE KV QV  ++RQ+Q+PL C +E+
Sbjct: 61  IHHKGKGICGIYPFGIAETKVAQVNQFARQNQHPLLCSLEE 101


>gi|121604835|ref|YP_982164.1| ATP-dependent Clp protease adaptor protein ClpS [Polaromonas
           naphthalenivorans CJ2]
 gi|120593804|gb|ABM37243.1| ATP-dependent Clp protease adaptor protein ClpS [Polaromonas
           naphthalenivorans CJ2]
          Length = 145

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 47/128 (36%), Positives = 73/128 (57%), Gaps = 9/128 (7%)

Query: 19  LALMSFIFMADSRMNKKGIA--------EFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNY 69
           +++   I MA                  + +      +     K + P++Y+V+L+ND+Y
Sbjct: 16  ISMARMISMATKPPKSPAQPPTPAVKPADVNGGDSVVLERRPQKTKPPQMYQVVLLNDDY 75

Query: 70  TPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQY 129
           TPMEFV+ V+Q FF KD ETA  IMLK+H  G G CGV++ ++A  KV+QV   +R++ +
Sbjct: 76  TPMEFVVVVIQEFFNKDRETATQIMLKIHLDGKGICGVFSRDVAATKVDQVTEAARKNGH 135

Query: 130 PLQCIMEQ 137
           PLQC+ E 
Sbjct: 136 PLQCVSEP 143


>gi|37680507|ref|NP_935116.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio vulnificus
           YJ016]
 gi|320155836|ref|YP_004188215.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio vulnificus
           MO6-24/O]
 gi|326423943|ref|NP_760980.2| ATP-dependent Clp protease adaptor protein ClpS [Vibrio vulnificus
           CMCP6]
 gi|39930932|sp|Q7MJ40|CLPS_VIBVY RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|37199255|dbj|BAC95087.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
 gi|319931148|gb|ADV86012.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio vulnificus
           MO6-24/O]
 gi|319999322|gb|AAO10507.2| ATP-dependent Clp protease adaptor protein clpS [Vibrio vulnificus
           CMCP6]
          Length = 106

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D   +  ++++ PK Y V+L ND+YTPM+FVI VL+ FF  D + A  IMLKVH++
Sbjct: 9   TPDSDLLEKEITQIQPPKKYNVVLNNDDYTPMDFVIDVLERFFSHDLDKATQIMLKVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG Y+ EIAE KV QV  YSR++++PL C MEQ
Sbjct: 69  GKAICGTYSAEIAETKVAQVTMYSRENEHPLLCTMEQ 105


>gi|113969987|ref|YP_733780.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella sp.
           MR-4]
 gi|114047222|ref|YP_737772.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella sp.
           MR-7]
 gi|117920199|ref|YP_869391.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella sp.
           ANA-3]
 gi|123130486|sp|Q0HJP4|CLPS_SHESM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|123131487|sp|Q0HVZ0|CLPS_SHESR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214747|sp|A0KW16|CLPS_SHESA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|113884671|gb|ABI38723.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella sp.
           MR-4]
 gi|113888664|gb|ABI42715.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella sp.
           MR-7]
 gi|117612531|gb|ABK47985.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella sp.
           ANA-3]
          Length = 102

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 66/92 (71%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E R  S++  P +Y+V+L ND+YTPM+FVI VLQ FF K+ + A  IML +HHQG G C
Sbjct: 10  VEERVESELMPPSMYKVILNNDDYTPMDFVIEVLQIFFRKNEQEATDIMLTIHHQGKGIC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G++ Y IAE KV QV  ++RQ+Q+PL C +E+
Sbjct: 70  GIFPYGIAETKVIQVNQFARQNQHPLLCSLEK 101


>gi|91788801|ref|YP_549753.1| ATP-dependent Clp protease adaptor protein ClpS [Polaromonas sp.
           JS666]
 gi|91698026|gb|ABE44855.1| ATP-dependent Clp protease adaptor protein ClpS [Polaromonas sp.
           JS666]
          Length = 125

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 50/130 (38%), Positives = 75/130 (57%), Gaps = 9/130 (6%)

Query: 8   SMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVND 67
           SM  +  +   L     +           +   D+      R   K + P++Y+V+L+ND
Sbjct: 3   SMASKSPKSPALPPTPVVR-------PDEVNGGDSV--VLERRPQKTKPPQMYQVVLLND 53

Query: 68  NYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQH 127
           +YTPMEFV+ +LQ FF KDHETA  IMLK+H  G G CGV++ ++A  KV+QV   +R++
Sbjct: 54  DYTPMEFVVVILQEFFNKDHETATQIMLKIHLDGKGVCGVFSKDVAATKVDQVTEAARKN 113

Query: 128 QYPLQCIMEQ 137
            +PLQC+ E 
Sbjct: 114 GHPLQCVSEP 123


>gi|291295834|ref|YP_003507232.1| ATP-dependent Clp protease adaptor protein ClpS [Meiothermus ruber
           DSM 1279]
 gi|290470793|gb|ADD28212.1| ATP-dependent Clp protease adaptor protein ClpS [Meiothermus ruber
           DSM 1279]
          Length = 98

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 47/96 (48%), Positives = 62/96 (64%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
              ++ R  +  R P  Y+VLL+ND+YTPM+FV+ VL  +F K    A  IML+VHH G+
Sbjct: 3   DTATKTRSQTATRTPPRYKVLLLNDDYTPMDFVVEVLMRYFKKSKLEATRIMLQVHHAGV 62

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G  GVY +EIAE KVNQVM  +    +PLQC ME +
Sbjct: 63  GVAGVYPFEIAETKVNQVMAAASAEGHPLQCTMEPE 98


>gi|157962354|ref|YP_001502388.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           pealeana ATCC 700345]
 gi|189082480|sp|A8H5L6|CLPS_SHEPA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|157847354|gb|ABV87853.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           pealeana ATCC 700345]
          Length = 102

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 63/84 (75%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           ++ P +Y+V+L ND+YTPM+FVI +LQ FF KD + A  IML +HH+G G CG+Y + IA
Sbjct: 18  LKQPSMYKVILNNDDYTPMDFVIEILQLFFKKDEQQATEIMLAIHHKGKGICGIYPFGIA 77

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQ 137
           E KV QV  ++RQ+Q+PL C +E+
Sbjct: 78  ETKVAQVNQFARQNQHPLLCSLEE 101


>gi|317047538|ref|YP_004115186.1| ATP-dependent Clp protease adaptor protein ClpS [Pantoea sp. At-9b]
 gi|316949155|gb|ADU68630.1| ATP-dependent Clp protease adaptor protein ClpS [Pantoea sp. At-9b]
          Length = 131

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/91 (50%), Positives = 64/91 (70%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E +    ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +MLKVH+QG   CG
Sbjct: 40  EDKVREGLKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDVERATQLMLKVHYQGKAICG 99

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           V+  E+AE KV QV  Y+R++++PL C +E+
Sbjct: 100 VFTAEVAETKVAQVNIYARENEHPLLCTLEK 130


>gi|220904698|ref|YP_002480010.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219868997|gb|ACL49332.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 106

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 64/96 (66%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           N  +S+V    K++ P  YRVLL ND+YT M+FV+ VL + F K  + A  IML VH QG
Sbjct: 9   NDGESQVIVEKKLKEPDRYRVLLHNDDYTSMDFVVAVLCSIFNKTTQEATAIMLNVHQQG 68

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G+CGVY +E+AE KV +V   +R   +PL+C ME+
Sbjct: 69  VGQCGVYTHEVAETKVKRVHQAARAAGFPLKCTMEK 104


>gi|24374169|ref|NP_718212.1| hypothetical protein SO_2627 [Shewanella oneidensis MR-1]
 gi|37077213|sp|Q8EDW4|CLPS_SHEON RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|24348676|gb|AAN55656.1|AE015704_7 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 102

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 66/92 (71%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E R  S++  P +Y+V+L ND+YTPM+FVI VLQ FF K+ + A  IML +HHQG G C
Sbjct: 10  VEERVESELMPPSMYKVILNNDDYTPMDFVIEVLQIFFRKNEQEATDIMLTIHHQGKGIC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G++ + IAE KV QV  ++RQ+Q+PL C +E+
Sbjct: 70  GIFPFGIAETKVIQVNQFARQNQHPLLCSLEK 101


>gi|226954273|ref|ZP_03824737.1| protease [Acinetobacter sp. ATCC 27244]
 gi|294650477|ref|ZP_06727836.1| protease [Acinetobacter haemolyticus ATCC 19194]
 gi|226835001|gb|EEH67384.1| protease [Acinetobacter sp. ATCC 27244]
 gi|292823620|gb|EFF82464.1| protease [Acinetobacter haemolyticus ATCC 19194]
          Length = 130

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 62/110 (56%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
                     E             +++ P LY V+L+ND+YTPM+FVI VLQ++F  D +
Sbjct: 19  HLNPRLSDSHEEHEGEVVVQTAPPELKRPPLYAVVLMNDDYTPMDFVIEVLQSYFGMDFD 78

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            A  +ML VH++G G  G+Y  +IAE K NQV NY+R   +PL C +E +
Sbjct: 79  QASQVMLTVHYEGKGTAGIYPRDIAETKANQVNNYARSQGHPLLCQIEPE 128


>gi|262279297|ref|ZP_06057082.1| substrate modulator for ClpAP [Acinetobacter calcoaceticus RUH2202]
 gi|293607903|ref|ZP_06690206.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|299769891|ref|YP_003731917.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter sp.
           DR1]
 gi|262259648|gb|EEY78381.1| substrate modulator for ClpAP [Acinetobacter calcoaceticus RUH2202]
 gi|292828476|gb|EFF86838.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|298699979|gb|ADI90544.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter sp.
           DR1]
 gi|325122454|gb|ADY81977.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 137

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/105 (40%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 35  KGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                 D+  +  V+ +  +++ P LY V+L+ND+YTPM+FVI +LQ +F  + + A  +
Sbjct: 32  SDSQNEDHDGEVVVQTAPPELKRPPLYAVVLMNDDYTPMDFVIEILQQYFAMNLDQATQV 91

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           ML VH++G G  GVY  +IAE K N V NY+R   +PL C +E K
Sbjct: 92  MLTVHYEGKGIAGVYPRDIAETKANLVNNYARSQGHPLLCQIEPK 136


>gi|257095587|ref|YP_003169228.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257048111|gb|ACV37299.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 102

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/101 (45%), Positives = 66/101 (65%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +A             ++++ P LY+VLL+ND++TPM+FVI VLQ FF  D E A  IMLK
Sbjct: 1   MATKHQDSSLLEARPTQLKPPPLYKVLLLNDDFTPMDFVIVVLQRFFGMDREHATRIMLK 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VH +G G CGV+  ++A  KV QV  ++R +Q+PL C+ME+
Sbjct: 61  VHTEGRGVCGVFPRDVAATKVEQVTTFARSNQHPLACVMEE 101


>gi|289679172|ref|ZP_06500062.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudomonas
           syringae pv. syringae FF5]
          Length = 94

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 58/90 (64%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
                ++ P +Y+V+L ND+YTPM+FV+ VL+ FF  + E A  +ML VH +G   CG++
Sbjct: 4   DAKPALQAPPMYKVVLFNDDYTPMDFVVEVLEVFFNLNRELATKVMLAVHTEGRAVCGLF 63

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             +IAE K  QV  Y+R+ Q+PL C +E+ 
Sbjct: 64  TRDIAETKAMQVNQYARESQHPLLCEIEKD 93


>gi|229525754|ref|ZP_04415159.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           bv. albensis VL426]
 gi|229339335|gb|EEO04352.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           bv. albensis VL426]
          Length = 106

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 63/97 (64%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D   +  + V+ P +Y V+L ND+YTPM+FVI +L+ FF  D E A  +MLKVH++
Sbjct: 9   SPDFDLLEKEKTAVKPPSMYHVVLNNDDYTPMDFVIEILERFFSMDIERATQVMLKVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG +  E+AE KV QV  YSR++++PL C MEQ
Sbjct: 69  GKAICGTFTAEVAETKVAQVTRYSRENEHPLLCTMEQ 105


>gi|238792421|ref|ZP_04636055.1| ATP-dependent Clp protease adapter protein clpS [Yersinia
           intermedia ATCC 29909]
 gi|238728347|gb|EEQ19867.1| ATP-dependent Clp protease adapter protein clpS [Yersinia
           intermedia ATCC 29909]
          Length = 106

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 63/104 (60%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                  +     + +    ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GNNNDWLNFEHLVKDKQKEALKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+QG   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 62  MLNVHYQGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEK 105


>gi|228311827|pdb|2W9R|A Chain A, Structural Basis Of N-End Rule Substrate Recognition In
           Escherichia Coli By The Clpap Adaptor Protein Clps
 gi|228311836|pdb|2WA9|A Chain A, Structural Basis Of N-End Rule Substrate Recognition In
           Escherichia Coli By The Clpap Adaptor Protein Clps - Trp
           Peptide Structure
 gi|228311837|pdb|2WA9|B Chain B, Structural Basis Of N-End Rule Substrate Recognition In
           Escherichia Coli By The Clpap Adaptor Protein Clps - Trp
           Peptide Structure
 gi|228311838|pdb|2WA9|C Chain C, Structural Basis Of N-End Rule Substrate Recognition In
           Escherichia Coli By The Clpap Adaptor Protein Clps - Trp
           Peptide Structure
 gi|228311839|pdb|2WA9|D Chain D, Structural Basis Of N-End Rule Substrate Recognition In
           Escherichia Coli By The Clpap Adaptor Protein Clps - Trp
           Peptide Structure
 gi|228311840|pdb|2WA9|E Chain E, Structural Basis Of N-End Rule Substrate Recognition In
           Escherichia Coli By The Clpap Adaptor Protein Clps - Trp
           Peptide Structure
 gi|228311841|pdb|2WA9|F Chain F, Structural Basis Of N-End Rule Substrate Recognition In
           Escherichia Coli By The Clpap Adaptor Protein Clps - Trp
           Peptide Structure
 gi|228311842|pdb|2WA9|G Chain G, Structural Basis Of N-End Rule Substrate Recognition In
           Escherichia Coli By The Clpap Adaptor Protein Clps - Trp
           Peptide Structure
          Length = 108

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|119476169|ref|ZP_01616521.1| ATP-dependent Clp protease adaptor protein ClpS [marine gamma
           proteobacterium HTCC2143]
 gi|119450796|gb|EAW32030.1| ATP-dependent Clp protease adaptor protein ClpS [marine gamma
           proteobacterium HTCC2143]
          Length = 124

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/101 (37%), Positives = 58/101 (57%), Gaps = 1/101 (0%)

Query: 37  IAEFDNCLDSEV-RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
               +   D  V      ++ P +Y+V+L+ND+YTPMEFV+ +L+ FF    E A  +ML
Sbjct: 20  PPGNEGDGDLAVAELKPALKRPPMYKVVLLNDDYTPMEFVVEILETFFSMGREQATQVML 79

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
            VH  G G CG++  ++AE K  QV  Y+R+  +PL   +E
Sbjct: 80  AVHTHGKGVCGLFTRDVAETKAAQVNQYARESHHPLLAEVE 120


>gi|319787138|ref|YP_004146613.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465650|gb|ADV27382.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 108

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 44/87 (50%), Positives = 61/87 (70%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
             ++  P +Y+V+L+ND+YTPM+FV+ VLQ FF  D E A  +ML VH +G G CGV+  
Sbjct: 21  RPEIAPPPMYQVILLNDDYTPMDFVVAVLQQFFGLDLERATQVMLHVHTRGRGVCGVFTR 80

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           E+AE KV QV  +SR +Q+PL C ME+
Sbjct: 81  EVAESKVAQVNEFSRMNQHPLLCTMEK 107


>gi|261344322|ref|ZP_05971966.1| ATP-dependent Clp protease adaptor protein ClpS [Providencia
           rustigianii DSM 4541]
 gi|282567927|gb|EFB73462.1| ATP-dependent Clp protease adaptor protein ClpS [Providencia
           rustigianii DSM 4541]
          Length = 106

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 62/100 (62%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
             F      +      ++ P +Y+VLL ND+YTPM+FV+ VLQ FF  D E A  IML V
Sbjct: 6   GTFKTDTIFKNEVEQTLQPPSMYKVLLNNDDYTPMDFVVEVLQKFFSFDEERATQIMLDV 65

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H QG G CGVY  E+AE K  QV  ++R+H+YPL C +E+
Sbjct: 66  HFQGKGSCGVYTAEVAETKAAQVNAFAREHEYPLLCTIEK 105


>gi|33301910|sp|Q8DAS0|CLPS_VIBVU RecName: Full=ATP-dependent Clp protease adapter protein ClpS
          Length = 106

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 64/97 (65%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D   +  ++++ PK Y V+L ND+YTPM+FVI VL+ FF  D   A  IMLKVH++
Sbjct: 9   TPDSDLLEKEITQIQPPKKYNVVLNNDDYTPMDFVIDVLERFFSHDLNKATQIMLKVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG Y+ EIAE KV QV  YSR++++PL C MEQ
Sbjct: 69  GKAICGTYSAEIAETKVAQVTMYSRENEHPLLCTMEQ 105


>gi|300310730|ref|YP_003774822.1| ATP-dependent Clp protease adaptor protein [Herbaspirillum
           seropedicae SmR1]
 gi|300073515|gb|ADJ62914.1| ATP-dependent Clp protease adaptor protein [Herbaspirillum
           seropedicae SmR1]
          Length = 104

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/97 (50%), Positives = 68/97 (70%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           ++      R  SK++ P +Y+VLL+ND+YTPMEFV+ V+Q +F KD ETA  IMLKVH  
Sbjct: 7   NDGGTVLERQESKLKPPPMYQVLLLNDDYTPMEFVVAVIQQYFNKDRETATQIMLKVHRD 66

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G G CGVY  +IA  KV  V+ ++R+  +PLQC+ME+
Sbjct: 67  GKGMCGVYPKDIASTKVELVLTHARKAGHPLQCVMEE 103


>gi|271500837|ref|YP_003333862.1| ATP-dependent Clp protease adaptor protein ClpS [Dickeya dadantii
           Ech586]
 gi|270344392|gb|ACZ77157.1| ATP-dependent Clp protease adaptor protein ClpS [Dickeya dadantii
           Ech586]
          Length = 106

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 66/104 (63%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                       ++  ++  ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GNHSTGPQTDDLTKEHYTEALQPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+QG   CGVY+ E+AE KV QV  Y+R++++PL C +E+
Sbjct: 62  MLTVHYQGKAICGVYSAEVAETKVAQVNRYARENEHPLLCTLEK 105


>gi|148261822|ref|YP_001235949.1| ATP-dependent Clp protease adaptor protein ClpS [Acidiphilium
           cryptum JF-5]
 gi|146403503|gb|ABQ32030.1| ATP-dependent Clp protease adaptor protein ClpS [Acidiphilium
           cryptum JF-5]
          Length = 147

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 70/115 (60%), Gaps = 2/115 (1%)

Query: 23  SFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
           + I+ A    +  G    D       +  ++ + P LYRV++ ND+YTPMEFV+  L   
Sbjct: 34  NRIYGAIGMDDFDGQDGMDPVF--ATQARARAKRPPLYRVMMFNDDYTPMEFVVATLVGL 91

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           F K  + A  I L++H +G+G CG++ YEIAE K+ QV+  +R++Q+PLQC++E 
Sbjct: 92  FGKTTDEAGRIALRIHRRGVGVCGIFTYEIAETKMIQVLELARENQHPLQCMIEP 146


>gi|120598597|ref|YP_963171.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella sp.
           W3-18-1]
 gi|146293324|ref|YP_001183748.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           putrefaciens CN-32]
 gi|166214746|sp|A4Y7L6|CLPS_SHEPC RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214748|sp|A1RIX2|CLPS_SHESW RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|120558690|gb|ABM24617.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella sp.
           W3-18-1]
 gi|145565014|gb|ABP75949.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           putrefaciens CN-32]
 gi|319426624|gb|ADV54698.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           putrefaciens 200]
          Length = 102

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 66/92 (71%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E R  S++  P +Y+V+L ND+YTPM+FVI VLQ FF K+ + A  IML +HHQG G C
Sbjct: 10  VEERVESELMPPSMYKVILNNDDYTPMDFVIEVLQVFFRKNEQEATDIMLTIHHQGKGIC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G++ + IAE KV QV  ++RQ+Q+PL C +E+
Sbjct: 70  GIFPFGIAETKVIQVNQFARQNQHPLLCSLEK 101


>gi|163868096|ref|YP_001609300.1| ATP-dependent Clp protease adaptor protein ClpS [Bartonella
           tribocorum CIP 105476]
 gi|161017747|emb|CAK01305.1| Clp protease adaptor protein [Bartonella tribocorum CIP 105476]
          Length = 123

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 77/116 (66%)

Query: 21  LMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ 80
           +++ I         K   E  +      +  +K++ PKLYRVLL+ND+YTPM+FV+ VL+
Sbjct: 6   IINSIPHIMHNEKGKNWDEGRHSAVIIPKARAKLQKPKLYRVLLLNDDYTPMDFVVFVLK 65

Query: 81  NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           NFF K  E A  IML VHH GIGECG Y YE+AEMK+ QV   +RQ+++PLQC+ME
Sbjct: 66  NFFKKSFEEATRIMLNVHHNGIGECGTYTYEVAEMKIVQVRECARQNEHPLQCVME 121


>gi|148977557|ref|ZP_01814136.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrionales
           bacterium SWAT-3]
 gi|145963208|gb|EDK28475.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrionales
           bacterium SWAT-3]
          Length = 106

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 66/97 (68%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D   + ++KV+ P +Y V+L ND+YTPM+FVI +L+ FF  D E A  +MLKVH++
Sbjct: 9   SPGSDLLEKEATKVKPPAMYNVVLNNDDYTPMDFVIEILERFFSLDIEKATEVMLKVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG Y+ EIAE KV QV  YS+++++PL C MEQ
Sbjct: 69  GKAICGTYSAEIAETKVAQVTMYSKENEHPLLCTMEQ 105


>gi|237732131|ref|ZP_04562612.1| ATP-dependent Clp protease adapter protein clpS [Citrobacter sp.
           30_2]
 gi|226907670|gb|EEH93588.1| ATP-dependent Clp protease adapter protein clpS [Citrobacter sp.
           30_2]
          Length = 106

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 66/97 (68%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D  L +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDLLAEDKLRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|237746972|ref|ZP_04577452.1| ATP-dependent Clp protease adaptor protein ClpS [Oxalobacter
           formigenes HOxBLS]
 gi|229378323|gb|EEO28414.1| ATP-dependent Clp protease adaptor protein ClpS [Oxalobacter
           formigenes HOxBLS]
          Length = 143

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/90 (50%), Positives = 66/90 (73%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
              ++ ++ P +YRVLL+ND++TPM+FVI VLQ +F+K+ E A  IMLKVH +G G CG+
Sbjct: 53  EETATVLKPPPMYRVLLLNDDFTPMDFVIFVLQEYFHKNAEMATRIMLKVHREGKGVCGI 112

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +  +IA  KV QV+ ++RQ  +PLQC ME+
Sbjct: 113 FPKDIANTKVEQVIRHARQEGHPLQCTMEE 142


>gi|258621690|ref|ZP_05716721.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio mimicus
           VM573]
 gi|258626363|ref|ZP_05721210.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio mimicus
           VM603]
 gi|262165415|ref|ZP_06033152.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio mimicus
           VM223]
 gi|262171823|ref|ZP_06039501.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio mimicus
           MB-451]
 gi|258581415|gb|EEW06317.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio mimicus
           VM603]
 gi|258585921|gb|EEW10639.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio mimicus
           VM573]
 gi|261892899|gb|EEY38885.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio mimicus
           MB-451]
 gi|262025131|gb|EEY43799.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio mimicus
           VM223]
          Length = 106

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 64/97 (65%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
              LD   +  + V+ P +Y V+L ND+YTPM+FVI +L+ FF  D E A  +MLKVH++
Sbjct: 9   SPDLDLLEKEKTAVKPPSMYHVVLNNDDYTPMDFVIEILERFFSMDIERATQVMLKVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG +  E+AE KV QV  YSR++++PL C MEQ
Sbjct: 69  GKAICGTFTAEVAETKVAQVTMYSRENEHPLLCTMEQ 105


>gi|238757595|ref|ZP_04618779.1| ATP-dependent Clp protease adapter protein clpS [Yersinia aldovae
           ATCC 35236]
 gi|238704100|gb|EEP96633.1| ATP-dependent Clp protease adapter protein clpS [Yersinia aldovae
           ATCC 35236]
          Length = 106

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 64/104 (61%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                  +     + ++   ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GNNNDWLNFEHLVKDKYKEALKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+QG   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 62  MLNVHYQGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEK 105


>gi|224824763|ref|ZP_03697870.1| ATP-dependent Clp protease adaptor protein ClpS [Lutiella
           nitroferrum 2002]
 gi|224603256|gb|EEG09432.1| ATP-dependent Clp protease adaptor protein ClpS [Lutiella
           nitroferrum 2002]
          Length = 102

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 68/87 (78%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
            +K R P +Y+VLL+ND+YTPM+FV+ +LQ+FF+K+ E A  IML+VH QG G CGVY  
Sbjct: 15  RAKTRPPSMYKVLLLNDDYTPMDFVVQILQHFFHKNREQATSIMLQVHTQGRGVCGVYTK 74

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ++A  KV QV+ +++ HQ+PLQC+ME+
Sbjct: 75  DVAATKVEQVLQFAKAHQHPLQCVMEE 101


>gi|325919554|ref|ZP_08181568.1| hypothetical protein XGA_0507 [Xanthomonas gardneri ATCC 19865]
 gi|325549963|gb|EGD20803.1| hypothetical protein XGA_0507 [Xanthomonas gardneri ATCC 19865]
          Length = 106

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 68/106 (64%), Gaps = 1/106 (0%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M +    E+D+ L  E     +V  P  Y+VLL+ND+YTPM+FV+ VL+ FF    E A 
Sbjct: 1   MPRNTTHEYDHGLMVEA-SKPEVAPPPRYQVLLLNDDYTPMDFVVTVLEQFFNLSLEQAT 59

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH +G G CGVY+ E+AE KV QV  +SR +Q+PL C MEQ
Sbjct: 60  QVMLHVHTRGRGVCGVYSREVAESKVAQVNEFSRMNQHPLLCTMEQ 105


>gi|85713420|ref|ZP_01044415.1| ATP-dependent Clp protease adaptor protein ClpS [Idiomarina baltica
           OS145]
 gi|85692756|gb|EAQ30759.1| ATP-dependent Clp protease adaptor protein ClpS [Idiomarina baltica
           OS145]
          Length = 104

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/94 (48%), Positives = 65/94 (69%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           D E     +++ P +Y+V+L ND+YTPM+FVI VL  FF  ++E A   ML+VH++G   
Sbjct: 11  DVEEESKHELKPPSMYKVILNNDDYTPMDFVIEVLIRFFRMNNERATDTMLQVHYKGKAV 70

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CGVY+ EIAE KV QV  Y+R++Q+PL C ME +
Sbjct: 71  CGVYSAEIAETKVVQVNQYARENQHPLLCTMEHE 104


>gi|254438854|ref|ZP_05052348.1| ATP-dependent Clp protease adaptor protein ClpS [Octadecabacter
           antarcticus 307]
 gi|198254300|gb|EDY78614.1| ATP-dependent Clp protease adaptor protein ClpS [Octadecabacter
           antarcticus 307]
          Length = 113

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/94 (46%), Positives = 69/94 (73%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
             ++   +K + P LY+V+++ND+YTPMEFV+HVL+ FF   H+ +  IM+ VH +G+  
Sbjct: 20  GVKLETRTKTKRPPLYKVMILNDDYTPMEFVVHVLERFFSLTHDQSVDIMMAVHKKGLAV 79

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            GV+++EIAE KV QVM+ + +HQ+PLQC ME++
Sbjct: 80  VGVFSHEIAETKVAQVMDLAARHQHPLQCTMEKE 113


>gi|254450586|ref|ZP_05064023.1| ATP-dependent Clp protease adaptor protein ClpS [Octadecabacter
           antarcticus 238]
 gi|198264992|gb|EDY89262.1| ATP-dependent Clp protease adaptor protein ClpS [Octadecabacter
           antarcticus 238]
          Length = 107

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/95 (46%), Positives = 69/95 (72%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
           +  ++   +K + P LY+V+++ND+YTPMEFV+HVL+ FF   H+ +  IML VH +G+ 
Sbjct: 13  IGIKLETRTKTKRPPLYKVMILNDDYTPMEFVVHVLERFFSLTHDQSVEIMLAVHKKGLA 72

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             GV+++EIAE KV  VM+ + +HQ+PLQC ME++
Sbjct: 73  VVGVFSHEIAETKVALVMDLAARHQHPLQCTMEKE 107


>gi|119944513|ref|YP_942193.1| ATP-dependent Clp protease adaptor protein ClpS [Psychromonas
           ingrahamii 37]
 gi|119863117|gb|ABM02594.1| ATP-dependent Clp protease adaptor protein ClpS [Psychromonas
           ingrahamii 37]
          Length = 108

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/107 (48%), Positives = 76/107 (71%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+ K   +  N  D+  +  +K+R P +Y VLL ND+YTPM+FVI VLQ FF  D++ A 
Sbjct: 1   MSDKKAPKTVNKSDTIEKVETKLRPPSMYNVLLHNDDYTPMDFVIDVLQQFFRLDNQKAT 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +ML VH++ +G CG ++ EIAE KV QVMNY+RQ+++PL+C ME++
Sbjct: 61  EVMLNVHYKEVGICGTFSAEIAETKVMQVMNYARQNEHPLRCSMEKE 107


>gi|190574283|ref|YP_001972128.1| putative ATP-dependent Clp protease adaptor protein ClpS
           [Stenotrophomonas maltophilia K279a]
 gi|229889824|sp|B2FQX5|CLPS_STRMK RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|190012205|emb|CAQ45828.1| putative ATP-dependent Clp protease adaptor protein ClpS
           [Stenotrophomonas maltophilia K279a]
          Length = 108

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 32  MNKKGIAEFDNCLDSEVRF-SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
           M  +   +  +     V     +V  P  Y+V+L+ND+YTPM+FV+ VLQ FF  D + A
Sbjct: 1   MPHESSPDSQHEHGVAVEAARPEVAPPPFYQVMLLNDDYTPMDFVVDVLQQFFSMDLDKA 60

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             +ML VH +G G CGV+  E+AE KV QV  YSR +Q+PL C ME+
Sbjct: 61  TQVMLHVHTRGRGVCGVFTREVAETKVAQVNEYSRMNQHPLLCTMEK 107


>gi|312795291|ref|YP_004028213.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           rhizoxinica HKI 454]
 gi|312167066|emb|CBW74069.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           rhizoxinica HKI 454]
          Length = 104

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 48/95 (50%), Positives = 67/95 (70%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R   K + P +YRV+L+ND++TPMEFV+ V+Q +F KD +TA  IMLKVH++G 
Sbjct: 9   DGTVLERQEHKAKPPSMYRVVLLNDDFTPMEFVVMVIQQYFNKDRDTATQIMLKVHYEGR 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 69  GICGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|242239694|ref|YP_002987875.1| ATP-dependent Clp protease adaptor protein ClpS [Dickeya dadantii
           Ech703]
 gi|242131751|gb|ACS86053.1| ATP-dependent Clp protease adaptor protein ClpS [Dickeya dadantii
           Ech703]
          Length = 106

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/103 (43%), Positives = 64/103 (62%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
                      ++      ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +M
Sbjct: 3   NHNTGPQVEGQTKDLHEEALQPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQLM 62

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L VH+QG   CGVY+ E+AE KV QV  Y+R++++PL C +E+
Sbjct: 63  LTVHYQGKAICGVYSAEVAETKVAQVNRYARENEHPLLCTLEK 105


>gi|90415922|ref|ZP_01223855.1| hypothetical protein GB2207_01777 [marine gamma proteobacterium
           HTCC2207]
 gi|90332296|gb|EAS47493.1| hypothetical protein GB2207_01777 [marine gamma proteobacterium
           HTCC2207]
          Length = 114

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/111 (38%), Positives = 68/111 (61%), Gaps = 3/111 (2%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M++ +       + +  +++E     K++ P +++V+L+ND+YTPMEFV+ +L+ FF K 
Sbjct: 1   MSNDKNPPAWQHDGNTVVETE---RPKLKKPSMFKVVLLNDDYTPMEFVVELLEKFFSKT 57

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            E A  IML +H  G G CG+Y  ++AE K   V  YSR HQ+PL C +E 
Sbjct: 58  RENATRIMLSIHTDGKGVCGIYTKDVAETKAGTVNQYSRDHQHPLLCEVEP 108


>gi|251789967|ref|YP_003004688.1| ATP-dependent Clp protease adaptor protein ClpS [Dickeya zeae
           Ech1591]
 gi|247538588|gb|ACT07209.1| ATP-dependent Clp protease adaptor protein ClpS [Dickeya zeae
           Ech1591]
          Length = 106

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 66/104 (63%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                       ++  ++  ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GNHSTGPQTDDLTKEHYTEALQPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+QG   CGVY+ E+AE KV QV  Y+R++++PL C +E+
Sbjct: 62  MLTVHYQGKAICGVYSAEVAETKVEQVNRYARENEHPLLCTLEK 105


>gi|15641156|ref|NP_230788.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121587408|ref|ZP_01677177.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           2740-80]
 gi|121726248|ref|ZP_01679538.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           V52]
 gi|147674267|ref|YP_001216663.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           O395]
 gi|153214234|ref|ZP_01949269.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           1587]
 gi|153802564|ref|ZP_01957150.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           MZO-3]
 gi|153816957|ref|ZP_01969624.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           NCTC 8457]
 gi|153821999|ref|ZP_01974666.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           B33]
 gi|153826033|ref|ZP_01978700.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           MZO-2]
 gi|153828695|ref|ZP_01981362.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           623-39]
 gi|227081316|ref|YP_002809867.1| ATP-dependent Clp protease adaptor protein [Vibrio cholerae M66-2]
 gi|229505262|ref|ZP_04394772.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae BX
           330286]
 gi|229511068|ref|ZP_04400547.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           B33]
 gi|229515526|ref|ZP_04404985.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           TMA 21]
 gi|229518188|ref|ZP_04407632.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           RC9]
 gi|229520427|ref|ZP_04409852.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae TM
           11079-80]
 gi|229529768|ref|ZP_04419158.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           12129(1)]
 gi|229608281|ref|YP_002878929.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           MJ-1236]
 gi|254225532|ref|ZP_04919142.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           V51]
 gi|254291568|ref|ZP_04962358.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           AM-19226]
 gi|254848271|ref|ZP_05237621.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           MO10]
 gi|255745555|ref|ZP_05419503.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholera
           CIRS 101]
 gi|262158371|ref|ZP_06029487.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           INDRE 91/1]
 gi|262170183|ref|ZP_06037871.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           RC27]
 gi|297578745|ref|ZP_06940673.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           RC385]
 gi|298498752|ref|ZP_07008559.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           MAK 757]
 gi|12230810|sp|Q9KSW3|CLPS_VIBCH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|172047399|sp|A5F294|CLPS_VIBC3 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|254763825|sp|C3LLJ0|CLPS_VIBCM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|9655616|gb|AAF94302.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121548328|gb|EAX58392.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           2740-80]
 gi|121631194|gb|EAX63567.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           V52]
 gi|124115483|gb|EAY34303.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           1587]
 gi|124121878|gb|EAY40621.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           MZO-3]
 gi|125622002|gb|EAZ50326.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           V51]
 gi|126512544|gb|EAZ75138.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           NCTC 8457]
 gi|126520464|gb|EAZ77687.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           B33]
 gi|146316150|gb|ABQ20689.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           O395]
 gi|148875848|gb|EDL73983.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           623-39]
 gi|149740253|gb|EDM54400.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           MZO-2]
 gi|150422520|gb|EDN14477.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           AM-19226]
 gi|227009204|gb|ACP05416.1| ATP-dependent Clp protease adaptor protein [Vibrio cholerae M66-2]
 gi|227013010|gb|ACP09220.1| ATP-dependent Clp protease adaptor protein [Vibrio cholerae O395]
 gi|229333542|gb|EEN99028.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           12129(1)]
 gi|229342525|gb|EEO07518.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae TM
           11079-80]
 gi|229344903|gb|EEO09877.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           RC9]
 gi|229347295|gb|EEO12255.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           TMA 21]
 gi|229351033|gb|EEO15974.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           B33]
 gi|229357485|gb|EEO22402.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae BX
           330286]
 gi|229370936|gb|ACQ61359.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           MJ-1236]
 gi|254843976|gb|EET22390.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           MO10]
 gi|255736630|gb|EET92027.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholera
           CIRS 101]
 gi|262021352|gb|EEY40065.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           RC27]
 gi|262029812|gb|EEY48460.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           INDRE 91/1]
 gi|297536339|gb|EFH75172.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           RC385]
 gi|297543085|gb|EFH79135.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           MAK 757]
 gi|327483847|gb|AEA78254.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio cholerae
           LMA3894-4]
          Length = 106

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 63/97 (64%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D   +  + V+ P +Y V+L ND+YTPM+FVI +L+ FF  D E A  +MLKVH++
Sbjct: 9   SPDFDLLEKEKTAVKPPSMYHVVLNNDDYTPMDFVIEILERFFSMDIERATQVMLKVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG +  E+AE KV QV  YSR++++PL C MEQ
Sbjct: 69  GKAICGTFTAEVAETKVAQVTMYSRENEHPLLCTMEQ 105


>gi|285018228|ref|YP_003375939.1| ATP-dependent clp protease adaptor protein clps [Xanthomonas
           albilineans GPE PC73]
 gi|283473446|emb|CBA15951.1| putative atp-dependent clp protease adaptor protein clps
           [Xanthomonas albilineans]
          Length = 94

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 60/87 (68%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
             +   P +Y+VLL+ND+YTPMEFV+ VLQ FF  D E A  +ML VH +G G CGVY  
Sbjct: 7   KPETARPPMYQVLLLNDDYTPMEFVVTVLQQFFALDLERATQVMLHVHTRGRGVCGVYTR 66

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           E+AE KV QV  +SR +Q+PL C ME+
Sbjct: 67  EVAESKVAQVNEFSRMNQHPLLCTMEK 93


>gi|53718539|ref|YP_107525.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei K96243]
 gi|53725847|ref|YP_103843.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei ATCC 23344]
 gi|67642115|ref|ZP_00440876.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei GB8 horse 4]
 gi|76810861|ref|YP_332526.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 1710b]
 gi|121600243|ref|YP_991923.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei SAVP1]
 gi|124384404|ref|YP_001027038.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei NCTC 10229]
 gi|126440545|ref|YP_001058010.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 668]
 gi|126448935|ref|YP_001081687.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei NCTC 10247]
 gi|126455350|ref|YP_001065244.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 1106a]
 gi|134281101|ref|ZP_01767810.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 305]
 gi|167003875|ref|ZP_02269654.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei PRL-20]
 gi|167718445|ref|ZP_02401681.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei DM98]
 gi|167737495|ref|ZP_02410269.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 14]
 gi|167814613|ref|ZP_02446293.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 91]
 gi|167823083|ref|ZP_02454554.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 9]
 gi|167844644|ref|ZP_02470152.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei B7210]
 gi|167893175|ref|ZP_02480577.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 7894]
 gi|167901629|ref|ZP_02488834.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei NCTC 13177]
 gi|167909878|ref|ZP_02496969.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 112]
 gi|167917901|ref|ZP_02504992.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei BCC215]
 gi|217420084|ref|ZP_03451590.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 576]
 gi|226194397|ref|ZP_03789995.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei Pakistan 9]
 gi|237811161|ref|YP_002895612.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei MSHR346]
 gi|242318006|ref|ZP_04817022.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 1106b]
 gi|254178824|ref|ZP_04885478.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei ATCC 10399]
 gi|254181505|ref|ZP_04888102.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 1655]
 gi|254196779|ref|ZP_04903203.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei S13]
 gi|254202547|ref|ZP_04908910.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei FMH]
 gi|254207884|ref|ZP_04914234.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei JHU]
 gi|254261197|ref|ZP_04952251.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 1710a]
 gi|254296418|ref|ZP_04963875.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 406e]
 gi|254298242|ref|ZP_04965694.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 406e]
 gi|67460237|sp|Q62HH7|CLPS_BURMA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|67460244|sp|Q63WJ1|CLPS_BURPS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|123600017|sp|Q3JV77|CLPS_BURP1 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|158513522|sp|A3NSC3|CLPS_BURP0 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214726|sp|A3MN51|CLPS_BURM7 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214727|sp|A2S519|CLPS_BURM9 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214728|sp|A1V120|CLPS_BURMS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214729|sp|A3N6N9|CLPS_BURP6 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|52208953|emb|CAH34892.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
 gi|52429270|gb|AAU49863.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei ATCC 23344]
 gi|76580314|gb|ABA49789.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 1710b]
 gi|121229053|gb|ABM51571.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei SAVP1]
 gi|124292424|gb|ABN01693.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei NCTC 10229]
 gi|126220038|gb|ABN83544.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 668]
 gi|126228992|gb|ABN92532.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 1106a]
 gi|126241805|gb|ABO04898.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei NCTC 10247]
 gi|134247407|gb|EBA47492.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 305]
 gi|147746794|gb|EDK53871.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei FMH]
 gi|147751778|gb|EDK58845.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei JHU]
 gi|157806177|gb|EDO83347.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 406e]
 gi|157808080|gb|EDO85250.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 406e]
 gi|160694738|gb|EDP84746.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei ATCC 10399]
 gi|169653522|gb|EDS86215.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei S13]
 gi|184212043|gb|EDU09086.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 1655]
 gi|217397388|gb|EEC37404.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 576]
 gi|225933482|gb|EEH29471.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei Pakistan 9]
 gi|237503292|gb|ACQ95610.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei MSHR346]
 gi|238523195|gb|EEP86635.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei GB8 horse 4]
 gi|242141245|gb|EES27647.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 1106b]
 gi|243060669|gb|EES42855.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           mallei PRL-20]
 gi|254219886|gb|EET09270.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           pseudomallei 1710a]
          Length = 104

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 48/95 (50%), Positives = 67/95 (70%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R   K++ P +Y+V+L+ND++TPMEFV+ V+Q +F KD ETA  IMLKVH +G 
Sbjct: 9   DSSVLERKEQKLKPPSMYKVVLLNDDFTPMEFVVMVVQEYFKKDRETATQIMLKVHREGR 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 69  GVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|228311830|pdb|2WA8|A Chain A, Structural Basis Of N-End Rule Substrate Recognition In
           Escherichia Coli By The Clpap Adaptor Protein Clps - The
           Phe Peptide Structure
 gi|228311832|pdb|2WA8|C Chain C, Structural Basis Of N-End Rule Substrate Recognition In
           Escherichia Coli By The Clpap Adaptor Protein Clps - The
           Phe Peptide Structure
          Length = 107

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|212634694|ref|YP_002311219.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           piezotolerans WP3]
 gi|226706569|sp|B8CLI1|CLPS_SHEPW RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|212556178|gb|ACJ28632.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           piezotolerans WP3]
          Length = 102

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 62/84 (73%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           ++ P +Y+V+L ND+YTPM+FVI +LQ FF KD   A  IML +HH+G G CG+Y + IA
Sbjct: 18  LKQPSMYKVILNNDDYTPMDFVIEILQLFFRKDEAQATEIMLAIHHKGKGICGIYPFGIA 77

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQ 137
           E KV QV  ++RQ+++PL C +E+
Sbjct: 78  ETKVAQVNQFARQNEHPLLCSLEE 101


>gi|194365699|ref|YP_002028309.1| ATP-dependent Clp protease adaptor protein ClpS [Stenotrophomonas
           maltophilia R551-3]
 gi|238693433|sp|B4SIN7|CLPS_STRM5 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|194348503|gb|ACF51626.1| ATP-dependent Clp protease adaptor protein ClpS [Stenotrophomonas
           maltophilia R551-3]
          Length = 108

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 32  MNKKGIAEFDNCLDSEVR-FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
           M ++   +  +     V     +V  P  Y+V+L+ND+YTPM+FV+ VLQ FF  D + A
Sbjct: 1   MPRESSPDSHHEHGVAVEPARPEVAPPPFYQVMLLNDDYTPMDFVVDVLQQFFTMDLDKA 60

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             +ML VH +G G CGV+  E+AE KV QV  YSR +Q+PL C ME+
Sbjct: 61  TQVMLHVHTRGRGVCGVFTREVAETKVAQVNEYSRMNQHPLLCTMEK 107


>gi|254506183|ref|ZP_05118327.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus 16]
 gi|219551001|gb|EED27982.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           parahaemolyticus 16]
          Length = 106

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/98 (44%), Positives = 63/98 (64%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                D      +KV+ P +Y V+L ND+YTPM+FVI +L+ FF  D + A  +ML+VH+
Sbjct: 8   VTPDSDLLELEKTKVKPPSMYNVVLNNDDYTPMDFVIEILERFFSMDADKATQVMLQVHY 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CG Y  E+AE KV QV  YS+++++PL C MEQ
Sbjct: 68  EGKAICGTYTAEVAETKVAQVTMYSKENEHPLLCTMEQ 105


>gi|84393767|ref|ZP_00992515.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio splendidus
           12B01]
 gi|84375629|gb|EAP92528.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio splendidus
           12B01]
          Length = 106

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D   +  +KV+ P +Y V+L ND+YTPM+FVI +L+ FF  D E A  +MLKVH++
Sbjct: 9   SPGSDLLEKEETKVKPPAMYNVVLNNDDYTPMDFVIEILERFFSLDIEQATEVMLKVHYE 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG Y+ EIAE KV QV  YS+++++PL C MEQ
Sbjct: 69  GKAICGTYSAEIAETKVAQVKMYSKENEHPLLCTMEQ 105


>gi|119775192|ref|YP_927932.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           amazonensis SB2B]
 gi|166214742|sp|A1S7A6|CLPS_SHEAM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|119767692|gb|ABM00263.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 102

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/92 (46%), Positives = 63/92 (68%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
              R  +++  P +Y+V+L ND+YTPM+FV+ VLQ FF  +   A  IML++HHQG   C
Sbjct: 10  VVERADTELMPPSMYKVILNNDDYTPMDFVVEVLQLFFKMNEHQATEIMLQIHHQGKAVC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           GV+ + IAE KV QV  ++RQ+Q+PL C +E+
Sbjct: 70  GVFPFGIAETKVAQVNQFARQNQHPLLCSLEK 101


>gi|218548404|ref|YP_002382195.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia
           fergusonii ATCC 35469]
 gi|226706568|sp|B7LN49|CLPS_ESCF3 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|218355945|emb|CAQ88560.1| regulatory protein for ClpA substrate specificity [Escherichia
           fergusonii ATCC 35469]
 gi|324113823|gb|EGC07798.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia
           fergusonii B253]
 gi|325496825|gb|EGC94684.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia
           fergusonii ECD227]
          Length = 106

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 66/97 (68%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLAEDKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLTVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V NY+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNNYARENEHPLLCTLEK 105


>gi|239994276|ref|ZP_04714800.1| ATP-dependent Clp protease adaptor protein ClpS [Alteromonas
           macleodii ATCC 27126]
 gi|238693285|sp|B4S1R5|CLPS_ALTMD RecName: Full=ATP-dependent Clp protease adapter protein ClpS
          Length = 106

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 50/103 (48%), Positives = 63/103 (61%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
           K  A        +     K + P +Y+VLL ND+YTPM+FVI VL  FF  D E A  +M
Sbjct: 3   KDNAISIEKEKQKDAQRQKPQPPPMYKVLLNNDDYTPMDFVIEVLMQFFNMDAEKANQLM 62

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L VH+QG   CG++  EIAE KV QV  Y+R+HQ+PL C MEQ
Sbjct: 63  LTVHYQGKAVCGIFTAEIAETKVMQVNQYARKHQHPLMCTMEQ 105


>gi|238784507|ref|ZP_04628515.1| ATP-dependent Clp protease adapter protein clpS [Yersinia
           bercovieri ATCC 43970]
 gi|238795830|ref|ZP_04639343.1| ATP-dependent Clp protease adapter protein clpS [Yersinia
           mollaretii ATCC 43969]
 gi|238714570|gb|EEQ06574.1| ATP-dependent Clp protease adapter protein clpS [Yersinia
           bercovieri ATCC 43970]
 gi|238720293|gb|EEQ12096.1| ATP-dependent Clp protease adapter protein clpS [Yersinia
           mollaretii ATCC 43969]
          Length = 106

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 64/104 (61%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
            K     +     + +    ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GKNNDWLNFEHLVKDKQKEALKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+QG   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 62  MLNVHYQGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEK 105


>gi|260459200|ref|ZP_05807455.1| ATP-dependent Clp protease adaptor protein ClpS [Mesorhizobium
           opportunistum WSM2075]
 gi|259034754|gb|EEW36010.1| ATP-dependent Clp protease adaptor protein ClpS [Mesorhizobium
           opportunistum WSM2075]
          Length = 131

 Score =  134 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 62/131 (47%), Positives = 88/131 (67%), Gaps = 1/131 (0%)

Query: 9   MYHRVKRDGI-LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVND 67
           M  R ++D + + L +   +A  +       E         R  +K + P LYRVL++ND
Sbjct: 1   MRIRKRQDYVTIGLTATTQVARMQNGGGDGNEAGRGTAVITRTKTKTKKPSLYRVLILND 60

Query: 68  NYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQH 127
           +YTPMEFV+HVL+ FF KD E A  IML VH+ G+GECGVY +E+AE KV+QVM+++RQ+
Sbjct: 61  DYTPMEFVVHVLERFFQKDREAATRIMLHVHNHGVGECGVYTFEVAETKVSQVMDFARQN 120

Query: 128 QYPLQCIMEQK 138
           Q+PLQC+ME+K
Sbjct: 121 QHPLQCVMEKK 131


>gi|183598326|ref|ZP_02959819.1| hypothetical protein PROSTU_01717 [Providencia stuartii ATCC 25827]
 gi|188020501|gb|EDU58541.1| hypothetical protein PROSTU_01717 [Providencia stuartii ATCC 25827]
          Length = 106

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/100 (44%), Positives = 64/100 (64%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
             F   +  +      ++ P +Y+V+L ND+YTPM+FV+ VLQ +F  D E A  IML V
Sbjct: 6   GTFKTDVVFKDEVEQVLQPPSMYKVILNNDDYTPMDFVVEVLQKYFSFDEERATQIMLDV 65

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H QG G CG++  E+AE K  QV +Y+R+H+YPL C +E+
Sbjct: 66  HFQGKGVCGIFTAEVAETKAAQVNSYAREHEYPLLCTIEK 105


>gi|71908707|ref|YP_286294.1| ATP-dependent Clp protease adaptor protein ClpS [Dechloromonas
           aromatica RCB]
 gi|123626787|sp|Q47BF7|CLPS_DECAR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|71848328|gb|AAZ47824.1| ATP-dependent Clp protease adaptor protein ClpS [Dechloromonas
           aromatica RCB]
          Length = 102

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/95 (52%), Positives = 66/95 (69%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                    S++  PK+Y+V+L+ND+YTPM+FVI VLQ FF  D E A  IMLKVH++G 
Sbjct: 7   EGGQLEAQRSRLGPPKMYKVVLLNDDYTPMDFVITVLQRFFSLDTEQATRIMLKVHNEGR 66

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGV+  +IA  KV QV  ++RQHQ+PL CIME+
Sbjct: 67  GVCGVFPRDIAATKVEQVSAFARQHQHPLACIMEE 101


>gi|323493245|ref|ZP_08098374.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           brasiliensis LMG 20546]
 gi|323312511|gb|EGA65646.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           brasiliensis LMG 20546]
          Length = 106

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/98 (44%), Positives = 63/98 (64%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                D      +KV+ P +Y V+L ND+YTPM+FVI +L+ FF  D + A  +ML+VH+
Sbjct: 8   VTPDSDLLELEKTKVKPPSMYNVVLNNDDYTPMDFVIEILERFFSMDIDKATQVMLQVHY 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CG Y  E+AE KV QV  YS+++++PL C MEQ
Sbjct: 68  EGKAICGTYTAEVAETKVAQVTMYSKENEHPLLCTMEQ 105


>gi|254480629|ref|ZP_05093876.1| ATP-dependent Clp protease adaptor protein ClpS [marine gamma
           proteobacterium HTCC2148]
 gi|214039212|gb|EEB79872.1| ATP-dependent Clp protease adaptor protein ClpS [marine gamma
           proteobacterium HTCC2148]
          Length = 107

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 64/100 (64%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
             E  +   +      +++ P L++V+L+ND+YTPMEFV+ VL++FF  + E A  +ML 
Sbjct: 4   EEEDVDGGLALQESKPELKKPPLFKVVLMNDDYTPMEFVVEVLESFFRMNREQATHVMLT 63

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           VH QG G CG++  +IAE K  QV  Y+R+ ++PL C +E
Sbjct: 64  VHTQGKGVCGIFTRDIAETKAAQVNQYARESEHPLLCEVE 103


>gi|33597157|ref|NP_884800.1| ATP-dependent Clp protease adaptor protein ClpS [Bordetella
           parapertussis 12822]
 gi|33601001|ref|NP_888561.1| ATP-dependent Clp protease adaptor protein ClpS [Bordetella
           bronchiseptica RB50]
 gi|39931037|sp|Q7W7E8|CLPS_BORPA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|39931045|sp|Q7WKT7|CLPS_BORBR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|33566608|emb|CAE37866.1| hypothetical protein BPP2572 [Bordetella parapertussis]
 gi|33575436|emb|CAE32514.1| hypothetical protein BB2017 [Bordetella bronchiseptica RB50]
          Length = 104

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 41  DNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
           D   D  V     +   P +Y+V+L+ND+YTPMEFV+ VLQ FF K+ E A  IML+VHH
Sbjct: 6   DTQHDVVVEKQPARTAPPPMYQVVLLNDDYTPMEFVVKVLQKFFGKNSEDATRIMLQVHH 65

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CGVY  ++A  ++ QV  Y+R  Q+PLQCIME 
Sbjct: 66  EGRAVCGVYPRDLAATRIAQVSQYARARQHPLQCIMEP 103


>gi|94499670|ref|ZP_01306207.1| ATP-dependent Clp protease adaptor protein ClpS [Oceanobacter sp.
           RED65]
 gi|94428424|gb|EAT13397.1| ATP-dependent Clp protease adaptor protein ClpS [Oceanobacter sp.
           RED65]
          Length = 116

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 63/102 (61%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                D    +      +++ P LY+V+++ND+YTPM+FVI VL  FF  D E A  IML
Sbjct: 12  DKESEDEHGIAVAPSKPELKRPSLYQVIMLNDDYTPMDFVIDVLTRFFAMDMEKATQIML 71

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            VH QG   CGVY  +IAE K  QVM Y+ +HQ+PL+C ++Q
Sbjct: 72  AVHTQGSAVCGVYTKDIAETKAAQVMAYAEEHQHPLKCNIQQ 113


>gi|15800639|ref|NP_286653.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 EDL933]
 gi|15830221|ref|NP_308994.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. Sakai]
 gi|16128849|ref|NP_415402.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           str. K-12 substr. MG1655]
 gi|24112257|ref|NP_706767.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella flexneri
           2a str. 301]
 gi|26246907|ref|NP_752947.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           CFT073]
 gi|30062369|ref|NP_836540.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella flexneri
           2a str. 2457T]
 gi|74311440|ref|YP_309859.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella sonnei
           Ss046]
 gi|82543368|ref|YP_407315.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella boydii
           Sb227]
 gi|82777596|ref|YP_403945.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella
           dysenteriae Sd197]
 gi|89107732|ref|AP_001512.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           str. K-12 substr. W3110]
 gi|91209918|ref|YP_539904.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           UTI89]
 gi|110641082|ref|YP_668812.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           536]
 gi|110804883|ref|YP_688403.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella flexneri
           5 str. 8401]
 gi|117623059|ref|YP_851972.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           APEC O1]
 gi|157156472|ref|YP_001462078.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           E24377A]
 gi|157160404|ref|YP_001457722.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           HS]
 gi|168752462|ref|ZP_02777484.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4113]
 gi|168759050|ref|ZP_02784057.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4401]
 gi|168769874|ref|ZP_02794881.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4486]
 gi|168777871|ref|ZP_02802878.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4196]
 gi|168783792|ref|ZP_02808799.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4076]
 gi|168789133|ref|ZP_02814140.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC869]
 gi|168802712|ref|ZP_02827719.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC508]
 gi|170020716|ref|YP_001725670.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           ATCC 8739]
 gi|170080540|ref|YP_001729860.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170683903|ref|YP_001744326.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           SMS-3-5]
 gi|187732054|ref|YP_001880921.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella boydii
           CDC 3083-94]
 gi|188493236|ref|ZP_03000506.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           53638]
 gi|191167602|ref|ZP_03029413.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           B7A]
 gi|191172151|ref|ZP_03033695.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           F11]
 gi|193064650|ref|ZP_03045729.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           E22]
 gi|194428349|ref|ZP_03060890.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           B171]
 gi|194433088|ref|ZP_03065370.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella
           dysenteriae 1012]
 gi|194438739|ref|ZP_03070826.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           101-1]
 gi|195939544|ref|ZP_03084926.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4024]
 gi|208807982|ref|ZP_03250319.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4206]
 gi|208815975|ref|ZP_03257154.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4045]
 gi|208822627|ref|ZP_03262946.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4042]
 gi|209399503|ref|YP_002269555.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4115]
 gi|209918130|ref|YP_002292214.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           SE11]
 gi|217326428|ref|ZP_03442512.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. TW14588]
 gi|218553467|ref|YP_002386380.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           IAI1]
 gi|218557785|ref|YP_002390698.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           S88]
 gi|218688663|ref|YP_002396875.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           ED1a]
 gi|218694355|ref|YP_002402022.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           55989]
 gi|218700603|ref|YP_002408232.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           IAI39]
 gi|218704310|ref|YP_002411829.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           UMN026]
 gi|227884153|ref|ZP_04001958.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           83972]
 gi|238900140|ref|YP_002925936.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           BW2952]
 gi|253774089|ref|YP_003036920.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160996|ref|YP_003044104.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli B
           str. REL606]
 gi|254792082|ref|YP_003076919.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. TW14359]
 gi|256020998|ref|ZP_05434863.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella sp. D9]
 gi|256023492|ref|ZP_05437357.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia sp.
           4_1_40B]
 gi|260843132|ref|YP_003220910.1| regulatory protein ClpS for ClpA substrate specificity [Escherichia
           coli O103:H2 str. 12009]
 gi|260854173|ref|YP_003228064.1| regulatory protein ClpS for ClpA substrate specificity [Escherichia
           coli O26:H11 str. 11368]
 gi|260867054|ref|YP_003233456.1| regulatory protein ClpS for ClpA substrate specificity [Escherichia
           coli O111:H- str. 11128]
 gi|261225537|ref|ZP_05939818.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261258494|ref|ZP_05951027.1| regulatory protein ClpS for ClpA substrate specificity [Escherichia
           coli O157:H7 str. FRIK966]
 gi|291281885|ref|YP_003498703.1| ATP-dependent Clp protease adapter protein clpS [Escherichia coli
           O55:H7 str. CB9615]
 gi|293404189|ref|ZP_06648183.1| ClpS [Escherichia coli FVEC1412]
 gi|293409260|ref|ZP_06652836.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293414164|ref|ZP_06656813.1| ATP-dependent Clp protease adapter protein ClpS [Escherichia coli
           B185]
 gi|293433179|ref|ZP_06661607.1| ATP-dependent Clp protease adapter protein ClpS [Escherichia coli
           B088]
 gi|297516224|ref|ZP_06934610.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           OP50]
 gi|298379970|ref|ZP_06989575.1| ATP-dependent Clp protease adapter protein ClpS [Escherichia coli
           FVEC1302]
 gi|300817017|ref|ZP_07097236.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 107-1]
 gi|300823619|ref|ZP_07103746.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 119-7]
 gi|300895696|ref|ZP_07114292.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 198-1]
 gi|300902417|ref|ZP_07120399.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 84-1]
 gi|300921087|ref|ZP_07137471.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 115-1]
 gi|300922550|ref|ZP_07138651.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 182-1]
 gi|300928422|ref|ZP_07143955.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 187-1]
 gi|300935725|ref|ZP_07150693.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 21-1]
 gi|300950109|ref|ZP_07164055.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 116-1]
 gi|300954436|ref|ZP_07166888.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 175-1]
 gi|300978555|ref|ZP_07174308.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 45-1]
 gi|300991762|ref|ZP_07179625.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 200-1]
 gi|301020523|ref|ZP_07184607.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 69-1]
 gi|301024394|ref|ZP_07188081.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 196-1]
 gi|301051189|ref|ZP_07198019.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 185-1]
 gi|301305345|ref|ZP_07211440.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 124-1]
 gi|301328605|ref|ZP_07221666.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 78-1]
 gi|301646325|ref|ZP_07246213.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 146-1]
 gi|306812669|ref|ZP_07446862.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           NC101]
 gi|307137509|ref|ZP_07496865.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           H736]
 gi|307311731|ref|ZP_07591371.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           W]
 gi|309783999|ref|ZP_07678643.1| ATP-dependent Clp protease adaptor ClpS family protein [Shigella
           dysenteriae 1617]
 gi|309795322|ref|ZP_07689740.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 145-7]
 gi|312969050|ref|ZP_07783257.1| ATP-dependent Clp protease adaptor ClpS family protein [Escherichia
           coli 2362-75]
 gi|312971008|ref|ZP_07785187.1| ATP-dependent Clp protease adaptor ClpS family protein [Escherichia
           coli 1827-70]
 gi|331641402|ref|ZP_08342537.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           H736]
 gi|331646149|ref|ZP_08347252.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           M605]
 gi|331651900|ref|ZP_08352919.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           M718]
 gi|331656953|ref|ZP_08357915.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           TA206]
 gi|331662295|ref|ZP_08363218.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           TA143]
 gi|331667255|ref|ZP_08368120.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           TA271]
 gi|331676669|ref|ZP_08377365.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           H591]
 gi|331682390|ref|ZP_08383009.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           H299]
 gi|67462206|sp|P0A8Q6|CLPS_ECOLI RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|67462207|sp|P0A8Q7|CLPS_ECOL6 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|67462208|sp|P0A8Q8|CLPS_ECO57 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|67462209|sp|P0A8Q9|CLPS_SHIFL RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|122424438|sp|Q1RE41|CLPS_ECOUT RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|123049335|sp|Q0TJG8|CLPS_ECOL5 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|123343208|sp|Q0T8P4|CLPS_SHIF8 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|123560128|sp|Q323M1|CLPS_SHIBS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|123562126|sp|Q32E01|CLPS_SHIDS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|123617606|sp|Q3Z3N8|CLPS_SHISS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|158512538|sp|A1A9B8|CLPS_ECOK1 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|167008653|sp|A7ZJU9|CLPS_ECO24 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|167008654|sp|A7ZYI5|CLPS_ECOHS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|189082474|sp|B1IWP1|CLPS_ECOLC RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|226706563|sp|B7MHI7|CLPS_ECO45 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|226706564|sp|B7NM96|CLPS_ECO7I RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|226706565|sp|B7M809|CLPS_ECO8A RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|226706566|sp|B7NAN2|CLPS_ECOLU RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|226706567|sp|B1LKM9|CLPS_ECOSM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|229889820|sp|B1X822|CLPS_ECODH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238066650|sp|B5YSH7|CLPS_ECO5E RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238066651|sp|B6I8V2|CLPS_ECOSE RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238691691|sp|B2TUJ7|CLPS_SHIB3 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|254763816|sp|B7LD74|CLPS_ECO55 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|254763817|sp|B7MRT8|CLPS_ECO81 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|259491246|sp|C4ZY53|CLPS_ECOBW RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|27573865|pdb|1MBU|C Chain C, Crystal Structure Analysis Of Clpsn Heterodimer
 gi|27573866|pdb|1MBU|D Chain D, Crystal Structure Analysis Of Clpsn Heterodimer
 gi|27573868|pdb|1MBV|B Chain B, Crystal Structure Analysis Of Clpsn Heterodimer Tetragonal
           Form
 gi|27573871|pdb|1MBX|C Chain C, Crystal Structure Analysis Of Clpsn With Transition Metal
           Ion Bound
 gi|27573872|pdb|1MBX|D Chain D, Crystal Structure Analysis Of Clpsn With Transition Metal
           Ion Bound
 gi|61679804|pdb|1R6O|C Chain C, Atp-Dependent Clp Protease Atp-Binding Subunit ClpaATP-
           Dependent Clp Protease Adaptor Protein Clps
 gi|61679805|pdb|1R6O|D Chain D, Atp-Dependent Clp Protease Atp-Binding Subunit ClpaATP-
           Dependent Clp Protease Adaptor Protein Clps
 gi|61679808|pdb|1R6Q|C Chain C, Clpns With Fragments
 gi|61679809|pdb|1R6Q|D Chain D, Clpns With Fragments
 gi|12513911|gb|AAG55263.1|AE005269_7 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26107307|gb|AAN79490.1|AE016758_94 Protein yljA [Escherichia coli CFT073]
 gi|1787108|gb|AAC73968.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           str. K-12 substr. MG1655]
 gi|4062464|dbj|BAA35600.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           str. K12 substr. W3110]
 gi|13360426|dbj|BAB34390.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|24051108|gb|AAN42474.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30040614|gb|AAP16346.1| hypothetical protein S0881 [Shigella flexneri 2a str. 2457T]
 gi|73854917|gb|AAZ87624.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81241744|gb|ABB62454.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81244779|gb|ABB65487.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|91071492|gb|ABE06373.1| ATP-dependent Clp protease adaptor protein [Escherichia coli UTI89]
 gi|110342674|gb|ABG68911.1| hypothetical protein YljA [Escherichia coli 536]
 gi|110614431|gb|ABF03098.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115512183|gb|ABJ00258.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157066084|gb|ABV05339.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           HS]
 gi|157078502|gb|ABV18210.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           E24377A]
 gi|169755644|gb|ACA78343.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           ATCC 8739]
 gi|169888375|gb|ACB02082.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170521621|gb|ACB19799.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           SMS-3-5]
 gi|187429046|gb|ACD08320.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella boydii
           CDC 3083-94]
 gi|187766992|gb|EDU30836.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4196]
 gi|188013696|gb|EDU51818.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4113]
 gi|188488435|gb|EDU63538.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           53638]
 gi|188998902|gb|EDU67888.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4076]
 gi|189354287|gb|EDU72706.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4401]
 gi|189361171|gb|EDU79590.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4486]
 gi|189371156|gb|EDU89572.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC869]
 gi|189375364|gb|EDU93780.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC508]
 gi|190902363|gb|EDV62101.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           B7A]
 gi|190907678|gb|EDV67273.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           F11]
 gi|192927707|gb|EDV82322.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           E22]
 gi|194413564|gb|EDX29845.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           B171]
 gi|194418585|gb|EDX34672.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella
           dysenteriae 1012]
 gi|194422371|gb|EDX38371.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           101-1]
 gi|208727783|gb|EDZ77384.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4206]
 gi|208732623|gb|EDZ81311.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4045]
 gi|208738112|gb|EDZ85795.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4042]
 gi|209160903|gb|ACI38336.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC4115]
 gi|209775128|gb|ACI85876.1| hypothetical protein ECs0967 [Escherichia coli]
 gi|209775130|gb|ACI85877.1| hypothetical protein ECs0967 [Escherichia coli]
 gi|209775132|gb|ACI85878.1| hypothetical protein ECs0967 [Escherichia coli]
 gi|209775134|gb|ACI85879.1| hypothetical protein ECs0967 [Escherichia coli]
 gi|209775136|gb|ACI85880.1| hypothetical protein ECs0967 [Escherichia coli]
 gi|209911389|dbj|BAG76463.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|217322649|gb|EEC31073.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. TW14588]
 gi|218351087|emb|CAU96791.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           55989]
 gi|218360235|emb|CAQ97785.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           IAI1]
 gi|218364554|emb|CAR02238.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           S88]
 gi|218370589|emb|CAR18396.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           IAI39]
 gi|218426227|emb|CAR07052.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           ED1a]
 gi|218431407|emb|CAR12285.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           UMN026]
 gi|222032610|emb|CAP75349.1| ATP-dependent Clp protease adaptor protein clpS [Escherichia coli
           LF82]
 gi|227838905|gb|EEJ49371.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           83972]
 gi|238863441|gb|ACR65439.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           BW2952]
 gi|242376696|emb|CAQ31409.1| specificity factor for ClpA-ClpP chaperone-protease complex
           [Escherichia coli BL21(DE3)]
 gi|253325133|gb|ACT29735.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972897|gb|ACT38568.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli B
           str. REL606]
 gi|253977111|gb|ACT42781.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           BL21(DE3)]
 gi|254591482|gb|ACT70843.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           O157:H7 str. TW14359]
 gi|257752822|dbj|BAI24324.1| regulatory protein ClpS for ClpA substrate specificity [Escherichia
           coli O26:H11 str. 11368]
 gi|257758279|dbj|BAI29776.1| regulatory protein ClpS for ClpA substrate specificity [Escherichia
           coli O103:H2 str. 12009]
 gi|257763410|dbj|BAI34905.1| regulatory protein ClpS for ClpA substrate specificity [Escherichia
           coli O111:H- str. 11128]
 gi|260449972|gb|ACX40394.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           DH1]
 gi|281600210|gb|ADA73194.1| ATP-dependent Clp protease adapter protein clpS [Shigella flexneri
           2002017]
 gi|284920735|emb|CBG33798.1| ATP-dependent Clp protease adaptor protein [Escherichia coli 042]
 gi|290761758|gb|ADD55719.1| ATP-dependent Clp protease adapter protein clpS [Escherichia coli
           O55:H7 str. CB9615]
 gi|291323998|gb|EFE63420.1| ATP-dependent Clp protease adapter protein ClpS [Escherichia coli
           B088]
 gi|291428775|gb|EFF01800.1| ClpS [Escherichia coli FVEC1412]
 gi|291434222|gb|EFF07195.1| ATP-dependent Clp protease adapter protein ClpS [Escherichia coli
           B185]
 gi|291469728|gb|EFF12212.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294493941|gb|ADE92697.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           IHE3034]
 gi|298279668|gb|EFI21176.1| ATP-dependent Clp protease adapter protein ClpS [Escherichia coli
           FVEC1302]
 gi|299880401|gb|EFI88612.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 196-1]
 gi|300297210|gb|EFJ53595.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 185-1]
 gi|300305516|gb|EFJ60036.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 200-1]
 gi|300318586|gb|EFJ68370.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 175-1]
 gi|300360365|gb|EFJ76235.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 198-1]
 gi|300398656|gb|EFJ82194.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 69-1]
 gi|300405449|gb|EFJ88987.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 84-1]
 gi|300409634|gb|EFJ93172.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 45-1]
 gi|300411938|gb|EFJ95248.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 115-1]
 gi|300421096|gb|EFK04407.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 182-1]
 gi|300450524|gb|EFK14144.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 116-1]
 gi|300459088|gb|EFK22581.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 21-1]
 gi|300463585|gb|EFK27078.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 187-1]
 gi|300523819|gb|EFK44888.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 119-7]
 gi|300530369|gb|EFK51431.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 107-1]
 gi|300839363|gb|EFK67123.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 124-1]
 gi|300844997|gb|EFK72757.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 78-1]
 gi|301075428|gb|EFK90234.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 146-1]
 gi|305853432|gb|EFM53871.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           NC101]
 gi|306908286|gb|EFN38785.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           W]
 gi|307552724|gb|ADN45499.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           ABU 83972]
 gi|307627693|gb|ADN71997.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           UM146]
 gi|308120972|gb|EFO58234.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 145-7]
 gi|308928142|gb|EFP73605.1| ATP-dependent Clp protease adaptor ClpS family protein [Shigella
           dysenteriae 1617]
 gi|309701158|emb|CBJ00458.1| ATP-dependent Clp protease adaptor protein [Escherichia coli ETEC
           H10407]
 gi|310336769|gb|EFQ01936.1| ATP-dependent Clp protease adaptor ClpS family protein [Escherichia
           coli 1827-70]
 gi|312286452|gb|EFR14365.1| ATP-dependent Clp protease adaptor ClpS family protein [Escherichia
           coli 2362-75]
 gi|312945399|gb|ADR26226.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|313650206|gb|EFS14618.1| ATP-dependent Clp protease adaptor ClpS family protein [Shigella
           flexneri 2a str. 2457T]
 gi|315060167|gb|ADT74494.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           W]
 gi|315135530|dbj|BAJ42689.1| ATP-dependent Clp protease adapter protein clpS [Escherichia coli
           DH1]
 gi|315257919|gb|EFU37887.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 85-1]
 gi|315287285|gb|EFU46696.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 110-3]
 gi|315291075|gb|EFU50438.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 153-1]
 gi|315296657|gb|EFU55952.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 16-3]
 gi|315619193|gb|EFU99772.1| ATP-dependent Clp protease adaptor ClpS family protein [Escherichia
           coli 3431]
 gi|320175322|gb|EFW50428.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella
           dysenteriae CDC 74-1112]
 gi|320180599|gb|EFW55528.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella boydii
           ATCC 9905]
 gi|320183180|gb|EFW58038.1| ATP-dependent Clp protease adaptor protein ClpS [Shigella flexneri
           CDC 796-83]
 gi|320192633|gb|EFW67274.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. EC1212]
 gi|320196624|gb|EFW71247.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           WV_060327]
 gi|320202276|gb|EFW76847.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           EC4100B]
 gi|320637752|gb|EFX07544.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. G5101]
 gi|320642875|gb|EFX12076.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H- str. 493-89]
 gi|320648332|gb|EFX16987.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H- str. H 2687]
 gi|320654170|gb|EFX22238.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320659794|gb|EFX27350.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320664264|gb|EFX31415.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323155745|gb|EFZ41914.1| ATP-dependent Clp protease adaptor ClpS family protein [Escherichia
           coli EPECa14]
 gi|323159506|gb|EFZ45486.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Escherichia coli E128010]
 gi|323165818|gb|EFZ51604.1| ATP-dependent Clp protease adaptor ClpS family protein [Shigella
           sonnei 53G]
 gi|323172148|gb|EFZ57786.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Escherichia coli LT-68]
 gi|323175497|gb|EFZ61092.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Escherichia coli 1180]
 gi|323185154|gb|EFZ70519.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Escherichia coli 1357]
 gi|323379276|gb|ADX51544.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           KO11]
 gi|323937988|gb|EGB34250.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           E1520]
 gi|323942798|gb|EGB38963.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           E482]
 gi|323947161|gb|EGB43171.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           H120]
 gi|323953415|gb|EGB49281.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           H252]
 gi|323958183|gb|EGB53892.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           H263]
 gi|323962994|gb|EGB58566.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           H489]
 gi|323967317|gb|EGB62740.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           M863]
 gi|323969619|gb|EGB64906.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           TA007]
 gi|323976732|gb|EGB71820.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           TW10509]
 gi|324009833|gb|EGB79052.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 57-2]
 gi|324013007|gb|EGB82226.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 60-1]
 gi|324019029|gb|EGB88248.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           MS 117-3]
 gi|324116095|gb|EGC10019.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           E1167]
 gi|326338224|gb|EGD62053.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. 1125]
 gi|326346201|gb|EGD69939.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O157:H7 str. 1044]
 gi|327253669|gb|EGE65298.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Escherichia coli STEC_7v]
 gi|330910663|gb|EGH39173.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           AA86]
 gi|331038200|gb|EGI10420.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           H736]
 gi|331044901|gb|EGI17028.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           M605]
 gi|331050178|gb|EGI22236.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           M718]
 gi|331055201|gb|EGI27210.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           TA206]
 gi|331060717|gb|EGI32681.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           TA143]
 gi|331065611|gb|EGI37504.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           TA271]
 gi|331075358|gb|EGI46656.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           H591]
 gi|331080021|gb|EGI51200.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           H299]
 gi|332091077|gb|EGI96167.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Shigella dysenteriae 155-74]
 gi|332097186|gb|EGJ02169.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Shigella boydii 3594-74]
 gi|332104576|gb|EGJ07922.1| regulatory protein for ClpA substrate specificity [Shigella sp. D9]
          Length = 106

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|170769198|ref|ZP_02903651.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia
           albertii TW07627]
 gi|170121850|gb|EDS90781.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia
           albertii TW07627]
          Length = 106

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E R    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFEQLAEERVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|33593716|ref|NP_881360.1| ATP-dependent Clp protease adaptor protein ClpS [Bordetella
           pertussis Tohama I]
 gi|39931026|sp|Q7VVC1|CLPS_BORPE RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|33563789|emb|CAE43031.1| hypothetical protein BP2756 [Bordetella pertussis Tohama I]
          Length = 104

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 41  DNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
           D   D  V     +   P +Y+V+L+ND+YTPMEFV+ VLQ FF K+ E A  IML+VHH
Sbjct: 6   DTQHDVVVEKQPARTAPPPMYQVVLLNDDYTPMEFVVKVLQKFFGKNSEDATRIMLQVHH 65

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CGVY  ++A  ++ QV  Y+R  Q+PLQCIME 
Sbjct: 66  EGRAVCGVYPRDLAATRIAQVSQYARARQHPLQCIMEP 103


>gi|323496571|ref|ZP_08101624.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sinaloensis
           DSM 21326]
 gi|323318317|gb|EGA71275.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sinaloensis
           DSM 21326]
          Length = 106

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                D      +K++ P +Y V+L ND+YTPM+FVI +L+ FF  D + A  +MLKVH+
Sbjct: 8   VTPDSDLLELEKTKIKPPSMYNVVLNNDDYTPMDFVIEILERFFSMDEDKATQVMLKVHY 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CG +  E+AE KV QV  YS+++++PL C MEQ
Sbjct: 68  EGKAICGTFTAEVAETKVAQVTMYSKENEHPLLCTMEQ 105


>gi|149376383|ref|ZP_01894146.1| ATP-dependent Clp protease adaptor protein ClpS [Marinobacter
           algicola DG893]
 gi|149359397|gb|EDM47858.1| ATP-dependent Clp protease adaptor protein ClpS [Marinobacter
           algicola DG893]
          Length = 119

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
           +       + +         ++ P  +RVLL+ND+YTPM+FV+ VL  FF  + E A  +
Sbjct: 15  EDDQPGHQDDVSVAPE-KPALKRPARFRVLLLNDDYTPMDFVVDVLMKFFGMNEEKATQV 73

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH QG   CGVY  +IAE K  QV  YS + ++PL C +E+
Sbjct: 74  MLLVHTQGKAVCGVYTRDIAETKAAQVNQYSSECEHPLLCEIER 117


>gi|161503926|ref|YP_001571038.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. arizonae serovar 62:z4,z23:-- str.
           RSK2980]
 gi|189082476|sp|A9MI06|CLPS_SALAR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|160865273|gb|ABX21896.1| hypothetical protein SARI_02017 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 106

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 63/97 (64%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D     E      ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLVEDDLRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVEMVNQYARENEHPLLCTLEK 105


>gi|323190703|gb|EFZ75972.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Escherichia coli RN587/1]
          Length = 106

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVTMVNKYARENEHPLLCTLEK 105


>gi|281178016|dbj|BAI54346.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 106

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPM+FVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMDFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|291616886|ref|YP_003519628.1| ClpS [Pantoea ananatis LMG 20103]
 gi|291151916|gb|ADD76500.1| ClpS [Pantoea ananatis LMG 20103]
 gi|327393314|dbj|BAK10736.1| ATP-dependent Clp protease adaptor protein ClpS [Pantoea ananatis
           AJ13355]
          Length = 106

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 60/89 (67%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
           +    ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +MLKVH+ G   CGV+
Sbjct: 17  KVREGLKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLKVHYHGKAICGVF 76

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             E+AE K  QV NY+R + +PL C +E+
Sbjct: 77  TAEVAETKAAQVNNYARDNHHPLLCTLEK 105


>gi|91793189|ref|YP_562840.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           denitrificans OS217]
 gi|122968755|sp|Q12N59|CLPS_SHEDO RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|91715191|gb|ABE55117.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           denitrificans OS217]
          Length = 102

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 64/92 (69%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
           ++ R  S++  P +Y+V+L ND+YTPM+FVI VL  FF K    A  IML +HHQG G C
Sbjct: 10  TKQRIESELMPPSMYKVILNNDDYTPMDFVIEVLARFFDKHEPQATDIMLTIHHQGKGIC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           GVY + IAE KV QV  ++R++Q+PL C +E+
Sbjct: 70  GVYPFGIAETKVLQVNQFARENQHPLLCTLEK 101


>gi|15805613|ref|NP_294309.1| ATP-dependent Clp protease adaptor protein ClpS [Deinococcus
           radiodurans R1]
 gi|6458284|gb|AAF10166.1|AE001917_3 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 139

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/126 (32%), Positives = 70/126 (55%), Gaps = 5/126 (3%)

Query: 13  VKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPM 72
               G   ++  +          G         ++    ++ + P+L+RVLL+ND+YTPM
Sbjct: 15  PLGGGARPILGAMTRPTIPPGPPG-----AEGRTQTLERTETKKPRLWRVLLLNDDYTPM 69

Query: 73  EFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQ 132
           ++V+ VL+ FF K  + A+ IML VHH+G G  GVY  ++AE KV QV  ++++  +PL+
Sbjct: 70  DYVVQVLEQFFRKTEQEAELIMLAVHHKGQGVAGVYTRDVAETKVAQVTAHAQREGHPLR 129

Query: 133 CIMEQK 138
            + E +
Sbjct: 130 VVAEPE 135


>gi|163856974|ref|YP_001631272.1| ATP-dependent Clp protease adaptor protein ClpS [Bordetella petrii
           DSM 12804]
 gi|229889825|sp|A9IQ03|CLPS_BORPD RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|163260702|emb|CAP43004.1| hypothetical protein Bpet2662 [Bordetella petrii]
          Length = 104

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/98 (48%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 41  DNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
           D   D  V  +  +   P +Y+V+L+ND+YTPMEFV+ VLQ FF K+ E A  IML+VHH
Sbjct: 6   DTQHDVAVEKAPARTAPPPMYQVVLLNDDYTPMEFVVKVLQKFFGKNQEDATRIMLQVHH 65

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G G CGVY  ++A  ++ QV  Y+R  Q+PLQC+ME 
Sbjct: 66  EGRGTCGVYPRDVAATRIAQVAQYARARQHPLQCVMEP 103


>gi|193071768|ref|ZP_03052664.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           E110019]
 gi|192954925|gb|EDV85432.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           E110019]
          Length = 106

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/105 (45%), Positives = 69/105 (65%), Gaps = 2/105 (1%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
                 +FD   + +VR +  ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  
Sbjct: 3   KTNDWLDFDQVAEEKVRDA--LKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQ 60

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +ML VH+QG   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 61  LMLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|325526418|gb|EGD04006.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           TJI49]
          Length = 104

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/95 (50%), Positives = 67/95 (70%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R   K++ P +Y+V+L+ND++TPMEFV+ V+Q +F KD ETA  IMLKVH +G 
Sbjct: 9   DSTVLERKEQKLKPPSMYKVVLLNDDFTPMEFVVMVVQEYFKKDRETATQIMLKVHREGR 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 69  GVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|269139553|ref|YP_003296254.1| ATP-dependent Clp protease adaptor protein [Edwardsiella tarda
           EIB202]
 gi|267985214|gb|ACY85043.1| ATP-dependent Clp protease adaptor protein [Edwardsiella tarda
           EIB202]
 gi|304559441|gb|ADM42105.1| ATP-dependent Clp protease adaptor protein ClpS [Edwardsiella tarda
           FL6-60]
          Length = 106

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 45/92 (48%), Positives = 60/92 (65%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E R    V+ P LY V+L ND+YTPMEFVI VLQ FF  D E A  +ML VH++G   C
Sbjct: 14  VEDRTRRAVKPPSLYSVILNNDDYTPMEFVIEVLQKFFAYDIERATQLMLTVHYKGKAVC 73

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           GV+  E+AE KV  +  Y+R +++PL C +E+
Sbjct: 74  GVFTAEVAETKVALINRYARDNEHPLLCTLEK 105


>gi|78067320|ref|YP_370089.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           383]
 gi|107023457|ref|YP_621784.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           cenocepacia AU 1054]
 gi|115352618|ref|YP_774457.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           ambifaria AMMD]
 gi|116690539|ref|YP_836162.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           cenocepacia HI2424]
 gi|134296692|ref|YP_001120427.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           vietnamiensis G4]
 gi|161523956|ref|YP_001578968.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           multivorans ATCC 17616]
 gi|167585699|ref|ZP_02378087.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           ubonensis Bu]
 gi|170697705|ref|ZP_02888793.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           ambifaria IOP40-10]
 gi|170733880|ref|YP_001765827.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           cenocepacia MC0-3]
 gi|171319748|ref|ZP_02908836.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           ambifaria MEX-5]
 gi|172061479|ref|YP_001809131.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           ambifaria MC40-6]
 gi|189351283|ref|YP_001946911.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           multivorans ATCC 17616]
 gi|206561069|ref|YP_002231834.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           cenocepacia J2315]
 gi|221199250|ref|ZP_03572294.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           multivorans CGD2M]
 gi|221205848|ref|ZP_03578863.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           multivorans CGD2]
 gi|221211472|ref|ZP_03584451.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           multivorans CGD1]
 gi|254247420|ref|ZP_04940741.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           cenocepacia PC184]
 gi|254251618|ref|ZP_04944936.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           dolosa AUO158]
 gi|122322413|sp|Q0BCK0|CLPS_BURCM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|123371357|sp|Q1BU94|CLPS_BURCA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|123567808|sp|Q39DM1|CLPS_BURS3 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214725|sp|A0K9U2|CLPS_BURCH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214730|sp|A4JH39|CLPS_BURVG RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238687030|sp|A9AGM9|CLPS_BURM1 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238688602|sp|B1JXD0|CLPS_BURCC RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238692854|sp|B1YVB1|CLPS_BURA4 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238693085|sp|B4E904|CLPS_BURCJ RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|77968065|gb|ABB09445.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           383]
 gi|105893646|gb|ABF76811.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           cenocepacia AU 1054]
 gi|115282606|gb|ABI88123.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           ambifaria AMMD]
 gi|116648628|gb|ABK09269.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           cenocepacia HI2424]
 gi|124872196|gb|EAY63912.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           cenocepacia PC184]
 gi|124894227|gb|EAY68107.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           dolosa AUO158]
 gi|134139849|gb|ABO55592.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           vietnamiensis G4]
 gi|160341385|gb|ABX14471.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           multivorans ATCC 17616]
 gi|169817122|gb|ACA91705.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           cenocepacia MC0-3]
 gi|170137453|gb|EDT05693.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           ambifaria IOP40-10]
 gi|171095020|gb|EDT40043.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           ambifaria MEX-5]
 gi|171993996|gb|ACB64915.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           ambifaria MC40-6]
 gi|189335305|dbj|BAG44375.1| ATP-dependent Clp protease adaptor protein [Burkholderia
           multivorans ATCC 17616]
 gi|198037111|emb|CAR53032.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           cenocepacia J2315]
 gi|221168833|gb|EEE01301.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           multivorans CGD1]
 gi|221174686|gb|EEE07118.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           multivorans CGD2]
 gi|221180535|gb|EEE12938.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           multivorans CGD2M]
          Length = 104

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/95 (50%), Positives = 67/95 (70%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R   K++ P +Y+V+L+ND++TPMEFV+ V+Q +F KD ETA  IMLKVH +G 
Sbjct: 9   DSTVLERKQQKLKPPSMYKVVLLNDDFTPMEFVVMVVQEYFKKDRETATQIMLKVHREGR 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 69  GVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|215486012|ref|YP_002328443.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           O127:H6 str. E2348/69]
 gi|254763815|sp|B7UMX3|CLPS_ECO27 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|215264084|emb|CAS08426.1| regulatory protein for ClpA substrate specificity [Escherichia coli
           O127:H6 str. E2348/69]
          Length = 106

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFEQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|187925140|ref|YP_001896782.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           phytofirmans PsJN]
 gi|238689617|sp|B2T6J4|CLPS_BURPP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|187716334|gb|ACD17558.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           phytofirmans PsJN]
          Length = 104

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 67/95 (70%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R   K++ P +Y+V+L+ND++TPMEFV+ V+Q +F KD ETA  +MLKVH +G 
Sbjct: 9   DGTVLERQEKKLKPPSMYKVVLLNDDFTPMEFVVMVVQEYFNKDRETATQVMLKVHREGR 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 69  GVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|283784648|ref|YP_003364513.1| ATP-dependent Clp protease adaptor protein [Citrobacter rodentium
           ICC168]
 gi|282948102|emb|CBG87667.1| ATP-dependent Clp protease adaptor protein [Citrobacter rodentium
           ICC168]
          Length = 106

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/89 (48%), Positives = 62/89 (69%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
           +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+QG   CG++
Sbjct: 17  KVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGIF 76

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             E+AE KV  V  Y+R++++PL C +E+
Sbjct: 77  TAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|307130779|ref|YP_003882795.1| regulatory protein for ClpA substrate specificity [Dickeya dadantii
           3937]
 gi|306528308|gb|ADM98238.1| regulatory protein for ClpA substrate specificity [Dickeya dadantii
           3937]
          Length = 106

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 64/99 (64%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
                  ++   +  ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +ML VH
Sbjct: 7   GTQTDDLTKEHNAEALQPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLTVH 66

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           + G   CGVY+ E+AE KV QV  Y+R++++PL C +E+
Sbjct: 67  YHGKAICGVYSAEVAETKVAQVNRYARENEHPLLCTLEK 105


>gi|157146439|ref|YP_001453758.1| ATP-dependent Clp protease adaptor protein ClpS [Citrobacter koseri
           ATCC BAA-895]
 gi|166214733|sp|A8AIK9|CLPS_CITK8 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|157083644|gb|ABV13322.1| hypothetical protein CKO_02199 [Citrobacter koseri ATCC BAA-895]
          Length = 106

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLAEDKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|54293794|ref|YP_126209.1| hypothetical protein lpl0850 [Legionella pneumophila str. Lens]
 gi|148360536|ref|YP_001251743.1| ATP-dependent Clp protease adaptor protein [Legionella pneumophila
           str. Corby]
 gi|296106398|ref|YP_003618098.1| ATP-dependent Clp protease adaptor protein ClpS [Legionella
           pneumophila 2300/99 Alcoy]
 gi|67460217|sp|Q5WY89|CLPS_LEGPL RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214737|sp|A5IG97|CLPS_LEGPC RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|53753626|emb|CAH15084.1| hypothetical protein lpl0850 [Legionella pneumophila str. Lens]
 gi|148282309|gb|ABQ56397.1| ATP-dependent Clp protease adaptor protein [Legionella pneumophila
           str. Corby]
 gi|295648299|gb|ADG24146.1| ATP-dependent Clp protease adaptor protein ClpS [Legionella
           pneumophila 2300/99 Alcoy]
 gi|307609611|emb|CBW99113.1| hypothetical protein LPW_08981 [Legionella pneumophila 130b]
          Length = 111

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 43/96 (44%), Positives = 65/96 (67%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             +     S+ ++ P+ Y+VLL+ND+YTPM+FV+ VL++FF+ + E A  +ML+VH QG 
Sbjct: 16  DTELSTEISTAIKRPRKYKVLLLNDDYTPMDFVVEVLKHFFHLNEEVAIQVMLQVHFQGK 75

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G CGV+  +IAE KV  V  Y+R +Q+PL   ME +
Sbjct: 76  GVCGVFTRDIAETKVALVNEYARMNQHPLLSSMEPE 111


>gi|260550322|ref|ZP_05824534.1| substrate modulator for ClpAP [Acinetobacter sp. RUH2624]
 gi|260406634|gb|EEX00115.1| substrate modulator for ClpAP [Acinetobacter sp. RUH2624]
          Length = 137

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 65/109 (59%), Gaps = 1/109 (0%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET 89
                     D+  +  V+ +  +++ P LY V+L+ND+YTPM+FVI +LQ +F  + + 
Sbjct: 28  NPRLSDSQNEDHDGEIVVQTAPPELKRPPLYAVVLLNDDYTPMDFVIEILQQYFAMNLDQ 87

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           A  +ML VH++G G  GVY  +IAE K N V NY+R   +PL C ++ K
Sbjct: 88  ATQVMLTVHYEGKGTAGVYPRDIAETKANLVNNYARSQGHPLLCQIKPK 136


>gi|126174686|ref|YP_001050835.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           OS155]
 gi|153000985|ref|YP_001366666.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           OS185]
 gi|160875698|ref|YP_001555014.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           OS195]
 gi|217973055|ref|YP_002357806.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           OS223]
 gi|304409063|ref|ZP_07390684.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           OS183]
 gi|307303066|ref|ZP_07582821.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           BA175]
 gi|166214743|sp|A3D5F3|CLPS_SHEB5 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214744|sp|A6WP64|CLPS_SHEB8 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|189082478|sp|A9L4G4|CLPS_SHEB9 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|254763824|sp|B8E950|CLPS_SHEB2 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|125997891|gb|ABN61966.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           OS155]
 gi|151365603|gb|ABS08603.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           OS185]
 gi|160861220|gb|ABX49754.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           OS195]
 gi|217498190|gb|ACK46383.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           OS223]
 gi|304352884|gb|EFM17281.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           OS183]
 gi|306913426|gb|EFN43848.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           BA175]
 gi|315267887|gb|ADT94740.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella baltica
           OS678]
          Length = 102

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 66/92 (71%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E R  S++  P +Y+V+L ND+YTPM+FVI VLQ FF K+ + A  IML +HHQG G C
Sbjct: 10  VEERVESELMPPSMYKVVLNNDDYTPMDFVIEVLQVFFRKNEQEATDIMLTIHHQGKGIC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G++ + IAE KV QV  ++RQ+Q+PL C +E+
Sbjct: 70  GIFPFGIAETKVIQVNQFARQNQHPLLCSLEK 101


>gi|167835724|ref|ZP_02462607.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           thailandensis MSMB43]
          Length = 104

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 67/95 (70%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R   K++ P +Y+V+L+ND++TPMEFV+ ++Q +F KD ETA  IMLKVH +G 
Sbjct: 9   DSTVLERKEQKLKPPSMYKVVLLNDDFTPMEFVVMIVQEYFRKDRETATQIMLKVHREGR 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 69  GVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|307545652|ref|YP_003898131.1| ATP-dependent Clp protease adaptor protein ClpS [Halomonas elongata
           DSM 2581]
 gi|307217676|emb|CBV42946.1| ATP-dependent Clp protease adaptor protein ClpS [Halomonas elongata
           DSM 2581]
          Length = 121

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 3/117 (2%)

Query: 20  ALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL 79
            L  +              + D  + S      ++  P +Y+V+L ND++TPMEFV+ VL
Sbjct: 4   RLAPYRAGMTRPPEPDEEGDGDVAVQSS---EPELAHPPMYKVVLHNDDFTPMEFVVEVL 60

Query: 80  QNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           Q FF+ D ETA  IML VH QG   CG++  +IAE K +QV  Y+R+ Q+PL C +E
Sbjct: 61  QTFFHMDSETAVQIMLAVHTQGKATCGIFTRDIAETKSHQVNQYARECQHPLLCDIE 117


>gi|238753481|ref|ZP_04614844.1| ATP-dependent Clp protease adapter protein clpS [Yersinia ruckeri
           ATCC 29473]
 gi|238708434|gb|EEQ00789.1| ATP-dependent Clp protease adapter protein clpS [Yersinia ruckeri
           ATCC 29473]
          Length = 106

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 63/104 (60%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                  +     + +    ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GNNNDWLNFEHLVKDKQIDALKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH++G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 62  MLNVHYKGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEK 105


>gi|52841053|ref|YP_094852.1| ATP-dependent Clp protease adaptor protein ClpS [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|54296838|ref|YP_123207.1| ATP-dependent Clp protease adaptor protein ClpS [Legionella
           pneumophila str. Paris]
 gi|67460221|sp|Q5X6T6|CLPS_LEGPA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|67460231|sp|Q5ZXB5|CLPS_LEGPH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|52628164|gb|AAU26905.1| hypothetical protein lpg0817 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53750623|emb|CAH12030.1| hypothetical protein lpp0879 [Legionella pneumophila str. Paris]
          Length = 111

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 43/96 (44%), Positives = 65/96 (67%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             +     S+ ++ P+ Y+VLL+ND+YTPM+FV+ VL++FF+ + E A  +ML+VH QG 
Sbjct: 16  DTELSTEISTAIKRPRKYKVLLLNDDYTPMDFVVEVLKHFFHLNEEVAIQVMLQVHFQGK 75

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G CGV+  +IAE KV  V  Y+R +Q+PL   ME +
Sbjct: 76  GVCGVFTRDIAETKVALVNEYARMNQHPLLSSMEPE 111


>gi|330818077|ref|YP_004361782.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           gladioli BSR3]
 gi|327370470|gb|AEA61826.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           gladioli BSR3]
          Length = 104

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 70/111 (63%), Gaps = 8/111 (7%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           MA     +              R   K++ P +Y+V+L+ND++TPMEFV+ V+Q +F KD
Sbjct: 1   MAIIPDKQDN--------TVLERSEQKLKPPSMYKVVLLNDDFTPMEFVVMVVQEYFKKD 52

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            ETA  IMLKVH +G G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 53  RETATQIMLKVHREGRGVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|152983115|ref|YP_001354205.1| ATP-dependent Clp protease adaptor protein ClpS [Janthinobacterium
           sp. Marseille]
 gi|254763819|sp|A6T108|CLPS_JANMA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|151283192|gb|ABR91602.1| ATP-dependent Clp protease adaptor protein ClpS [Janthinobacterium
           sp. Marseille]
          Length = 102

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 49/101 (48%), Positives = 69/101 (68%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +A   +     +R   K++ P +Y+VLL+ND+YTPMEFV+ +LQ +F KD ETA  IML 
Sbjct: 1   MAIKHDDGTVLMRQEQKLKPPSMYQVLLLNDDYTPMEFVVLILQEYFSKDRETATQIMLM 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VH  G G CGVY  +IA  KV  V+N++R+  +PLQC+ME+
Sbjct: 61  VHRDGKGICGVYPKDIASTKVELVLNHARKAGHPLQCVMEE 101


>gi|294140597|ref|YP_003556575.1| ATP-dependent Clp protease adaptor protein clpS [Shewanella
           violacea DSS12]
 gi|293327066|dbj|BAJ01797.1| ATP-dependent Clp protease adaptor protein clpS [Shewanella
           violacea DSS12]
          Length = 102

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 45/92 (48%), Positives = 66/92 (71%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E R  S++  P +Y+V+L ND+YTPM+FVI +LQ FF K+ + A  IML +HHQG G C
Sbjct: 10  VEERVESELMPPSMYKVVLNNDDYTPMDFVIEILQFFFKKNEQEATDIMLAIHHQGKGIC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G++ + IAE KV QV  ++RQ+++PL C +E+
Sbjct: 70  GIFPFGIAETKVAQVNQFARQNEHPLLCSLEK 101


>gi|90413212|ref|ZP_01221207.1| ATP-dependent Clp protease adaptor protein ClpS [Photobacterium
           profundum 3TCK]
 gi|90325764|gb|EAS42222.1| ATP-dependent Clp protease adaptor protein ClpS [Photobacterium
           profundum 3TCK]
          Length = 106

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 44/96 (45%), Positives = 65/96 (67%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              D   +  ++V+ P +Y+V+L ND+YTPM+FVI VLQ FF  D E A  +ML VH++G
Sbjct: 10  PESDVLDKEEAQVKPPAMYKVVLNNDDYTPMDFVIEVLQKFFSMDMEKATQLMLNVHYEG 69

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
              CG +  E+AE KV QVM ++R++++PL C ME+
Sbjct: 70  KAICGTFTAEVAETKVAQVMMHARENEHPLLCTMEK 105


>gi|209517459|ref|ZP_03266300.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           H160]
 gi|295677449|ref|YP_003605973.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           CCGE1002]
 gi|209502113|gb|EEA02128.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           H160]
 gi|295437292|gb|ADG16462.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           CCGE1002]
          Length = 104

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/95 (48%), Positives = 67/95 (70%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R   K++ P +Y+V+L+ND++TPMEFV+ ++Q +F KD ETA  +MLKVH +G 
Sbjct: 9   DGTVLERQEQKLKPPSMYKVVLLNDDFTPMEFVVMIVQEYFNKDRETATQVMLKVHREGR 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 69  GVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|50121581|ref|YP_050748.1| ATP-dependent Clp protease adaptor protein ClpS [Pectobacterium
           atrosepticum SCRI1043]
 gi|67460269|sp|Q6D3T7|CLPS_ERWCT RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|49612107|emb|CAG75557.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 106

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 64/104 (61%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                   +   +  +   K++ P +Y V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GNNRTWSQSESLTADQQKEKLQPPSMYNVVLNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+QG   CGV++ E+AE KV QV  Y+R+++ PL C +E+
Sbjct: 62  MLTVHYQGKAICGVFSAEVAETKVVQVNRYARENEQPLLCTLEK 105


>gi|237707137|ref|ZP_04537618.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia sp.
           3_2_53FAA]
 gi|226898347|gb|EEH84606.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia sp.
           3_2_53FAA]
          Length = 106

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|16759817|ref|NP_455434.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|16764306|ref|NP_459921.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|29142410|ref|NP_805752.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|56414003|ref|YP_151078.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|62179469|ref|YP_215886.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161614825|ref|YP_001588790.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167550381|ref|ZP_02344138.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|167992164|ref|ZP_02573262.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168230818|ref|ZP_02655876.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168236855|ref|ZP_02661913.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168240792|ref|ZP_02665724.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168263570|ref|ZP_02685543.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168466528|ref|ZP_02700390.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|168819925|ref|ZP_02831925.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|194444791|ref|YP_002040145.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194450386|ref|YP_002044938.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194470024|ref|ZP_03076008.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194734739|ref|YP_002114001.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197247594|ref|YP_002145862.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197264687|ref|ZP_03164761.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197362926|ref|YP_002142563.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|198243258|ref|YP_002214872.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|204929828|ref|ZP_03220849.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|207856339|ref|YP_002242990.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|213021515|ref|ZP_03335962.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213052429|ref|ZP_03345307.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213419934|ref|ZP_03353000.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213428022|ref|ZP_03360772.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213581370|ref|ZP_03363196.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-0664]
 gi|213620715|ref|ZP_03373498.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-2068]
 gi|213649852|ref|ZP_03379905.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
 gi|213865354|ref|ZP_03387473.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|224582756|ref|YP_002636554.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|238913424|ref|ZP_04657261.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
 gi|289825000|ref|ZP_06544363.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|54036861|sp|P67650|CLPS_SALTI RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|54041058|sp|P67649|CLPS_SALTY RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|67460139|sp|Q57R56|CLPS_SALCH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|67460197|sp|Q5PGK0|CLPS_SALPA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|189082477|sp|A9N7Z5|CLPS_SALPB RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238689929|sp|B5BBT0|CLPS_SALPK RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238690018|sp|B5F127|CLPS_SALA4 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238690349|sp|B5FQ21|CLPS_SALDC RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238690424|sp|B5QYM8|CLPS_SALEP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238690613|sp|B4TD06|CLPS_SALHS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238693573|sp|B4T0G6|CLPS_SALNS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238693662|sp|B4TRR1|CLPS_SALSV RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|254763823|sp|C0PXR3|CLPS_SALPC RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|25321103|pir||AH0609 conserved hypothetical protein STY0942 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16419456|gb|AAL19880.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16502110|emb|CAD05346.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138040|gb|AAO69601.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56128260|gb|AAV77766.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62127102|gb|AAX64805.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161364189|gb|ABX67957.1| hypothetical protein SPAB_02578 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403454|gb|ACF63676.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194408690|gb|ACF68909.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194456388|gb|EDX45227.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194710241|gb|ACF89462.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195630880|gb|EDX49466.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197094403|emb|CAR59919.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197211297|gb|ACH48694.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197242942|gb|EDY25562.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197290191|gb|EDY29548.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197937774|gb|ACH75107.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|204320822|gb|EDZ06023.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205324512|gb|EDZ12351.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205329607|gb|EDZ16371.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205334903|gb|EDZ21667.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205340436|gb|EDZ27200.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|205343076|gb|EDZ29840.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205347686|gb|EDZ34317.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|206708142|emb|CAR32435.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224467283|gb|ACN45113.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|261246161|emb|CBG23965.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992673|gb|ACY87558.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301157489|emb|CBW16979.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911934|dbj|BAJ35908.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|320085181|emb|CBY94968.1| ATP-dependent Clp protease adapter protein clpS [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|321223269|gb|EFX48338.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|322616381|gb|EFY13290.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322619631|gb|EFY16506.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322622673|gb|EFY19518.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322628586|gb|EFY25373.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322631522|gb|EFY28278.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322637049|gb|EFY33752.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322641753|gb|EFY38389.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322644455|gb|EFY40995.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649575|gb|EFY46006.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322654123|gb|EFY50446.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322658038|gb|EFY54305.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322663512|gb|EFY59714.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322670248|gb|EFY66388.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322671484|gb|EFY67606.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322676840|gb|EFY72907.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322682765|gb|EFY78784.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322686444|gb|EFY82426.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|322713939|gb|EFZ05510.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
 gi|323129211|gb|ADX16641.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|323196102|gb|EFZ81265.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323196752|gb|EFZ81896.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323202968|gb|EFZ88002.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323209009|gb|EFZ93946.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323211914|gb|EFZ96742.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323215154|gb|EFZ99899.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323222357|gb|EGA06735.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323226878|gb|EGA11061.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323229832|gb|EGA13955.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323233057|gb|EGA17153.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323240792|gb|EGA24834.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323243109|gb|EGA27129.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323247430|gb|EGA31386.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323251652|gb|EGA35519.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323257360|gb|EGA41058.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323261949|gb|EGA45515.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323267964|gb|EGA51443.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323271969|gb|EGA55384.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
 gi|326622625|gb|EGE28970.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
          Length = 106

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 63/97 (64%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D     E      ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLVEDSVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|319944074|ref|ZP_08018353.1| ATP-dependent Clp protease [Lautropia mirabilis ATCC 51599]
 gi|319742651|gb|EFV95059.1| ATP-dependent Clp protease [Lautropia mirabilis ATCC 51599]
          Length = 102

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/98 (46%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 41  DNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            N     +      ++ P LY+VLL+ND++TPM+FV+ VLQ FF    E A  +ML+VHH
Sbjct: 4   SNDPSVVLEREQLALKPPPLYKVLLLNDDFTPMDFVVQVLQKFFSMSLEKATDVMLQVHH 63

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G G CG++  +IA  KV QV  ++RQHQ+PLQC+ME+
Sbjct: 64  EGRGVCGMFPRDIALTKVEQVSGFARQHQHPLQCVMEE 101


>gi|152969471|ref|YP_001334580.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206576057|ref|YP_002239467.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella
           pneumoniae 342]
 gi|238893943|ref|YP_002918677.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella
           pneumoniae NTUH-K2044]
 gi|288936315|ref|YP_003440374.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella
           variicola At-22]
 gi|290510629|ref|ZP_06549999.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella sp.
           1_1_55]
 gi|329998510|ref|ZP_08303132.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella sp. MS
           92-3]
 gi|166214736|sp|A6T6X9|CLPS_KLEP7 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238066652|sp|B5XYB2|CLPS_KLEP3 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|150954320|gb|ABR76350.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206565115|gb|ACI06891.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella
           pneumoniae 342]
 gi|238546259|dbj|BAH62610.1| ATP-dependent Clp protease adaptor protein [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|288891024|gb|ADC59342.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella
           variicola At-22]
 gi|289777345|gb|EFD85343.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella sp.
           1_1_55]
 gi|328538655|gb|EGF64752.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella sp. MS
           92-3]
          Length = 105

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 75/106 (70%), Gaps = 2/106 (1%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+K+   +F++ +D EVR +  ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A 
Sbjct: 1   MSKRDWLDFEHLVDDEVRDA--IKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERAT 58

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH++G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 59  QLMLTVHYEGKAICGVFTAEVAETKVAMVNQYARENEHPLLCTLEK 104


>gi|85059079|ref|YP_454781.1| ATP-dependent Clp protease adaptor protein ClpS [Sodalis
           glossinidius str. 'morsitans']
 gi|123519578|sp|Q2NTZ9|CLPS_SODGM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|84779599|dbj|BAE74376.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 106

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 47/104 (45%), Positives = 66/104 (63%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
            K     D    +E +    VR P +Y+V+L+ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GKTSDRLDEQHLAEEQVKDAVRPPSMYKVILINDDYTPMEFVIDVLQKFFSYDVERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML+VH+QG   CG+Y  E+AE K   V  Y+R++++PL C +E+
Sbjct: 62  MLRVHYQGKAVCGIYTAEVAETKAVHVNRYARENEHPLLCTLEK 105


>gi|83721401|ref|YP_441318.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           thailandensis E264]
 gi|167561846|ref|ZP_02354762.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           oklahomensis EO147]
 gi|167569069|ref|ZP_02361943.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           oklahomensis C6786]
 gi|167580102|ref|ZP_02372976.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           thailandensis TXDOH]
 gi|167618167|ref|ZP_02386798.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           thailandensis Bt4]
 gi|257140007|ref|ZP_05588269.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           thailandensis E264]
 gi|123537862|sp|Q2T0I1|CLPS_BURTA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|83655226|gb|ABC39289.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           thailandensis E264]
          Length = 104

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 67/95 (70%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R   K++ P +Y+V+L+ND++TPMEFV+ ++Q +F KD ETA  IMLKVH +G 
Sbjct: 9   DSTVLERKEQKLKPPSMYKVVLLNDDFTPMEFVVMIVQEYFKKDRETATQIMLKVHREGR 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 69  GVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|262402498|ref|ZP_06079059.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sp. RC586]
 gi|262351280|gb|EEZ00413.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sp. RC586]
          Length = 106

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 44/98 (44%), Positives = 62/98 (63%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                D   +  + V+ P +Y V+L ND+YT M+FVI +L+ FF  D E A  +MLKVH+
Sbjct: 8   VSPDFDLLEKEKTAVKPPSMYHVVLNNDDYTSMDFVIEILERFFSMDIERATQVMLKVHY 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CG +  E+AE KV QV  YSR++++PL C MEQ
Sbjct: 68  EGKAICGTFTAEVAETKVAQVTMYSRENEHPLLCTMEQ 105


>gi|91784980|ref|YP_560186.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           xenovorans LB400]
 gi|170693565|ref|ZP_02884723.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           graminis C4D1M]
 gi|296157172|ref|ZP_06840008.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           Ch1-1]
 gi|307730769|ref|YP_003907993.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           CCGE1003]
 gi|323527132|ref|YP_004229285.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           CCGE1001]
 gi|122970195|sp|Q13UV5|CLPS_BURXL RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|91688934|gb|ABE32134.1| Putative ATP-dependent Clp protease adaptor protein ClpS
           [Burkholderia xenovorans LB400]
 gi|170141347|gb|EDT09517.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           graminis C4D1M]
 gi|295892508|gb|EFG72290.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           Ch1-1]
 gi|307585304|gb|ADN58702.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           CCGE1003]
 gi|323384134|gb|ADX56225.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia sp.
           CCGE1001]
          Length = 104

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 46/95 (48%), Positives = 67/95 (70%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R   K++ P +Y+V+L+ND++TPMEFV+ ++Q +F KD ETA  +MLKVH +G 
Sbjct: 9   DGTVLERQEKKLKPPSMYKVVLLNDDFTPMEFVVMIVQEYFNKDRETATQVMLKVHREGR 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 69  GVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|300716062|ref|YP_003740865.1| ATP-dependent Clp protease adaptor protein [Erwinia billingiae
           Eb661]
 gi|299061898|emb|CAX59014.1| ATP-dependent Clp protease adaptor protein [Erwinia billingiae
           Eb661]
          Length = 106

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 48/105 (45%), Positives = 68/105 (64%), Gaps = 2/105 (1%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
           N      F++  D ++R    ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  
Sbjct: 3   NTNDWLNFEHLADDKLREG--LKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDTERATQ 60

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +ML VH+QG   CGVY  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 61  LMLAVHYQGKAICGVYTAEVAETKVAHVNKYARENEHPLLCTLEK 105


>gi|253990327|ref|YP_003041683.1| ATP-dependent Clp protease adaptor protein ClpS [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253781777|emb|CAQ84940.1| atp-dependent clp protease adaptor protein clps [Photorhabdus
           asymbiotica]
          Length = 106

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 45/96 (46%), Positives = 62/96 (64%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           N    +     K++ P +Y+V+L ND+YTPMEFV+ VL+ FF  D E A  +ML VH+QG
Sbjct: 10  NKESVKDERQHKLQPPSMYQVILNNDDYTPMEFVVDVLRKFFSYDVERATQLMLDVHYQG 69

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
              CGVY  E+AE K  QV  Y+R+ Q+PL C +E+
Sbjct: 70  KAVCGVYTAEVAETKAAQVNMYAREQQHPLLCTLEK 105


>gi|134095622|ref|YP_001100697.1| ATP-dependent Clp protease adaptor protein ClpS [Herminiimonas
           arsenicoxydans]
 gi|254763818|sp|A4G7T9|CLPS_HERAR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|133739525|emb|CAL62576.1| ATP-dependent Clp protease adaptor protein ClpS [Herminiimonas
           arsenicoxydans]
          Length = 102

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 49/101 (48%), Positives = 69/101 (68%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +A   +     +R   K++ P +Y+VLL+ND+YTPMEFV+ +LQ +F KD ETA  IML 
Sbjct: 1   MAIKHDDGTVLMRQEQKLKPPSMYQVLLLNDDYTPMEFVVMILQEYFSKDRETATQIMLM 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VH  G G CGVY  +IA  KV  V+N++R+  +PLQC+ME+
Sbjct: 61  VHRDGKGICGVYPKDIASTKVELVLNHARKAGHPLQCVMEE 101


>gi|226939299|ref|YP_002794370.1| ATP-dependent Clp protease adaptor protein ClpS [Laribacter
           hongkongensis HLHK9]
 gi|226714223|gb|ACO73361.1| ATP-dependent Clp protease adaptor protein ClpS [Laribacter
           hongkongensis HLHK9]
          Length = 103

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 40/87 (45%), Positives = 63/87 (72%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
             +   P +Y+V+L+ND++TPM+FV+ VL+ FFY   E A  +MLK+H +G G CG +  
Sbjct: 15  KIRTAPPPMYKVVLLNDDFTPMDFVVIVLERFFYMGREQATQVMLKIHTEGRGICGTFTR 74

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ++A  KV+QV +Y+R H++PLQC+ME+
Sbjct: 75  DVAATKVSQVRDYARTHEHPLQCVMEE 101


>gi|268590195|ref|ZP_06124416.1| ATP-dependent Clp protease adaptor protein ClpS [Providencia
           rettgeri DSM 1131]
 gi|291314476|gb|EFE54929.1| ATP-dependent Clp protease adaptor protein ClpS [Providencia
           rettgeri DSM 1131]
          Length = 106

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 44/100 (44%), Positives = 63/100 (63%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
             F   +  +      ++ P +Y+VLL ND+YTPM+FV+ VLQ +F  D E A  IML V
Sbjct: 6   GTFKTDVIFKDEIEQTLQPPSMYKVLLNNDDYTPMDFVVEVLQKYFSFDEERATQIMLDV 65

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H QG G CG++  E+AE K  QV  ++R+H+YPL C +E+
Sbjct: 66  HIQGKGVCGIFTAEVAETKAAQVNTFAREHEYPLLCTIEK 105


>gi|218673814|ref|ZP_03523483.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium etli
           GR56]
          Length = 86

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 56/86 (65%), Positives = 74/86 (86%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           K + P LYRVLL+ND+YTPMEFVIH+L+ FF KD E+A  IML VH+ G+GECG++ YE+
Sbjct: 1   KTKKPNLYRVLLLNDDYTPMEFVIHILERFFQKDRESATRIMLHVHNHGVGECGIFTYEV 60

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQK 138
           AE KV+QVM+++RQHQ+PLQC+ME+K
Sbjct: 61  AETKVSQVMDFARQHQHPLQCVMEKK 86


>gi|17547184|ref|NP_520586.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia
           solanacearum GMI1000]
 gi|21542317|sp|Q8XWK9|CLPS_RALSO RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|17429486|emb|CAD16172.1| hypothetical atp-dependent clp protease adaptor protein clps
           [Ralstonia solanacearum GMI1000]
 gi|299065938|emb|CBJ37119.1| ATP-dependent Clp protease adapter protein clpS [Ralstonia
           solanacearum CMR15]
          Length = 108

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 64/96 (66%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           +      R    ++ P +Y+VLL+ND+YTPMEFV+ +LQ +F KD ETA  IML VH +G
Sbjct: 12  DAGTVLERKEQALKPPAMYKVLLLNDDYTPMEFVVMILQQYFSKDRETATQIMLTVHREG 71

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CG+Y  +IA  KV  V  ++RQ  +PLQC+ME+
Sbjct: 72  RGVCGIYTRDIAATKVELVSTHARQAGHPLQCVMEE 107


>gi|83746257|ref|ZP_00943310.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia
           solanacearum UW551]
 gi|207723598|ref|YP_002253997.1| atp-dependent clp protease adaptor protein clps [Ralstonia
           solanacearum MolK2]
 gi|207742558|ref|YP_002258950.1| atp-dependent clp protease adaptor protein clps [Ralstonia
           solanacearum IPO1609]
 gi|300690670|ref|YP_003751665.1| ATP-dependent Clp protease adapter protein clpS [Ralstonia
           solanacearum PSI07]
 gi|300703254|ref|YP_003744856.1| ATP-dependent clp protease adapter protein clps [Ralstonia
           solanacearum CFBP2957]
 gi|83727007|gb|EAP74132.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia
           solanacearum UW551]
 gi|206588800|emb|CAQ35763.1| atp-dependent clp protease adaptor protein clps [Ralstonia
           solanacearum MolK2]
 gi|206593951|emb|CAQ60878.1| atp-dependent clp protease adaptor protein clps [Ralstonia
           solanacearum IPO1609]
 gi|299070917|emb|CBJ42221.1| ATP-dependent Clp protease adapter protein clpS [Ralstonia
           solanacearum CFBP2957]
 gi|299077730|emb|CBJ50368.1| ATP-dependent Clp protease adapter protein clpS [Ralstonia
           solanacearum PSI07]
          Length = 108

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 64/96 (66%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           +      R    ++ P +Y+VLL+ND+YTPMEFV+ +LQ +F KD ETA  IML VH +G
Sbjct: 12  DAGTVLERKEQALKPPAMYKVLLLNDDYTPMEFVVMILQQYFSKDRETATQIMLTVHREG 71

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CG+Y  +IA  KV  V  ++RQ  +PLQC+ME+
Sbjct: 72  KGVCGIYTRDIAATKVELVSTHARQAGHPLQCVMEE 107


>gi|238920382|ref|YP_002933897.1| hypothetical protein NT01EI_2492 [Edwardsiella ictaluri 93-146]
 gi|259491247|sp|C5BEA1|CLPS_EDWI9 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238869951|gb|ACR69662.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 106

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 60/91 (65%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E +    V+ P LY V+L ND+YTPMEFVI VLQ FF  D E A  +ML VH++G   CG
Sbjct: 15  EDQTRRAVKPPSLYSVILNNDDYTPMEFVIEVLQTFFAYDIERATQLMLTVHYKGKAVCG 74

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           V+  E+AE KV  +  Y+R +++PL C +E+
Sbjct: 75  VFTAEVAETKVALINRYARDNEHPLLCTLEK 105


>gi|322832165|ref|YP_004212192.1| ATP-dependent Clp protease adaptor protein ClpS [Rahnella sp.
           Y9602]
 gi|321167366|gb|ADW73065.1| ATP-dependent Clp protease adaptor protein ClpS [Rahnella sp.
           Y9602]
          Length = 106

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 65/104 (62%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                  +    +  +   +V+ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GNNQDWLNFEHLAADKQKDEVKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML+VH++G   CGVY  E+AE KV  V  Y++++++PL C +E+
Sbjct: 62  MLQVHYRGKAICGVYTAEVAETKVAHVNEYAKENEHPLLCTLEK 105


>gi|205352155|ref|YP_002225956.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|238690486|sp|B5R8G5|CLPS_SALG2 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|205271936|emb|CAR36780.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326627199|gb|EGE33542.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 106

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 62/97 (63%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D     E      ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +M  VH+Q
Sbjct: 9   DFDQLVEDSVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMFAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|238028418|ref|YP_002912649.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           glumae BGR1]
 gi|237877612|gb|ACR29945.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           glumae BGR1]
          Length = 104

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 8/111 (7%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           MA     +              R   K++ P +Y+V+L+ND++TPMEFV+ V+Q +F KD
Sbjct: 1   MAIIPDKQDN--------TVLERSEQKLKPPSMYKVVLLNDDFTPMEFVVMVVQEYFKKD 52

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            ETA  IML+VH +G G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 53  RETATQIMLRVHREGRGVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|156934623|ref|YP_001438539.1| ATP-dependent Clp protease adaptor protein ClpS [Cronobacter
           sakazakii ATCC BAA-894]
 gi|260597283|ref|YP_003209854.1| ATP-dependent Clp protease adaptor protein ClpS [Cronobacter
           turicensis z3032]
 gi|166214735|sp|A7MEQ8|CLPS_ENTS8 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|156532877|gb|ABU77703.1| hypothetical protein ESA_02457 [Cronobacter sakazakii ATCC BAA-894]
 gi|260216460|emb|CBA29592.1| ATP-dependent Clp protease adapter protein clpS [Cronobacter
           turicensis z3032]
          Length = 106

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 46/103 (44%), Positives = 65/103 (63%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
           K  +  D    +E      ++ P +Y+V+L+ND+YTPMEFVI VLQ FF  D E A  +M
Sbjct: 3   KDKSWLDFDHLAEDDLREALKPPSMYKVILMNDDYTPMEFVIDVLQKFFSYDVERATQLM 62

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L VH+QG   CGV+  E+AE KV  V  Y+R++ +PL C +E+
Sbjct: 63  LTVHYQGKAICGVFTAEVAETKVALVNKYARENDHPLLCTLEK 105


>gi|317491428|ref|ZP_07949864.1| ATP-dependent Clp protease adaptor protein ClpS [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316920975|gb|EFV42298.1| ATP-dependent Clp protease adaptor protein ClpS [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 107

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 43/85 (50%), Positives = 61/85 (71%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           +V+ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +ML VH++G   CGV+  E+
Sbjct: 21  EVKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLTVHYKGKAICGVFTAEV 80

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           AE KV  V  Y+R++++PL C +E+
Sbjct: 81  AETKVAHVNRYARENEHPLLCTLEK 105


>gi|121594198|ref|YP_986094.1| ATP-dependent Clp protease adaptor protein ClpS [Acidovorax sp.
           JS42]
 gi|120606278|gb|ABM42018.1| ATP-dependent Clp protease adaptor protein ClpS [Acidovorax sp.
           JS42]
          Length = 135

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 45/122 (36%), Positives = 70/122 (57%), Gaps = 1/122 (0%)

Query: 17  GILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFV 75
             +  M+      + +       +D      +   + K + P++Y+V+++ND+YTPMEFV
Sbjct: 12  ARMKFMATTPPIPAPVPAPTPPSWDEGGSVVLERRTQKTQPPQMYQVVMLNDDYTPMEFV 71

Query: 76  IHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
           + VLQ FF KD E A  IMLK+H  G G CGVY  ++A  KV+QV+  + +  +PLQC+ 
Sbjct: 72  VVVLQEFFNKDREAATQIMLKIHLDGKGVCGVYTRDVAATKVDQVLEAAHKAGHPLQCLS 131

Query: 136 EQ 137
           E 
Sbjct: 132 EP 133


>gi|37525540|ref|NP_928884.1| ATP-dependent Clp protease adaptor protein ClpS [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|39930943|sp|Q7N6F7|CLPS_PHOLL RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|36784968|emb|CAE13886.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 106

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 61/93 (65%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
             +     K++ P +Y+V+L ND+YTPMEFV+ VL+ FF  D E A  +ML VH+QG   
Sbjct: 13  SVKDERQQKLQPPSMYQVILNNDDYTPMEFVVDVLRKFFSYDIERATQLMLDVHYQGKAV 72

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           CGVY  E+AE K  QV  Y++++ +PL C +E+
Sbjct: 73  CGVYTAEVAETKAAQVNMYAKEYGHPLLCTLEK 105


>gi|259908937|ref|YP_002649293.1| ATP-dependent Clp protease adaptor protein ClpS [Erwinia pyrifoliae
           Ep1/96]
 gi|224964559|emb|CAX56072.1| ATP-dependent Clp protease adaptor protein [Erwinia pyrifoliae
           Ep1/96]
 gi|283478941|emb|CAY74857.1| ATP-dependent Clp protease adaptor protein ClpS [Erwinia pyrifoliae
           DSM 12163]
          Length = 106

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 60/89 (67%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
           +    ++ P +Y+V+L ND++TPMEFVI VLQ FF  D E A  +ML VH+QG   CGV+
Sbjct: 17  KVREALKPPSMYKVILNNDDFTPMEFVIDVLQKFFSYDIERATQLMLTVHYQGKAVCGVF 76

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             E+AE KV  V  Y+R +++PL C +E+
Sbjct: 77  TAEVAETKVAHVNKYARDNEHPLLCTLEK 105


>gi|262041017|ref|ZP_06014237.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|259041633|gb|EEW42684.1| ATP-dependent Clp protease adaptor protein ClpS [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
          Length = 105

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 74/106 (69%), Gaps = 2/106 (1%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+K+   +F++ +D EVR +  ++ P +Y+V+ VND+YTPMEFVI VLQ FF  D E A 
Sbjct: 1   MSKRDWLDFEHLVDDEVRDA--IKPPSMYKVIFVNDDYTPMEFVIDVLQKFFSYDVERAT 58

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH++G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 59  QLMLTVHYEGKAICGVFTAEVAETKVAMVNQYARENEHPLLCTLEK 104


>gi|161897896|ref|YP_433586.2| ATP-dependent Clp protease adaptor protein ClpS [Hahella chejuensis
           KCTC 2396]
          Length = 126

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 58/106 (54%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
            ++           +       ++ P +Y+V+++ND+YTPM+FV+ VL  FF      A 
Sbjct: 19  EDEGNQDGDHPGSLALAPEKPALKRPSMYQVVMLNDDYTPMDFVVEVLIRFFNMSEPKAT 78

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH QG   CGV+  +IAE K  QV  YS + ++PL C +E+
Sbjct: 79  QVMLAVHTQGRAVCGVFTRDIAESKAAQVNQYSSECEHPLLCEIER 124


>gi|163751226|ref|ZP_02158454.1| hypothetical protein KT99_13792 [Shewanella benthica KT99]
 gi|161328940|gb|EDQ00014.1| hypothetical protein KT99_13792 [Shewanella benthica KT99]
          Length = 102

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 66/92 (71%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E R  S++  P +Y+V+L ND+YTPM+FVI +LQ FF K+ + A  IML +HHQG G C
Sbjct: 10  VEERVESELMPPSMYKVVLNNDDYTPMDFVIEILQLFFKKNEQEATDIMLAIHHQGKGIC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           GV+ + IAE KV QV  ++RQ+++PL C +E+
Sbjct: 70  GVFPFGIAETKVAQVNQFARQNEHPLLCSLEK 101


>gi|297539530|ref|YP_003675299.1| ATP-dependent Clp protease adaptor protein ClpS [Methylotenera sp.
           301]
 gi|297258877|gb|ADI30722.1| ATP-dependent Clp protease adaptor protein ClpS [Methylotenera sp.
           301]
          Length = 108

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 48/103 (46%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
           K    F+N +  +   + K ++P ++ VLL+ND+YTPMEFV+  ++ FF K  E A  IM
Sbjct: 6   KNAKPFENDVALKPEVA-KPKLPPMFNVLLLNDDYTPMEFVVECIERFFNKSREQATQIM 64

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           LKVH +G+  CGVY  +IAE K+NQV++Y+R  Q+PLQC+ E 
Sbjct: 65  LKVHTEGLAVCGVYPQDIAETKMNQVLSYARDQQHPLQCVTEP 107


>gi|258405491|ref|YP_003198233.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfohalobium
           retbaense DSM 5692]
 gi|257797718|gb|ACV68655.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfohalobium
           retbaense DSM 5692]
          Length = 103

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 60/99 (60%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
           E D  +  E    + V+ P  Y+VLL ND+YT MEFV+ VL + F K    A  IML VH
Sbjct: 4   ENDPRIVPEKGEETAVKEPSRYKVLLHNDDYTTMEFVVQVLMDIFNKSEAEATQIMLNVH 63

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             G+G CG+Y  E+AE KV  V   +R+H YPL+C ME+
Sbjct: 64  KNGVGVCGIYTAEVAETKVAMVSQMARKHGYPLKCTMEE 102


>gi|300722512|ref|YP_003711802.1| modulator of ClpA substrate specificity [Xenorhabdus nematophila
           ATCC 19061]
 gi|297629019|emb|CBJ89604.1| modulator of ClpA substrate specificity [Xenorhabdus nematophila
           ATCC 19061]
          Length = 106

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 42/92 (45%), Positives = 61/92 (66%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            +      +R P +Y+V+L ND+YTPMEFV+ VLQ FF  + E A  +ML VH++G   C
Sbjct: 14  IKDDTKQTLRPPSMYQVVLNNDDYTPMEFVVDVLQKFFSYNVERATQLMLDVHYKGKAVC 73

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G+Y  E+AE K  QV  Y+R+H++PL C +E+
Sbjct: 74  GIYTAEVAETKAAQVNMYAREHEHPLLCTLEK 105


>gi|260779177|ref|ZP_05888069.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260605341|gb|EEX31636.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 106

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 44/98 (44%), Positives = 63/98 (64%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                D      +KV+ P +Y V+L ND+YTPM+FVI +L+ FF  D + A  +MLKVH+
Sbjct: 8   VTPDSDLLELEKTKVKPPSMYNVVLNNDDYTPMDFVIEILERFFSMDIDKATQVMLKVHY 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CG +  E+AE KV QV  YS+++++PL C MEQ
Sbjct: 68  EGKAICGTFTAEVAETKVAQVTMYSQENEHPLLCTMEQ 105


>gi|291334349|gb|ADD94008.1| hypothetical protein ED21_23138 [uncultured marine bacterium
           MedDCM-OCT-S11-C310]
          Length = 112

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M+D   N +    ++           KV+ PK Y+VLL NDNYT MEFV+ VL+  F+ +
Sbjct: 1   MSDGNDNWEDEP-YEGEGQVATETEIKVKRPKRYKVLLHNDNYTTMEFVVLVLKTVFHLE 59

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             +A  +ML VH +G G  GV++YE+AE KV++V   +R H YPL+C ME 
Sbjct: 60  EPSAVQVMLHVHRKGAGVAGVFSYEVAETKVHKVTELARAHDYPLRCSMEP 110


>gi|13470855|ref|NP_102424.1| ATP-dependent Clp protease adaptor protein ClpS [Mesorhizobium loti
           MAFF303099]
 gi|21542310|sp|Q98MA3|CLPS1_RHILO RecName: Full=ATP-dependent Clp protease adapter protein ClpS 1
 gi|14021598|dbj|BAB48210.1| mll0664 [Mesorhizobium loti MAFF303099]
          Length = 109

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 57/103 (55%), Positives = 76/103 (73%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
              E         R  +K + P LYRVL++ND+YTPMEFV+HVL+ FF KD E A  IML
Sbjct: 7   DGNEAGRGTAVITRTKTKTKKPSLYRVLILNDDYTPMEFVVHVLERFFQKDREAATRIML 66

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            VH+ G+GECGVY +E+AE KV+QVM+++RQ+Q+PLQC+ME+K
Sbjct: 67  HVHNHGVGECGVYTFEVAETKVSQVMDFARQNQHPLQCVMEKK 109


>gi|54308344|ref|YP_129364.1| ATP-dependent Clp protease adaptor protein ClpS [Photobacterium
           profundum SS9]
 gi|67460286|sp|Q6LT14|CLPS_PHOPR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|46912772|emb|CAG19562.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 106

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 44/96 (45%), Positives = 64/96 (66%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              D   +   +V+ P +Y+V+L ND+YTPM+FVI VLQ FF  D E A  +ML VH++G
Sbjct: 10  PESDVLDKEEVQVKPPAMYKVVLNNDDYTPMDFVIEVLQKFFSMDMEKATQLMLNVHYEG 69

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
              CG +  E+AE KV QVM ++R++++PL C ME+
Sbjct: 70  KAICGTFTAEVAETKVAQVMMHARENEHPLLCTMEK 105


>gi|200390037|ref|ZP_03216648.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|199602482|gb|EDZ01028.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
          Length = 106

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 61/84 (72%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+QG   CGV+  E+A
Sbjct: 22  LKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVA 81

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQ 137
           E KV  V  Y+R++++PL C +E+
Sbjct: 82  ETKVAMVNKYARENEHPLLCTLEK 105


>gi|21231414|ref|NP_637331.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66768532|ref|YP_243294.1| ATP-dependent Clp protease adaptor protein ClpS [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|24638420|sp|Q8P999|CLPS_XANCP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|81305496|sp|Q4UUJ9|CLPS_XANC8 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|21113082|gb|AAM41255.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573864|gb|AAY49274.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 106

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M +K   E D+ L  E     +V  P  Y+VLL+ND+YTPM+FV+ VLQ FF  + E A 
Sbjct: 1   MPRKTSHEHDHGLVVET-SKPEVAPPPRYQVLLLNDDYTPMDFVVTVLQQFFNLELERAT 59

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH +G G CGVY+ E+AE KV QV  +SR +Q+PL C MEQ
Sbjct: 60  QVMLHVHTRGRGVCGVYSREVAESKVAQVNEFSRMNQHPLLCTMEQ 105


>gi|78776659|ref|YP_392974.1| ATP-dependent Clp protease adaptor protein ClpS [Sulfurimonas
           denitrificans DSM 1251]
 gi|78497199|gb|ABB43739.1| ATP-dependent Clp protease adaptor protein ClpS [Sulfurimonas
           denitrificans DSM 1251]
          Length = 99

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 65/97 (67%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
             +D E +   K++ PK Y+VLL+ND+YT MEFVI +L   F+K++E A  IML++H + 
Sbjct: 3   TNIDLETKEKVKIKYPKKYKVLLLNDDYTSMEFVIDILITIFHKNYEQAHQIMLEIHKKT 62

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            G CG+Y YEIAE KV QV   +R + + L+  ME++
Sbjct: 63  KGICGIYTYEIAETKVMQVHKKARDNGFALRATMEEE 99


>gi|261339214|ref|ZP_05967072.1| hypothetical protein ENTCAN_05442 [Enterobacter cancerogenus ATCC
           35316]
 gi|296103112|ref|YP_003613258.1| ATP-dependent Clp protease adaptor protein ClpS [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|288319063|gb|EFC58001.1| ATP-dependent Clp protease adaptor protein ClpS [Enterobacter
           cancerogenus ATCC 35316]
 gi|295057571|gb|ADF62309.1| ATP-dependent Clp protease adaptor protein ClpS [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295096412|emb|CBK85502.1| Uncharacterized conserved protein [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 106

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 66/97 (68%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+L+ND+YTPMEFVI VLQ FF  D E A  +ML VH++
Sbjct: 9   DFDQLAEDKVRDALKPPSMYKVMLMNDDYTPMEFVIDVLQKFFSYDVERATQLMLTVHYR 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CG++  E+AE KV  V +Y+R++++PL C +E+
Sbjct: 69  GKAICGIFTAEVAETKVAMVNDYARENEHPLLCTLEK 105


>gi|254428859|ref|ZP_05042566.1| ATP-dependent Clp protease adaptor protein ClpS [Alcanivorax sp.
           DG881]
 gi|196195028|gb|EDX89987.1| ATP-dependent Clp protease adaptor protein ClpS [Alcanivorax sp.
           DG881]
          Length = 94

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 41/90 (45%), Positives = 62/90 (68%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
                K++ P +Y+VL++ND+YTPM+FV+ +L++FF    E A  +ML VH +G   CGV
Sbjct: 4   EEAKPKLKPPSMYKVLMLNDDYTPMDFVVEILEDFFNLGREQATRVMLTVHTEGKAVCGV 63

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           Y  +IAE K  QV+ Y+R++Q+PL C +EQ
Sbjct: 64  YPQDIAETKATQVVEYARENQHPLMCQVEQ 93


>gi|188534289|ref|YP_001908086.1| ATP-dependent Clp protease adaptor protein ClpS [Erwinia
           tasmaniensis Et1/99]
 gi|238689683|sp|B2VC66|CLPS_ERWT9 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|188029331|emb|CAO97208.1| ATP-dependent Clp protease adaptor protein [Erwinia tasmaniensis
           Et1/99]
          Length = 106

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 61/89 (68%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
           +   +++ P +Y+V+L ND++TPMEFVI VLQ FF  D E A  +ML VH+QG   CGV+
Sbjct: 17  KVREELKPPSMYKVILNNDDFTPMEFVIDVLQKFFSYDIERATQLMLTVHYQGKAICGVF 76

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             E+AE KV  V  Y+R +++PL C +E+
Sbjct: 77  TAEVAETKVAHVNKYARDNEHPLLCTLEK 105


>gi|325282898|ref|YP_004255439.1| ATP-dependent Clp protease adapter protein clpS [Deinococcus
           proteolyticus MRP]
 gi|324314707|gb|ADY25822.1| ATP-dependent Clp protease adapter protein clpS [Deinococcus
           proteolyticus MRP]
          Length = 109

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 45/101 (44%), Positives = 66/101 (65%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
            + D    ++    ++ R P+L+RVLL+ND+YTPM+FV+ VL+ +F K  + A+ IML V
Sbjct: 4   PDTDRAGHTQTLERTETRKPRLWRVLLLNDDYTPMDFVVLVLERYFRKTEQDAELIMLAV 63

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           HH+G G  GVY  +IAE KV QV   +RQ  YPL+ + E +
Sbjct: 64  HHKGQGVAGVYTRDIAETKVAQVTQLARQEGYPLRVLAEPE 104


>gi|332162228|ref|YP_004298805.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318606291|emb|CBY27789.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325666458|gb|ADZ43102.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330860566|emb|CBX70865.1| ATP-dependent Clp protease adapter protein clpS [Yersinia
           enterocolitica W22703]
          Length = 115

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 66/109 (60%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
           D +   K     +     + +    ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E
Sbjct: 6   DGQAMGKNNDWLNFEHLVKDKQIEALKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIE 65

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            A  +ML VH+QG   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 66  RATQLMLNVHYQGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEK 114


>gi|114332013|ref|YP_748235.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosomonas
           eutropha C91]
 gi|122313284|sp|Q0AEG2|CLPS_NITEC RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|114309027|gb|ABI60270.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosomonas
           eutropha C91]
          Length = 103

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 43/94 (45%), Positives = 67/94 (71%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
               +  +++  P LY+V+L+ND++TPM+FV+ VL++FF+ D E A  IMLK+H +G G 
Sbjct: 10  SVIEKGKTRLTPPPLYKVILINDDFTPMDFVVKVLRHFFFMDEEMATRIMLKIHTEGAGI 69

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CG Y  +IA  KV QV  +S+Q+Q+PL C+ME++
Sbjct: 70  CGTYPGDIAATKVQQVNEFSKQNQHPLMCVMEKE 103


>gi|78485455|ref|YP_391380.1| ATP-dependent Clp protease adaptor protein ClpS [Thiomicrospira
           crunogena XCL-2]
 gi|123555526|sp|Q31GL7|CLPS_THICR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|78363741|gb|ABB41706.1| ATP-dependent Clp protease adaptor protein ClpS [Thiomicrospira
           crunogena XCL-2]
          Length = 104

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 50/102 (49%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
                 D+ +  E     KV+ PK Y+V+L+ND++TPM+FV+ VL  FF  D   A  +M
Sbjct: 2   PSQPFQDDGVVLET-ARPKVKPPKRYQVVLLNDDFTPMDFVVDVLTRFFGMDEAKANAVM 60

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           L VH +G G CGVY+ E+AEMKV QV  Y+R+HQ+PLQC ME
Sbjct: 61  LAVHTKGKGTCGVYSREVAEMKVMQVNQYAREHQHPLQCEME 102


>gi|261252480|ref|ZP_05945053.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio orientalis
           CIP 102891]
 gi|260935871|gb|EEX91860.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio orientalis
           CIP 102891]
          Length = 106

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/98 (44%), Positives = 62/98 (63%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
                D      +KV+ P +Y V+L ND+YTPM+FVI +L+ FF  D + A  +ML+VH+
Sbjct: 8   VTPDSDLLELEKTKVKPPSMYNVVLNNDDYTPMDFVIEILERFFSMDIDKATQVMLQVHY 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CG Y  E+AE KV QV  YS ++++PL C MEQ
Sbjct: 68  EGKAICGTYTAEVAETKVAQVTMYSTENEHPLLCTMEQ 105


>gi|119897424|ref|YP_932637.1| ATP-dependent Clp protease adaptor protein ClpS [Azoarcus sp. BH72]
 gi|166214724|sp|A1K4J5|CLPS_AZOSB RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|119669837|emb|CAL93750.1| ClpS protein [Azoarcus sp. BH72]
          Length = 102

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 46/95 (48%), Positives = 67/95 (70%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                    ++ R P LY+VLL+ND++TPM+FVI VLQ +F  D E A  +ML+VH +G+
Sbjct: 7   DGFVLEAKRTRTRPPPLYKVLLLNDDFTPMDFVIVVLQKYFSMDRERATRVMLQVHREGM 66

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGV+  +IA  KV QV++++RQHQ+PL C+ME+
Sbjct: 67  GVCGVFPRDIASTKVEQVVSFARQHQHPLACVMEE 101


>gi|294636953|ref|ZP_06715277.1| ATP-dependent Clp protease adaptor protein ClpS [Edwardsiella tarda
           ATCC 23685]
 gi|291089846|gb|EFE22407.1| ATP-dependent Clp protease adaptor protein ClpS [Edwardsiella tarda
           ATCC 23685]
          Length = 106

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 63/111 (56%), Gaps = 6/111 (5%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           MA+           D       R    V+ P LY V+L ND+YTPMEFVI VLQ FF  D
Sbjct: 1   MANLNDWLNLEPLADE------RTREAVKPPSLYSVILNNDDYTPMEFVIEVLQKFFTYD 54

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            E A  +ML VH++G   CGV+  E+AE KV  +  Y+R++ +PL C +E+
Sbjct: 55  IERATQLMLTVHYKGKAVCGVFTAEVAETKVALINRYARENDHPLLCTLEK 105


>gi|310767160|gb|ADP12110.1| ATP-dependent Clp protease adaptor protein ClpS [Erwinia sp.
           Ejp617]
          Length = 106

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 60/89 (67%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
           +    ++ P +Y+V+L ND++TPMEFVI VLQ FF  D E A  +ML VH+QG   CGV+
Sbjct: 17  KVREALKPPSMYKVILNNDDFTPMEFVIDVLQKFFSYDIERATQLMLTVHYQGKAICGVF 76

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             E+AE KV  V  Y+R +++PL C +E+
Sbjct: 77  TAEVAETKVAHVNKYARDNEHPLLCTLEK 105


>gi|253997306|ref|YP_003049370.1| ATP-dependent Clp protease adaptor protein ClpS [Methylotenera
           mobilis JLW8]
 gi|253983985|gb|ACT48843.1| ATP-dependent Clp protease adaptor protein ClpS [Methylotenera
           mobilis JLW8]
          Length = 103

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 72/96 (75%), Gaps = 1/96 (1%)

Query: 42  NCLDSEVRFS-SKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           +  D  ++   +K ++P +++VLL+ND+YTPMEFVI V++ FF K  E A  IMLKVH +
Sbjct: 6   HENDIALKPEVAKPKLPPMFKVLLLNDDYTPMEFVIEVIERFFNKSREQATQIMLKVHTE 65

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           G G CG+Y  +IAE K+NQV++Y+RQ Q+PLQCI+E
Sbjct: 66  GAGICGIYPQDIAETKMNQVVSYARQSQHPLQCIVE 101


>gi|73542438|ref|YP_296958.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia eutropha
           JMP134]
 gi|123624188|sp|Q46XL9|CLPS_RALEJ RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|72119851|gb|AAZ62114.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia eutropha
           JMP134]
          Length = 108

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/96 (45%), Positives = 64/96 (66%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
                  R   +++ P +Y+V+L+ND+YTPMEFV+ +LQ +F +D ETA  IML VH +G
Sbjct: 12  EAGTILERKEQQLKPPAMYKVVLLNDDYTPMEFVVMILQQYFSRDRETATQIMLTVHREG 71

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CG+Y  +IA  KV  V  ++RQ  +PLQC+ME+
Sbjct: 72  KGVCGIYTRDIAATKVELVSTHARQAGHPLQCVMEE 107


>gi|331672424|ref|ZP_08373214.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           TA280]
 gi|331070330|gb|EGI41695.1| ATP-dependent Clp protease adaptor protein ClpS [Escherichia coli
           TA280]
          Length = 106

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFIAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|88860127|ref|ZP_01134766.1| modulator of ClpA substrate specificity [Pseudoalteromonas tunicata
           D2]
 gi|88818121|gb|EAR27937.1| modulator of ClpA substrate specificity [Pseudoalteromonas tunicata
           D2]
          Length = 105

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/103 (49%), Positives = 64/103 (62%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
            G+ E D           K+R PK Y V+L ND+YTPM+FVI V+  FF K  E A  IM
Sbjct: 2   SGLKESDLIDTVRENEKQKLRPPKQYHVILNNDDYTPMDFVIEVIMKFFNKTSEQAAEIM 61

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           LKVH++G   CGVY+ EIAE KV QV  Y+R +++PL C  EQ
Sbjct: 62  LKVHYEGKAVCGVYSAEIAETKVAQVNQYARDNEHPLLCSYEQ 104


>gi|123441829|ref|YP_001005813.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|238762120|ref|ZP_04623093.1| ATP-dependent Clp protease adapter protein clpS [Yersinia
           kristensenii ATCC 33638]
 gi|238789631|ref|ZP_04633414.1| ATP-dependent Clp protease adapter protein clpS [Yersinia
           frederiksenii ATCC 33641]
 gi|158512680|sp|A1JMC5|CLPS_YERE8 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|122088790|emb|CAL11596.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238699848|gb|EEP92592.1| ATP-dependent Clp protease adapter protein clpS [Yersinia
           kristensenii ATCC 33638]
 gi|238722184|gb|EEQ13841.1| ATP-dependent Clp protease adapter protein clpS [Yersinia
           frederiksenii ATCC 33641]
          Length = 106

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 64/104 (61%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
            K     +     + +    ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GKNNDWLNFEHLVKDKQIEALKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+QG   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 62  MLNVHYQGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEK 105


>gi|221134865|ref|ZP_03561168.1| ATP-dependent Clp protease adaptor protein ClpS [Glaciecola sp.
           HTCC2999]
          Length = 106

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 66/106 (62%), Gaps = 1/106 (0%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+K+  +  D           KV+ P +Y+V+L ND+YTPMEFV+ VL  FF  D E A 
Sbjct: 1   MSKENTSTID-EHKINESVEKKVQPPSMYKVILNNDDYTPMEFVVEVLCRFFNMDGEKAN 59

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH+QG   CGVY  EIAE KV QV  Y+++HQ+PL C  EQ
Sbjct: 60  QVMLTVHYQGKAVCGVYTAEIAETKVMQVNQYAQKHQHPLLCSYEQ 105


>gi|187478584|ref|YP_786608.1| ATP-dependent Clp protease adaptor protein ClpS [Bordetella avium
           197N]
 gi|123514730|sp|Q2KZI1|CLPS_BORA1 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|115423170|emb|CAJ49701.1| ATP-dependent clp protease adaptor protein [Bordetella avium 197N]
          Length = 104

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 65/92 (70%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
              + S++   P +Y+V+L+ND+YTPMEFV+ VLQ FF K+ E A  IML+VHH+G G C
Sbjct: 12  VAEKQSARTAPPPMYQVVLLNDDYTPMEFVVKVLQKFFGKNQEEATRIMLQVHHEGRGIC 71

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           GVY  ++A  ++ QV  Y+R  Q+PLQCIME 
Sbjct: 72  GVYVRDVAATRIAQVAQYARARQHPLQCIMEP 103


>gi|308186236|ref|YP_003930367.1| ATP-dependent Clp protease adaptor protein [Pantoea vagans C9-1]
 gi|308056746|gb|ADO08918.1| ATP-dependent Clp protease adaptor protein [Pantoea vagans C9-1]
          Length = 126

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 72/120 (60%), Gaps = 2/120 (1%)

Query: 18  ILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIH 77
            +  +      ++  N      F++  + +VR    ++ P +Y+V+L ND+YTPMEFVI 
Sbjct: 8   AIKRLKAKSQRNTMANTNDWLNFEHLAEDKVREG--LKPPSMYKVILNNDDYTPMEFVID 65

Query: 78  VLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           V+Q FF  D E A  +MLKVH+ G   CGV+  E+AE K  QV NY+R++ +PL C +E+
Sbjct: 66  VVQKFFSYDVERATQLMLKVHYHGKAICGVFTAEVAETKAAQVNNYARENHHPLLCTLEK 125


>gi|319793921|ref|YP_004155561.1| ATP-dependent clp protease adaptor protein clps [Variovorax
           paradoxus EPS]
 gi|315596384|gb|ADU37450.1| ATP-dependent Clp protease adaptor protein ClpS [Variovorax
           paradoxus EPS]
          Length = 119

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 68/117 (58%), Gaps = 1/117 (0%)

Query: 22  MSFIFMADSRMNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQ 80
           M+                 D+     +     K   P++Y+V+++ND+YTPMEFVI VLQ
Sbjct: 1   MATRIPKTPPTPPAQKPAGDDGDSVVLERRPQKTAPPQMYQVVMLNDDYTPMEFVIVVLQ 60

Query: 81  NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +F KD ETA  IMLK+H  G G CGVY+ ++A  KVNQVM  ++Q  +PLQC+ E 
Sbjct: 61  EYFSKDRETATQIMLKIHLDGRGVCGVYSRDMAATKVNQVMEAAQQAGHPLQCVSEP 117


>gi|171058346|ref|YP_001790695.1| ATP-dependent Clp protease adaptor protein ClpS [Leptothrix
           cholodnii SP-6]
 gi|238689087|sp|B1XY29|CLPS_LEPCP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|170775791|gb|ACB33930.1| ATP-dependent Clp protease adaptor protein ClpS [Leptothrix
           cholodnii SP-6]
          Length = 115

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/113 (39%), Positives = 67/113 (59%), Gaps = 3/113 (2%)

Query: 27  MADSRMNKKGIAEFDNCLD---SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF 83
           M+D + N   +    +         +   +V  P++Y+V+++ND++TPMEFV+ VLQ FF
Sbjct: 1   MSDQKPNTPNVPAPPDDGQGAVIAEKQLQRVEPPRVYQVVMLNDDFTPMEFVVMVLQQFF 60

Query: 84  YKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
             D E A  IMLK+HH+G   CGVY  ++A  KV  V   +R+  +PLQC ME
Sbjct: 61  RHDLEAATQIMLKIHHEGRAVCGVYTQDVAATKVEMVQAAARRAGHPLQCTME 113


>gi|154253238|ref|YP_001414062.1| ATP-dependent Clp protease adaptor protein ClpS [Parvibaculum
           lavamentivorans DS-1]
 gi|171769648|sp|A7HWX2|CLPS_PARL1 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|154157188|gb|ABS64405.1| ATP-dependent Clp protease adaptor protein ClpS [Parvibaculum
           lavamentivorans DS-1]
          Length = 110

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 74/110 (67%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
            S   ++G  +         +   K + P LY+VLL+ND+YTPMEFV+HVL+ FF K  +
Sbjct: 1   MSDDRRRGDEDGGAGTGVITKTKPKTKKPSLYKVLLLNDDYTPMEFVVHVLERFFNKGRD 60

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            A  IML VH  G+G CG+Y YE+AE KV QVM++++QHQ+PLQC ME++
Sbjct: 61  EATVIMLHVHQHGVGICGLYTYEVAETKVTQVMDFAQQHQHPLQCTMERE 110


>gi|146311056|ref|YP_001176130.1| ATP-dependent Clp protease adaptor protein ClpS [Enterobacter sp.
           638]
 gi|167008655|sp|A4W8P9|CLPS_ENT38 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|145317932|gb|ABP60079.1| ATP-dependent Clp protease adaptor protein ClpS [Enterobacter sp.
           638]
          Length = 106

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 70/105 (66%), Gaps = 2/105 (1%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
            K    +FD   + +VR +  ++ P +Y+V+L+ND+YTPMEFVI VLQ FF  D E A  
Sbjct: 3   KKNDWLDFDQLAEDKVRDA--LKPPSMYKVMLMNDDYTPMEFVIDVLQKFFSYDVERATQ 60

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +ML VH++G   CG++  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 61  LMLTVHYRGKAICGIFTAEVAETKVAMVNEYARENEHPLLCTLEK 105


>gi|292487808|ref|YP_003530683.1| ATP-dependent Clp protease adaptor protein ClpS [Erwinia amylovora
           CFBP1430]
 gi|292899037|ref|YP_003538406.1| ATP-dependent Clp protease adaptor protein [Erwinia amylovora ATCC
           49946]
 gi|291198885|emb|CBJ45995.1| ATP-dependent Clp protease adaptor protein [Erwinia amylovora ATCC
           49946]
 gi|291553230|emb|CBA20275.1| ATP-dependent Clp protease adaptor protein ClpS [Erwinia amylovora
           CFBP1430]
 gi|312171926|emb|CBX80183.1| ATP-dependent Clp protease adaptor protein ClpS [Erwinia amylovora
           ATCC BAA-2158]
          Length = 106

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 62/91 (68%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E +   +++ P +Y+VLL ND++TPMEFVI VLQ FF  D E A  +ML VH+QG   CG
Sbjct: 15  EDKVREELKPPSMYKVLLNNDDFTPMEFVIDVLQKFFSYDIERATQLMLTVHYQGKAICG 74

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           V+  E+AE KV  V  Y+R +++PL C +E+
Sbjct: 75  VFTAEVAETKVAHVNKYARDNEHPLLCTLEK 105


>gi|94311825|ref|YP_585035.1| ATP-dependent Clp protease adaptor protein ClpS [Cupriavidus
           metallidurans CH34]
 gi|158564205|sp|Q1LJB0|CLPS_RALME RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|93355677|gb|ABF09766.1| regulatory protein for ClpA substrate specificity [Cupriavidus
           metallidurans CH34]
          Length = 108

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/96 (45%), Positives = 64/96 (66%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
                  R   +++ P +Y+V+L+ND+YTPMEFV+ +LQ +F +D ETA  IML VH +G
Sbjct: 12  ETGTVIERKEQQLKPPAMYKVVLLNDDYTPMEFVVMILQQYFSRDRETATQIMLTVHREG 71

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CG+Y  +IA  KV  V  ++RQ  +PLQC+ME+
Sbjct: 72  KGVCGIYTRDIAATKVELVSTHARQAGHPLQCVMEE 107


>gi|118591081|ref|ZP_01548480.1| ATP-dependent Clp protease adaptor protein ClpS [Stappia aggregata
           IAM 12614]
 gi|118436157|gb|EAV42799.1| ATP-dependent Clp protease adaptor protein ClpS [Stappia aggregata
           IAM 12614]
          Length = 121

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 58/103 (56%), Positives = 77/103 (74%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                D    +  R  +  + P LYRVLL+ND+YTPMEFVIHV++NFF K+ E A  IML
Sbjct: 19  DNDGGDAGTVTVTRTKTVTKRPNLYRVLLLNDDYTPMEFVIHVVENFFQKNREEATRIML 78

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            VHH G+GECG+Y+YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 79  HVHHHGVGECGIYSYEVAETKVTQVMDFARKHQHPLQCVMEKK 121


>gi|332110106|gb|EGJ10734.1| hypothetical protein RBXJA2T_10429 [Rubrivivax benzoatilyticus JA2]
          Length = 110

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 68/108 (62%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
                  G            R + +V+ P LY+V+L+ND+YTPMEFV+ VLQ++F +D +
Sbjct: 1   MKPPPLPGQDGGAGGAVVAERKAQRVKPPSLYQVVLLNDDYTPMEFVVMVLQHYFQRDLD 60

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           TA  IMLK+HH+G G CGVY  ++A  KV  V+  +R+  +PLQCIME
Sbjct: 61  TATHIMLKIHHEGRGVCGVYPKDVAATKVELVLAAARRDGHPLQCIME 108


>gi|332088859|gb|EGI93971.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Shigella boydii 5216-82]
          Length = 106

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE K+  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKMAMVNKYARENEHPLLCTLEK 105


>gi|114563426|ref|YP_750939.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           frigidimarina NCIMB 400]
 gi|122299542|sp|Q081G4|CLPS_SHEFN RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|114334719|gb|ABI72101.1| ATP-dependent Clp protease adaptor protein ClpS [Shewanella
           frigidimarina NCIMB 400]
          Length = 102

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 46/101 (45%), Positives = 71/101 (70%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +A+  N    E +  S+++ P +Y+V+L ND+YTPM+FV+ VLQ FF K+ + A  IML 
Sbjct: 1   MAKLGNVEHIEEKVESELQPPHMYKVVLNNDDYTPMDFVVEVLQRFFEKNEQQAVDIMLA 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +H+QG G CGV+ + IAE KV QV  ++R++Q+PL C +E+
Sbjct: 61  IHNQGKGLCGVFPFGIAETKVFQVNQFARENQHPLLCTLEK 101


>gi|311280209|ref|YP_003942440.1| ATP-dependent Clp protease adaptor protein ClpS [Enterobacter
           cloacae SCF1]
 gi|308749404|gb|ADO49156.1| ATP-dependent Clp protease adaptor protein ClpS [Enterobacter
           cloacae SCF1]
          Length = 106

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    ++ +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLTKDQVRDALKPPAMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLTVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +EQ
Sbjct: 69  GKAICGVFTAEVAETKVAMVNQYARENEHPLLCTLEQ 105


>gi|326316818|ref|YP_004234490.1| ATP-dependent Clp protease adaptor protein ClpS [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323373654|gb|ADX45923.1| ATP-dependent Clp protease adaptor protein ClpS [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 112

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 67/110 (60%), Gaps = 1/110 (0%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
            +     G+   D+     +   + + + P++Y+V+++ND+YTPMEFVI VLQ FF KD 
Sbjct: 1   MTPTPPTGVPSRDDGGSVVLERRTQRTQPPQMYQVVMLNDDYTPMEFVIVVLQEFFGKDR 60

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           E A  IMLK+H  G G CGVY+ ++A  KV QV   + +  +PLQC+ E 
Sbjct: 61  EAATQIMLKIHLDGKGVCGVYSRDVAATKVEQVREAAHKAGHPLQCLSEP 110


>gi|260222810|emb|CBA32750.1| ATP-dependent Clp protease adapter protein clpS [Curvibacter
           putative symbiont of Hydra magnipapillata]
          Length = 108

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 47/104 (45%), Positives = 67/104 (64%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
           K   A  D+      R S +V+ P +Y+V+++ND+YTPMEFV+ V+Q FF KD E A  I
Sbjct: 2   KPPPAGGDDGTVVLERLSQRVQPPSMYQVVMLNDDYTPMEFVVVVIQEFFGKDLEAATQI 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           MLK+H  G G CGVY  +IA  KV+QV+  + +  +PL+C+ E 
Sbjct: 62  MLKIHLDGRGVCGVYPKDIAATKVDQVLEAAHKAGHPLKCVSEP 105


>gi|184158341|ref|YP_001846680.1| ATP-dependent Clp protease adaptor protein ClpS [Acinetobacter
           baumannii ACICU]
 gi|183209935|gb|ACC57333.1| uncharacterized conserved protein [Acinetobacter baumannii ACICU]
          Length = 93

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 59/87 (67%)

Query: 52  SKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYE 111
            +++ P LY V+L+ND+YTPM+FVI +LQ +F  + + A  +ML VH++G G  GVY  +
Sbjct: 6   PELKRPPLYAVVLLNDDYTPMDFVIEILQQYFAMNLDQATQVMLTVHYEGKGTAGVYPRD 65

Query: 112 IAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           IAE K N V NY+R   +PL C +E K
Sbjct: 66  IAETKANLVNNYARSQGHPLLCQIEPK 92


>gi|187929804|ref|YP_001900291.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia
           pickettii 12J]
 gi|241663930|ref|YP_002982290.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia
           pickettii 12D]
 gi|309781481|ref|ZP_07676217.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia sp.
           5_7_47FAA]
 gi|238691811|sp|B2UAR2|CLPS_RALPJ RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|187726694|gb|ACD27859.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia
           pickettii 12J]
 gi|240865957|gb|ACS63618.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia
           pickettii 12D]
 gi|308919894|gb|EFP65555.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia sp.
           5_7_47FAA]
          Length = 108

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 64/96 (66%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           +      R    ++ P +Y+VLL+ND+YTPMEFV+ +LQ +F KD ETA  IML VH +G
Sbjct: 12  DAGTVLERKEQALKPPAMYKVLLLNDDYTPMEFVVMILQQYFSKDRETATQIMLTVHREG 71

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CG+Y  +IA  KV  V  ++RQ  +PLQC+ME+
Sbjct: 72  KGVCGLYTRDIAATKVELVSTHARQAGHPLQCVMEE 107


>gi|325981356|ref|YP_004293758.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosomonas sp.
           AL212]
 gi|325530875|gb|ADZ25596.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrosomonas sp.
           AL212]
          Length = 102

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/89 (50%), Positives = 68/89 (76%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
           +   K + P LY++LL+ND++TPMEFV+ VL++FF  + E A  IMLKVH +G+G CG+Y
Sbjct: 13  QEKVKYKPPPLYKILLLNDDFTPMEFVVEVLKSFFSMNQEQATLIMLKVHTEGVGVCGIY 72

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             +IA  KV QV+ +SR++Q+PL+C+ME+
Sbjct: 73  PGDIASTKVKQVIEFSRRNQHPLRCVMEE 101


>gi|304413815|ref|ZP_07395232.1| regulatory protein for ClpA substrate specificity [Candidatus
           Regiella insecticola LSR1]
 gi|304283535|gb|EFL91930.1| regulatory protein for ClpA substrate specificity [Candidatus
           Regiella insecticola LSR1]
          Length = 106

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/104 (44%), Positives = 64/104 (61%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
               A  D       +   K++ P LY+V+L ND+YTPMEFVI VLQ FF  D E A  I
Sbjct: 2   NDNHAGLDVEHLVNEQQIDKLQPPSLYKVILNNDDYTPMEFVIDVLQKFFSYDIELATQI 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML +H+QG   CGV+  E+AE KV  V  Y+R++++PL C +++
Sbjct: 62  MLDIHYQGRAICGVFTAEVAETKVVLVNQYARKNEHPLLCTLKK 105


>gi|239815631|ref|YP_002944541.1| ATP-dependent Clp protease adaptor protein ClpS [Variovorax
           paradoxus S110]
 gi|259491251|sp|C5CLL8|CLPS_VARPS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|239802208|gb|ACS19275.1| ATP-dependent Clp protease adaptor protein ClpS [Variovorax
           paradoxus S110]
          Length = 119

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/114 (42%), Positives = 67/114 (58%), Gaps = 2/114 (1%)

Query: 26  FMADSRMNKK-GIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF 83
            +  +           D+     +     K   P++Y+V+++ND+YTPMEFVI VLQ +F
Sbjct: 4   RIPKTPSTPPAQKPAGDDGDSVVLERRPQKTAPPQMYQVVMLNDDYTPMEFVIVVLQEYF 63

Query: 84  YKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            KD ETA  IMLK+H  G G CGVY+ ++A  KVNQVM  + Q  +PLQC+ E 
Sbjct: 64  NKDRETATQIMLKIHLDGRGVCGVYSRDLAATKVNQVMEAAHQAGHPLQCVSEP 117


>gi|120554676|ref|YP_959027.1| ATP-dependent Clp protease adaptor protein ClpS [Marinobacter
           aquaeolei VT8]
 gi|158513045|sp|A1U1H1|CLPS_MARAV RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|120324525|gb|ABM18840.1| ATP-dependent Clp protease adaptor protein ClpS [Marinobacter
           aquaeolei VT8]
          Length = 119

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 59/106 (55%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
              +      +   S       ++ P  YRV+L+ND+YTPM+FV+ VL  FF  + E A 
Sbjct: 12  NQGEDEQPGRHEGVSVAPEKPALKRPARYRVVLLNDDYTPMDFVVDVLMKFFAMNEEKAT 71

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH QG   CGVY  +IAE K  QV  YS + ++PL C +E+
Sbjct: 72  QVMLLVHTQGKAVCGVYTRDIAETKAAQVNQYSSECEHPLLCEIER 117


>gi|238749793|ref|ZP_04611298.1| ATP-dependent Clp protease adapter protein clpS [Yersinia rohdei
           ATCC 43380]
 gi|238712448|gb|EEQ04661.1| ATP-dependent Clp protease adapter protein clpS [Yersinia rohdei
           ATCC 43380]
          Length = 106

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 64/104 (61%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
            K     +     + +    ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GKNNDWLNFEHLVKDKHIEALKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+QG   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 62  MLNVHYQGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEK 105


>gi|114320604|ref|YP_742287.1| ATP-dependent Clp protease adaptor protein ClpS [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122311718|sp|Q0A8P0|CLPS_ALHEH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|114226998|gb|ABI56797.1| ATP-dependent Clp protease adaptor protein ClpS [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 106

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/103 (40%), Positives = 68/103 (66%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
               ++            +V+ P L++V+++ND+YTPM+FV+ VLQ FF+ D   A  +M
Sbjct: 3   DKAGDWQEHGPQVEEAPPQVKRPPLFKVIILNDDYTPMDFVVEVLQKFFHMDRARATQVM 62

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L VH +G G CGV++ ++AE KVNQV ++SRQH++PL C +++
Sbjct: 63  LHVHTRGEGVCGVFSRDVAETKVNQVNDWSRQHEHPLMCTLKE 105


>gi|254503825|ref|ZP_05115976.1| ATP-dependent Clp protease adaptor protein ClpS [Labrenzia
           alexandrii DFL-11]
 gi|222439896|gb|EEE46575.1| ATP-dependent Clp protease adaptor protein ClpS [Labrenzia
           alexandrii DFL-11]
          Length = 110

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 57/103 (55%), Positives = 75/103 (72%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                D       R  +  + P LYRVLL+ND+YTPMEFVIHV+++FF K+ E A  IML
Sbjct: 8   DKDGGDAGTVVVTRTKTVTKRPNLYRVLLLNDDYTPMEFVIHVVESFFQKNREEATRIML 67

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            VHH G+GECG+Y YE+AE KV QVM+++R+HQ+PLQC+ME+K
Sbjct: 68  HVHHHGVGECGIYTYEVAETKVTQVMDFARRHQHPLQCVMEKK 110


>gi|254524583|ref|ZP_05136638.1| ATP-dependent Clp protease adaptor protein ClpS [Stenotrophomonas
           sp. SKA14]
 gi|219722174|gb|EED40699.1| ATP-dependent Clp protease adaptor protein ClpS [Stenotrophomonas
           sp. SKA14]
          Length = 85

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/82 (53%), Positives = 58/82 (70%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
            P  Y+V+L+ND+YTPM+FV+ VLQ FF  D + A  +ML VH +G G CGV+  E+AE 
Sbjct: 3   PPPFYQVMLLNDDYTPMDFVVDVLQQFFSMDLDKATQVMLHVHTRGRGVCGVFTREVAET 62

Query: 116 KVNQVMNYSRQHQYPLQCIMEQ 137
           KV QV  YSR +Q+PL C ME+
Sbjct: 63  KVAQVNEYSRMNQHPLLCTMEK 84


>gi|224369760|ref|YP_002603924.1| ClpS [Desulfobacterium autotrophicum HRM2]
 gi|259491245|sp|C0QI24|CLPS_DESAH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|223692477|gb|ACN15760.1| ClpS [Desulfobacterium autotrophicum HRM2]
          Length = 104

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/101 (45%), Positives = 61/101 (60%), Gaps = 4/101 (3%)

Query: 42  NCLDSEVRFSSKVRV----PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
           N    + R SSKV      P +YRV+L ND+YT MEFV+ +L   F K  E A  IML +
Sbjct: 4   NEPSIKQRTSSKVEKKEGYPPMYRVVLHNDDYTTMEFVVQILITVFGKSLEKASIIMLNI 63

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H QG G CG Y  E+AE KVN V + +R+  +PL+  ME++
Sbjct: 64  HKQGKGICGSYTREVAETKVNTVHHLAREQGFPLKSTMEKE 104


>gi|304397051|ref|ZP_07378930.1| ATP-dependent Clp protease adaptor protein ClpS [Pantoea sp. aB]
 gi|304355200|gb|EFM19568.1| ATP-dependent Clp protease adaptor protein ClpS [Pantoea sp. aB]
          Length = 106

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 62/91 (68%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E +    ++ P +Y+V+L ND+YTPMEFVI V+Q FF  D E A  +MLKVH+ G   CG
Sbjct: 15  EDKVREGLKPPSMYKVILNNDDYTPMEFVIDVVQKFFSYDVERATQLMLKVHYHGKAICG 74

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           V+  E+AE K  QV NY+R++ +PL C +E+
Sbjct: 75  VFTAEVAETKAAQVNNYARENHHPLLCTLEK 105


>gi|22126687|ref|NP_670110.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           KIM 10]
 gi|45441053|ref|NP_992592.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51595733|ref|YP_069924.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia
           pseudotuberculosis IP 32953]
 gi|108806654|ref|YP_650570.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           Antiqua]
 gi|108812774|ref|YP_648541.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           Nepal516]
 gi|145599600|ref|YP_001163676.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           Pestoides F]
 gi|149366624|ref|ZP_01888658.1| hypothetical protein YPE_1859 [Yersinia pestis CA88-4125]
 gi|153948682|ref|YP_001401572.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia
           pseudotuberculosis IP 31758]
 gi|162418231|ref|YP_001606105.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           Angola]
 gi|165924312|ref|ZP_02220144.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165938973|ref|ZP_02227526.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166009809|ref|ZP_02230707.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166211395|ref|ZP_02237430.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167399829|ref|ZP_02305347.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167419808|ref|ZP_02311561.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167424070|ref|ZP_02315823.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167469762|ref|ZP_02334466.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           FV-1]
 gi|170024918|ref|YP_001721423.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia
           pseudotuberculosis YPIII]
 gi|186894810|ref|YP_001871922.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia
           pseudotuberculosis PB1/+]
 gi|218928515|ref|YP_002346390.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           CO92]
 gi|229841334|ref|ZP_04461493.1| regulatory protein for ClpA substrate specificity [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229843438|ref|ZP_04463584.1| regulatory protein for ClpA substrate specificity [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229895811|ref|ZP_04510981.1| regulatory protein for ClpA substrate specificity [Yersinia pestis
           Pestoides A]
 gi|229903187|ref|ZP_04518300.1| regulatory protein for ClpA substrate specificity [Yersinia pestis
           Nepal516]
 gi|270486980|ref|ZP_06204054.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           KIM D27]
 gi|294503358|ref|YP_003567420.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           Z176003]
 gi|21542306|sp|Q8ZGD5|CLPS_YERPE RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|67460254|sp|Q66CL0|CLPS_YERPS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|122383658|sp|Q1CA97|CLPS_YERPA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|122384459|sp|Q1CGD9|CLPS_YERPN RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|158514101|sp|A4TN41|CLPS_YERPP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|167008657|sp|A7FJZ4|CLPS_YERP3 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238687306|sp|A9R4Y5|CLPS_YERPG RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238688568|sp|B1JRG2|CLPS_YERPY RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238691444|sp|B2KA00|CLPS_YERPB RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|21959704|gb|AAM86361.1|AE013884_8 hypothetical protein y2810 [Yersinia pestis KIM 10]
 gi|45435912|gb|AAS61469.1| conserved hypothetical protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51589015|emb|CAH20633.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108776422|gb|ABG18941.1| hypothetical protein YPN_2613 [Yersinia pestis Nepal516]
 gi|108778567|gb|ABG12625.1| hypothetical protein YPA_0657 [Yersinia pestis Antiqua]
 gi|115347126|emb|CAL20019.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145211296|gb|ABP40703.1| hypothetical protein YPDSF_2328 [Yersinia pestis Pestoides F]
 gi|149290998|gb|EDM41073.1| hypothetical protein YPE_1859 [Yersinia pestis CA88-4125]
 gi|152960177|gb|ABS47638.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia
           pseudotuberculosis IP 31758]
 gi|162351046|gb|ABX84994.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           Angola]
 gi|165913120|gb|EDR31744.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165923372|gb|EDR40504.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165991205|gb|EDR43506.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166207166|gb|EDR51646.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166962549|gb|EDR58570.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167050537|gb|EDR61945.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167056919|gb|EDR66682.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169751452|gb|ACA68970.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia
           pseudotuberculosis YPIII]
 gi|186697836|gb|ACC88465.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia
           pseudotuberculosis PB1/+]
 gi|229678957|gb|EEO75060.1| regulatory protein for ClpA substrate specificity [Yersinia pestis
           Nepal516]
 gi|229689785|gb|EEO81846.1| regulatory protein for ClpA substrate specificity [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229697700|gb|EEO87747.1| regulatory protein for ClpA substrate specificity [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229700734|gb|EEO88763.1| regulatory protein for ClpA substrate specificity [Yersinia pestis
           Pestoides A]
 gi|262361398|gb|ACY58119.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           D106004]
 gi|262365065|gb|ACY61622.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           D182038]
 gi|270335484|gb|EFA46261.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           KIM D27]
 gi|294353817|gb|ADE64158.1| ATP-dependent Clp protease adaptor protein ClpS [Yersinia pestis
           Z176003]
 gi|320015777|gb|ADV99348.1| regulatory protein for ClpA substrate specificity [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 106

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 64/104 (61%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
            K     +     + +    ++ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GKNNDWLNFEHLVKDKQIEALQPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+QG   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 62  MLNVHYQGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEK 105


>gi|217969671|ref|YP_002354905.1| ATP-dependent Clp protease adaptor protein ClpS [Thauera sp. MZ1T]
 gi|217506998|gb|ACK54009.1| ATP-dependent Clp protease adaptor protein ClpS [Thauera sp. MZ1T]
          Length = 102

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 68/96 (70%), Gaps = 1/96 (1%)

Query: 43  CLDSEVRFS-SKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
             D  +    ++ R P L++V+L+ND+YTPM+FVI VLQ +F  D E A  +ML+VH +G
Sbjct: 6   QDDLVLEAKRTRTRPPPLFKVMLLNDDYTPMDFVIVVLQKYFGMDRERATRVMLQVHREG 65

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G CGV+  +IA  KV QV +++RQHQ+PL C+ME+
Sbjct: 66  MGVCGVFPRDIATTKVEQVTSFARQHQHPLACVMEE 101


>gi|157369916|ref|YP_001477905.1| ATP-dependent Clp protease adaptor protein ClpS [Serratia
           proteamaculans 568]
 gi|270261165|ref|ZP_06189438.1| ATP-dependent Clp protease adapter protein ClpS [Serratia odorifera
           4Rx13]
 gi|293396848|ref|ZP_06641122.1| ATP-dependent Clp protease adaptor protein ClpS [Serratia odorifera
           DSM 4582]
 gi|167008656|sp|A8GCD7|CLPS_SERP5 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|157321680|gb|ABV40777.1| ATP-dependent Clp protease adaptor protein ClpS [Serratia
           proteamaculans 568]
 gi|270044649|gb|EFA17740.1| ATP-dependent Clp protease adapter protein ClpS [Serratia odorifera
           4Rx13]
 gi|291420319|gb|EFE93574.1| ATP-dependent Clp protease adaptor protein ClpS [Serratia odorifera
           DSM 4582]
          Length = 106

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 64/104 (61%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                  +    +E +    V+ P +Y+V+L ND+YTPMEFVI VLQ FF  D E A  +
Sbjct: 2   GNNNDWLNFEHLAEEKQIDAVKPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH+QG   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 62  MLTVHYQGKAICGVFTAEVAETKVVHVNRYARENEHPLLCTLEK 105


>gi|149198609|ref|ZP_01875653.1| ATP-dependent Clp protease adaptor protein ClpS [Lentisphaera
           araneosa HTCC2155]
 gi|149138324|gb|EDM26733.1| ATP-dependent Clp protease adaptor protein ClpS [Lentisphaera
           araneosa HTCC2155]
          Length = 103

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 64/96 (66%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             D+ +    KV+ P  ++V+L ND+YTPM+FV++++ + F+K  + A  +ML VH +G 
Sbjct: 8   EGDAALLEKRKVKRPSRFKVILHNDDYTPMDFVVYLIMSVFHKTEDEAAQLMLTVHVKGK 67

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             CG+Y  EIAE KV++ M+ ++Q  +PL C M+++
Sbjct: 68  AICGIYPKEIAENKVDKAMSMAKQEGHPLLCTMQKE 103


>gi|270159871|ref|ZP_06188527.1| ATP-dependent Clp protease adaptor protein ClpS [Legionella
           longbeachae D-4968]
 gi|289165375|ref|YP_003455513.1| regulatory protein for ClpA substrate specificity [Legionella
           longbeachae NSW150]
 gi|269988210|gb|EEZ94465.1| ATP-dependent Clp protease adaptor protein ClpS [Legionella
           longbeachae D-4968]
 gi|288858548|emb|CBJ12429.1| regulatory protein for ClpA substrate specificity [Legionella
           longbeachae NSW150]
          Length = 107

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 73/107 (68%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+ + + E      +E   SS+++VP+ Y+V+L+ND+YTPM+FV+ VL++FF+   E A 
Sbjct: 1   MSGQNLEEIVRHRIAEPEMSSEIKVPRKYKVVLLNDDYTPMDFVVDVLKHFFHLSEEMAV 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML+VH QG G CGV+  +IAE KV  V  Y+R++Q+PL   ME +
Sbjct: 61  QIMLQVHFQGKGVCGVFTRDIAETKVALVNEYARRNQHPLLSSMEPE 107


>gi|116328081|ref|YP_797801.1| hypothetical protein LBL_1378 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116331466|ref|YP_801184.1| hypothetical protein LBJ_1906 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|122280789|sp|Q04RP4|CLPS_LEPBJ RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|122284127|sp|Q051X7|CLPS_LEPBL RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|116120825|gb|ABJ78868.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125155|gb|ABJ76426.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 108

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 63/104 (60%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
             I  FD    +  +   K++ P  YRV+++ND++TPMEFV+ +LQ  F++    ++ IM
Sbjct: 2   SDIFRFDTEEQTLTKEKVKLKRPSKYRVIILNDDFTPMEFVVWILQFVFHRSRAQSQQIM 61

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           LK H  G   CGVY++++A  KV QV   + QH YPL C ME +
Sbjct: 62  LKAHITGKALCGVYSHDVARTKVIQVQQLAEQHGYPLHCTMEVE 105


>gi|302879452|ref|YP_003848016.1| ATP-dependent Clp protease adaptor protein ClpS [Gallionella
           capsiferriformans ES-2]
 gi|302582241|gb|ADL56252.1| ATP-dependent Clp protease adaptor protein ClpS [Gallionella
           capsiferriformans ES-2]
          Length = 102

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/84 (47%), Positives = 60/84 (71%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
            + P +Y+V+L ND+YT MEFVI VLQ FF  ++E A+ +ML++H+ G   CGVY  ++A
Sbjct: 18  TKPPGMYKVVLYNDDYTTMEFVIDVLQRFFAINNERAQQLMLQIHNNGSATCGVYTRDVA 77

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQ 137
           E KV QV  Y++Q+ +PL+C  E+
Sbjct: 78  ETKVAQVTEYAQQNGHPLRCGTEE 101


>gi|186475335|ref|YP_001856805.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           phymatum STM815]
 gi|238691266|sp|B2JDY3|CLPS_BURP8 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|184191794|gb|ACC69759.1| ATP-dependent Clp protease adaptor protein ClpS [Burkholderia
           phymatum STM815]
          Length = 104

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 70/111 (63%), Gaps = 8/111 (7%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           MA     +              R   K++ P +++V+L+ND++TPMEFV+ ++Q +F KD
Sbjct: 1   MAIIPDKQDN--------TVLERQEQKLKPPAMFKVVLLNDDFTPMEFVVMIVQEYFNKD 52

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            ETA  IMLKVH +G G CGVY  +IA  KV QV+ ++RQ  +PLQC+ME+
Sbjct: 53  RETATQIMLKVHREGRGVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEE 103


>gi|28198572|ref|NP_778886.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           Temecula1]
 gi|71274782|ref|ZP_00651070.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           Dixon]
 gi|71897611|ref|ZP_00679856.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           Ann-1]
 gi|71901078|ref|ZP_00683187.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           Ann-1]
 gi|170729972|ref|YP_001775405.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           M12]
 gi|182681253|ref|YP_001829413.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           M23]
 gi|32130316|sp|Q87DL8|CLPS_XYLFT RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238687979|sp|B0U6Q9|CLPS_XYLFM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238691117|sp|B2I9Y0|CLPS_XYLF2 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|28056656|gb|AAO28535.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|71164514|gb|EAO14228.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           Dixon]
 gi|71729160|gb|EAO31282.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           Ann-1]
 gi|71732514|gb|EAO34567.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           Ann-1]
 gi|167964765|gb|ACA11775.1| conserved hypothetical protein [Xylella fastidiosa M12]
 gi|182631363|gb|ACB92139.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           M23]
 gi|307579703|gb|ADN63672.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 106

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 54/106 (50%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M++K + + DN L  E   ++KV  P  Y+VLL+ND+YTPM+FVI VLQ FF  D + A 
Sbjct: 1   MSQKTVHDQDNALLLET-GNTKVAPPPRYQVLLLNDDYTPMDFVIVVLQQFFAMDLKKAT 59

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH +G G CG Y  E+AE KV QV  +SR HQ+PL C M+Q
Sbjct: 60  QVMLHVHTRGRGVCGFYTREVAESKVAQVNEFSRIHQHPLLCTMKQ 105


>gi|160898941|ref|YP_001564523.1| ATP-dependent Clp protease adaptor protein ClpS [Delftia
           acidovorans SPH-1]
 gi|160364525|gb|ABX36138.1| ATP-dependent Clp protease adaptor protein ClpS [Delftia
           acidovorans SPH-1]
          Length = 125

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 47/123 (38%), Positives = 71/123 (57%), Gaps = 6/123 (4%)

Query: 21  LMSFIFMADSRMN-----KKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEF 74
           +   IFMA    +            D+     +     +V+ P++Y+V+++ND++TPMEF
Sbjct: 1   MARMIFMATQPPSIPPAIPTVRPVSDDDGAVVLERRRQRVQPPQMYQVVMLNDDFTPMEF 60

Query: 75  VIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCI 134
           VI VLQ  F KD ETA  IMLK+H  G G CGVY+ ++A  KV QV+  +++  +PLQ +
Sbjct: 61  VIIVLQELFGKDRETATQIMLKIHLDGRGVCGVYSRDVAATKVEQVLQAAQKAGHPLQAM 120

Query: 135 MEQ 137
            E 
Sbjct: 121 FEP 123


>gi|71278979|ref|YP_269595.1| ATP-dependent Clp protease adaptor protein ClpS [Colwellia
           psychrerythraea 34H]
 gi|123632117|sp|Q480C4|CLPS_COLP3 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|71144719|gb|AAZ25192.1| ATP-dependent Clp protease adaptor protein ClpS [Colwellia
           psychrerythraea 34H]
          Length = 106

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/98 (45%), Positives = 62/98 (63%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
           FD     E     ++  P  Y V L+ND+YTPM+FV+ VL NFF K  E A  IML +H+
Sbjct: 8   FDTEGIVEESVKEQIEEPAKYYVFLLNDDYTPMDFVVDVLCNFFNKSEEQATDIMLTIHY 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G   CG Y  EIAE KV QV+ Y+ ++Q+PL+C+M +
Sbjct: 68  KGKALCGTYTAEIAETKVEQVVQYAFENQHPLKCVMTK 105


>gi|56477975|ref|YP_159564.1| ATP-dependent Clp protease adaptor protein ClpS [Aromatoleum
           aromaticum EbN1]
 gi|67460190|sp|Q5P201|CLPS_AZOSE RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|56314018|emb|CAI08663.1| ATP-dependent Clp protease adaptor protein ClpS [Aromatoleum
           aromaticum EbN1]
          Length = 102

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/87 (51%), Positives = 66/87 (75%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
            ++ + P LY+VLL+ND++TPM+FVI VLQ FF  D E A  +ML+VH +G+G CGV+  
Sbjct: 15  QTRTKPPPLYKVLLLNDDFTPMDFVIVVLQKFFGMDRERATRVMLQVHREGMGVCGVFPK 74

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ++A  KV QV+ ++RQHQ+PL C+ME+
Sbjct: 75  DVAATKVEQVVAFARQHQHPLACVMEE 101


>gi|126667265|ref|ZP_01738238.1| ATP-dependent Clp protease adaptor protein ClpS [Marinobacter sp.
           ELB17]
 gi|126628210|gb|EAZ98834.1| ATP-dependent Clp protease adaptor protein ClpS [Marinobacter sp.
           ELB17]
          Length = 117

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/103 (39%), Positives = 60/103 (58%), Gaps = 1/103 (0%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
           +      + L         ++ P  +RV+L+ND+YTPM+FV+ VL  FF  + E A  +M
Sbjct: 14  ESEPGRHDQLSLAPE-KPALKRPAQFRVILLNDDYTPMDFVVEVLTTFFGMNEEKATQVM 72

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L VH QG   CGVY+ +IAE K  QV +YS +  +PL C +E+
Sbjct: 73  LLVHTQGKAVCGVYSRDIAETKAAQVNHYSSECDHPLLCEIER 115


>gi|67460273|sp|Q6FZM5|CLPS_BARQU RecName: Full=ATP-dependent Clp protease adapter protein ClpS
          Length = 110

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 54/108 (50%), Positives = 71/108 (65%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
                 K   E  +      +  SK++ PKLYRV L ND+YTPM+FV+ VL+NFF K  E
Sbjct: 1   MQNEKGKNWDESRHDAVIIPKMRSKLQKPKLYRVFLFNDDYTPMDFVVFVLKNFFKKSFE 60

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
            A  IML VH  G+GECG+Y+YE+AEMKV QV   + Q+++PLQC+ME
Sbjct: 61  EATHIMLNVHQNGVGECGIYSYEVAEMKVIQVRECAHQNEHPLQCVME 108


>gi|326405326|ref|YP_004285408.1| ATP-dependent Clp protease adaptor protein ClpS [Acidiphilium
           multivorum AIU301]
 gi|325052188|dbj|BAJ82526.1| ATP-dependent Clp protease adaptor protein ClpS [Acidiphilium
           multivorum AIU301]
          Length = 106

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/91 (43%), Positives = 63/91 (69%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
             +  ++ + P LYRV++ ND+YTPMEFV+  L   F K  + A  I L++H +G+G CG
Sbjct: 15  ATQARARAKRPPLYRVMMFNDDYTPMEFVVATLVGLFGKTTDEAGRIALRIHRRGVGVCG 74

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ++ YEIAE K+ QV+  +R++Q+PLQC++E 
Sbjct: 75  IFTYEIAETKMIQVLELARENQHPLQCMIEP 105


>gi|304311206|ref|YP_003810804.1| ATP-dependent Clp protease adaptor protein [gamma proteobacterium
           HdN1]
 gi|301796939|emb|CBL45152.1| ATP-dependent Clp protease adaptor protein [gamma proteobacterium
           HdN1]
          Length = 120

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 46/108 (42%), Positives = 70/108 (64%), Gaps = 1/108 (0%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET 89
           +M     +  +   D  VR +S +V  P +++VL++ND+YTPMEFV+ VLQ FF  + E 
Sbjct: 12  QMMANRPSVTEAEGDLAVREASAEVAPPPMFQVLMLNDDYTPMEFVVEVLQRFFGMNREA 71

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +ML VH +G   CGV+  ++AE K  QVM Y+R++Q+PL C +E+
Sbjct: 72  ATQVMLIVHTKGQASCGVFTKDVAETKAMQVMKYARENQHPLMCRIER 119


>gi|319408390|emb|CBI82045.1| Clp protease adaptor protein [Bartonella schoenbuchensis R1]
          Length = 119

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 55/108 (50%), Positives = 72/108 (66%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
                 KG +E         +   K + PKLYRVLL+ND+YTPM+FV+ +L++FF K  E
Sbjct: 12  MQNEKGKGWSEDKYDTIVIPQVKPKFQKPKLYRVLLLNDDYTPMDFVVFILESFFKKSFE 71

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
               IML VH  G+GECGVY YE+AEMKV QVM  +RQ+++PLQC+ME
Sbjct: 72  ETTRIMLNVHQNGVGECGVYTYEVAEMKVVQVMECARQNEHPLQCVME 119


>gi|290473958|ref|YP_003466832.1| modulator of ClpA substrate specificity [Xenorhabdus bovienii
           SS-2004]
 gi|289173265|emb|CBJ80040.1| modulator of ClpA substrate specificity [Xenorhabdus bovienii
           SS-2004]
          Length = 106

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/92 (44%), Positives = 62/92 (67%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E +    ++ P +Y+V+L ND+YTPMEFV+ VL+ FF  D E A  +ML +H+QG   C
Sbjct: 14  IEDKTEQTLQPPSMYKVILNNDDYTPMEFVVDVLRKFFSYDVERATQLMLDIHYQGKAIC 73

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G+Y  E+AE K  QV  Y+++H++PL C +E+
Sbjct: 74  GIYTAEVAETKAAQVNMYAKEHEHPLLCSLEK 105


>gi|90408367|ref|ZP_01216530.1| ATP-dependent Clp protease adaptor protein ClpS [Psychromonas sp.
           CNPT3]
 gi|90310530|gb|EAS38652.1| ATP-dependent Clp protease adaptor protein ClpS [Psychromonas sp.
           CNPT3]
          Length = 108

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 70/106 (66%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+ K   +  N      +  +K++ P +Y VLL ND+YTPM+FVI VLQ FF    + A 
Sbjct: 1   MSDKNSVQTGNSPAVLDKLETKLQPPAMYNVLLHNDDYTPMDFVIDVLQRFFQLSTDKAT 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IML VH+  IG CG ++ EIAE KV QVMNY++++++PL+C M++
Sbjct: 61  QIMLDVHYHDIGICGTFSAEIAETKVMQVMNYAQENEHPLRCSMQK 106


>gi|145589929|ref|YP_001156526.1| ATP-dependent Clp protease adaptor protein ClpS [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145048335|gb|ABP34962.1| ATP-dependent Clp protease adaptor protein ClpS [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 118

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 68/110 (61%)

Query: 28  ADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
             +         +        +   +++ P +Y+VLL+ND+YTPMEFV+ V+Q +F KDH
Sbjct: 8   PKNPTTGIPANPYAEDTILLEKQVEQIKAPSMYKVLLLNDDYTPMEFVVMVIQEYFNKDH 67

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ETA  IML+VH  G G CGV+  ++A  KV+QV+  SR+  +PLQC ME+
Sbjct: 68  ETATRIMLQVHLVGKGICGVFTRDVAATKVHQVIELSREAGHPLQCTMEE 117


>gi|152993643|ref|YP_001359364.1| ATP-dependent Clp protease, adaptor protein ClpS [Sulfurovum sp.
           NBC37-1]
 gi|151425504|dbj|BAF73007.1| ATP-dependent Clp protease, adaptor protein ClpS [Sulfurovum sp.
           NBC37-1]
          Length = 99

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 62/97 (63%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              + E     ++  P++Y+VLL ND+YT M+FV+ VL + F+K  E A  IML++H +G
Sbjct: 2   PKFEVESDVELELWEPQMYKVLLHNDDYTSMDFVVEVLTSIFHKTQEQAVQIMLQIHEKG 61

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              CGVY++EIA+ K  QV   ++++++PL   +E+ 
Sbjct: 62  KAICGVYSFEIAQTKAEQVKQLAKKNEFPLLATIEED 98


>gi|113869007|ref|YP_727496.1| ATP-dependent Clp protease adaptor protein ClpS [Ralstonia eutropha
           H16]
 gi|194290613|ref|YP_002006520.1| ATP-dependent clp protease adaptor protein clps [Cupriavidus
           taiwanensis LMG 19424]
 gi|123133653|sp|Q0K793|CLPS_RALEH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238692769|sp|B3R6C0|CLPS_CUPTR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|113527783|emb|CAJ94128.1| ATP-dependent Clp protease adaptor protein [Ralstonia eutropha H16]
 gi|193224448|emb|CAQ70459.1| ATP-dependent Clp protease substrate specificity regulator
           [Cupriavidus taiwanensis LMG 19424]
          Length = 108

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/96 (44%), Positives = 63/96 (65%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
                  R    ++ P +++V+L+ND+YTPMEFV+ +LQ +F +D ETA  IML VH +G
Sbjct: 12  EAGTILERKEQALKPPAMFKVVLLNDDYTPMEFVVMILQQYFSRDRETATQIMLTVHREG 71

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CG+Y  +IA  KV  V  ++RQ  +PLQC+ME+
Sbjct: 72  KGVCGIYTRDIAATKVELVSTHARQAGHPLQCVMEE 107


>gi|30249694|ref|NP_841764.1| hypothetical protein NE1732 [Nitrosomonas europaea ATCC 19718]
 gi|37076996|sp|Q82TY3|CLPS_NITEU RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|30180731|emb|CAD85643.1| DUF174 [Nitrosomonas europaea ATCC 19718]
          Length = 103

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 42/94 (44%), Positives = 68/94 (72%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
               +  +++  P LY+V+L+ND++TPM+FV+ VL++FF  + E A  +MLK+H +G G 
Sbjct: 10  SIIEKGRARLNPPPLYKVILINDDFTPMDFVVKVLRHFFLMNEEMATKVMLKIHIEGAGI 69

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CG+Y  +IA  KV QV ++SRQ+Q+PL C+ME++
Sbjct: 70  CGIYPSDIAVTKVQQVNDFSRQNQHPLMCVMEKE 103


>gi|121611395|ref|YP_999202.1| ATP-dependent Clp protease adaptor protein ClpS [Verminephrobacter
           eiseniae EF01-2]
 gi|158514006|sp|A1WRC7|CLPS_VEREI RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|121556035|gb|ABM60184.1| ATP-dependent Clp protease adaptor protein ClpS [Verminephrobacter
           eiseniae EF01-2]
          Length = 119

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 34  KKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
                  D+     +     K   P++Y+V+++ND+YTPMEFVI VLQ FF KD ETA  
Sbjct: 13  PATRPAPDDGGAVVLERRPEKTPPPQMYQVVMLNDDYTPMEFVIVVLQEFFSKDRETATR 72

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           IMLK+H  G G CGVY++++A  KV+QV++ + +  +PLQC+ E 
Sbjct: 73  IMLKIHLDGKGICGVYSHDVAATKVDQVLDAALKAGHPLQCVSEP 117


>gi|238897684|ref|YP_002923363.1| regulatory protein for ClpA substrate specificity [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229465441|gb|ACQ67215.1| regulatory protein for ClpA substrate specificity [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 105

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 60/84 (71%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           V+ P +Y+V+L ND+YTPMEFV+ VLQNFF  + E A  +MLKVH+QG   CG +  E+A
Sbjct: 21  VKPPDMYKVILNNDDYTPMEFVVDVLQNFFSYNLEQATALMLKVHYQGKAICGTFTAEVA 80

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQ 137
           E KV  V  Y+R++++P  C +E+
Sbjct: 81  ETKVASVNQYARENEHPFLCTLEK 104


>gi|289805673|ref|ZP_06536302.1| ATP-dependent Clp protease adaptor protein ClpS [Salmonella
           enterica subsp. enterica serovar Typhi str. AG3]
          Length = 107

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 45/94 (47%), Positives = 60/94 (63%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D     E      ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+Q
Sbjct: 9   DFDQLVEDSVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCI 134
           G   CGV+  E+AE KV  V  Y+R++++PL C 
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCT 102


>gi|312881479|ref|ZP_07741271.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309370845|gb|EFP98305.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 106

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 62/102 (60%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                    +      +KV  P +Y V+L ND+YTPMEFVI +L+ FF  D + A  +ML
Sbjct: 4   DFEWVSPDHELLELEKTKVTPPSMYNVILNNDDYTPMEFVIEILERFFSMDIDKATQVML 63

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           KVH++G   CG +  E+AE KV QV  +S+++++PL C ME+
Sbjct: 64  KVHYEGKAICGTFTAEVAETKVAQVTLHSKENEHPLLCTMER 105


>gi|15838043|ref|NP_298731.1| ATP-dependent Clp protease adaptor protein ClpS [Xylella fastidiosa
           9a5c]
 gi|12230825|sp|Q9PDD7|CLPS_XYLFA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|9106460|gb|AAF84251.1|AE003974_6 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 106

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 54/106 (50%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M++K + + DN L  E   ++KV  P  Y+VLL+ND+YTPM+FVI VLQ FF  D + A 
Sbjct: 1   MSQKTVHDQDNALLLET-GNTKVAPPPRYQVLLLNDDYTPMDFVIVVLQQFFAMDLKKAT 59

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH +G G CG Y  E+AE KV QV  +SR HQ+PL C M+Q
Sbjct: 60  QVMLHVHTRGCGVCGFYTREVAESKVAQVNEFSRIHQHPLLCTMKQ 105


>gi|124267648|ref|YP_001021652.1| hypothetical protein Mpe_A2462 [Methylibium petroleiphilum PM1]
 gi|124260423|gb|ABM95417.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 118

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 47/104 (45%), Positives = 67/104 (64%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
                 +         R S++V  P++Y+V+L+ND+YTPMEFV+ VLQ FF +D ETA  
Sbjct: 13  RPVTKPDDGQGAVVAERQSARVEPPRMYQVVLLNDDYTPMEFVVMVLQEFFQRDIETATQ 72

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           IMLK+HH+G G CGVY  ++A  KV  V+  +++  +PLQC ME
Sbjct: 73  IMLKIHHEGRGVCGVYTKDVASTKVESVLAAAKRSGHPLQCTME 116


>gi|24214803|ref|NP_712284.1| ATP-dependent Clp protease adaptor protein ClpS [Leptospira
           interrogans serovar Lai str. 56601]
 gi|45657680|ref|YP_001766.1| hypothetical protein LIC11815 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|37077224|sp|Q8F4D8|CLPS_LEPIN RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|67460336|sp|Q72RD1|CLPS_LEPIC RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|24195812|gb|AAN49302.1| ATP-dependent Clp protease adaptor protein ClpS [Leptospira
           interrogans serovar Lai str. 56601]
 gi|45600920|gb|AAS70403.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 111

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 41/101 (40%), Positives = 61/101 (60%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
             I  FD    +  +   K++ P  YRV+++ND++TPMEFV+ +LQ  F++    ++ IM
Sbjct: 2   SDIFRFDTEEQTLTKEKIKLKKPSKYRVIILNDDFTPMEFVVWILQMVFHRSRAESQQIM 61

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
           LK H  G   CGVY++++A  KV QV   + QH YPL C M
Sbjct: 62  LKAHITGKALCGVYSHDVARTKVAQVQQLAEQHGYPLHCTM 102


>gi|89092941|ref|ZP_01165893.1| ATP-dependent Clp protease adaptor protein ClpS [Oceanospirillum
           sp. MED92]
 gi|89082966|gb|EAR62186.1| ATP-dependent Clp protease adaptor protein ClpS [Oceanospirillum
           sp. MED92]
          Length = 120

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 33  NKKGIAEFDNCLDSEVR-FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           N+    EFD+           +++ P +YRV+L+ND+YTPM+FV+ VL  FF  D E A 
Sbjct: 14  NEDEHEEFDHDHGLATEEAKPELKKPSMYRVVLMNDDYTPMDFVVAVLMMFFSMDQEKAT 73

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML VH QG G CG++  ++A+ K   V  Y+R + +PL C +E+
Sbjct: 74  QVMLAVHTQGKGVCGIFTRDVADTKAAIVNQYARDNSHPLLCEVEK 119


>gi|308272838|emb|CBX29442.1| ATP-dependent Clp protease adapter protein clpS [uncultured
           Desulfobacterium sp.]
          Length = 105

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M      E +  + SE R    ++ P +++VLL ND+YT M+FV+ +L   FYK  E A 
Sbjct: 1   MGNNISPEIEESITSETRKE--IKEPSMFKVLLHNDDYTTMDFVVEILMRVFYKSIEEAI 58

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IML VH QG+G CG+Y YEIAE K+N V + SR   +PL+C +E+
Sbjct: 59  QIMLNVHRQGMGVCGLYTYEIAETKMNSVHSLSRDRGFPLRCSIEK 104


>gi|241763390|ref|ZP_04761445.1| ATP-dependent Clp protease adaptor protein ClpS [Acidovorax
           delafieldii 2AN]
 gi|241367432|gb|EER61743.1| ATP-dependent Clp protease adaptor protein ClpS [Acidovorax
           delafieldii 2AN]
          Length = 122

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 49/120 (40%), Positives = 71/120 (59%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFS-SKVRVPKLYRVLLVNDNYTPMEFVIH 77
           +  M+    +            D+     +     KVR P++Y+V+++ND+YTPMEFVI 
Sbjct: 1   MNFMATKPPSTPTAPPSVRPAQDDGGSVVLERRAQKVRPPQMYQVVMLNDDYTPMEFVIV 60

Query: 78  VLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VLQ FF KD ETA  IMLK+H  G G CGVY+ ++A  KV+QV+  + +  +PLQC+ E 
Sbjct: 61  VLQEFFNKDRETATQIMLKIHLDGKGICGVYSRDVAATKVDQVLEAALKAGHPLQCVSEP 120


>gi|297570438|ref|YP_003691782.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296926353|gb|ADH87163.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 105

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 67/104 (64%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
             +++    LD+  R   ++R P  Y+VLL ND+YT M+FV+ VL+  F  D ++A  IM
Sbjct: 2   SNMSQDQTGLDAVTREEQELRQPPRYKVLLHNDDYTTMDFVVTVLETVFKHDTDSAHRIM 61

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + VH +G+G  GVY  ++AE K   V N +R+H+YPL+C +E++
Sbjct: 62  MSVHKEGVGVAGVYPRDVAETKSAMVHNLARKHEYPLKCSLERE 105


>gi|114778159|ref|ZP_01453046.1| hypothetical protein SPV1_00837 [Mariprofundus ferrooxydans PV-1]
 gi|114551577|gb|EAU54131.1| hypothetical protein SPV1_00837 [Mariprofundus ferrooxydans PV-1]
          Length = 112

 Score =  129 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 66/104 (63%), Gaps = 1/104 (0%)

Query: 36  GIAEFDNCLDSEVRF-SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
            I   D+  + E      +++ P ++R+L++ND++TPM+FV+ VL  FF+K   TA  +M
Sbjct: 3   EITTPDSVRNPETETAEPQLQPPPMFRILMLNDDFTPMDFVVDVLIRFFHKSEATANQLM 62

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L++H +G   CG+Y  +IAE K+ QV   SR   +PL+CIME+ 
Sbjct: 63  LQIHLEGRAMCGIYPRDIAETKLQQVEAASRTSGHPLRCIMEKD 106


>gi|94987059|ref|YP_594992.1| hypothetical protein LI0617 [Lawsonia intracellularis PHE/MN1-00]
 gi|229889821|sp|Q1MQQ6|CLPS_LAWIP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|94731308|emb|CAJ54671.1| uncharacterized conserved protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 109

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 62/106 (58%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M +      +     E+    K+R PK+Y+VLL NDNYT MEFV+ +L   F K  E A 
Sbjct: 1   MTQSSYNPIEQEGSPELLLQEKIRRPKMYQVLLHNDNYTTMEFVVSILMKIFRKTMEQAT 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IML VH +GIG  GVY  E+AE KVN     +R+  +PL+C +++
Sbjct: 61  SIMLSVHRKGIGVAGVYTRELAETKVNTTHMLAREAGFPLRCTLQE 106


>gi|152990128|ref|YP_001355850.1| ATP-dependent Clp protease, adaptor protein ClpS [Nitratiruptor sp.
           SB155-2]
 gi|151421989|dbj|BAF69493.1| ATP-dependent Clp protease, adaptor protein ClpS [Nitratiruptor sp.
           SB155-2]
          Length = 97

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 43/96 (44%), Positives = 64/96 (66%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               E +   K+  PK Y+V L+ND+YT M+FV+ +L + F K +E A  IML +H QG 
Sbjct: 2   GEKVETKEVVKLEEPKKYKVFLLNDDYTTMDFVVDILCDIFDKSYEEAVNIMLTIHRQGK 61

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G CG+Y YEIAE K++QV   +R H++PL+ +ME++
Sbjct: 62  GLCGIYTYEIAETKIDQVHRLARAHEFPLKAVMEEE 97


>gi|222111090|ref|YP_002553354.1| ATP-dependent clp protease adaptor protein clps [Acidovorax ebreus
           TPSY]
 gi|221730534|gb|ACM33354.1| ATP-dependent Clp protease adaptor protein ClpS [Acidovorax ebreus
           TPSY]
          Length = 122

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 70/120 (58%), Gaps = 1/120 (0%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIH 77
           +  M+      + +       +D      +   + K + P++Y+V+++ND+YTPMEFV+ 
Sbjct: 1   MKFMATTPPIPAPVPAPTPPSWDEGGSVVLERRTQKTQPPQMYQVVMLNDDYTPMEFVVV 60

Query: 78  VLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VLQ FF KD E A  IMLK+H  G G CGVY  ++A  KV+QV+  + +  +PLQC+ E 
Sbjct: 61  VLQEFFNKDREAATQIMLKIHLDGKGVCGVYTRDVAATKVDQVLEAAHKAGHPLQCLSEP 120


>gi|319763343|ref|YP_004127280.1| ATP-dependent clp protease adaptor protein clps [Alicycliphilus
           denitrificans BC]
 gi|317117904|gb|ADV00393.1| ATP-dependent Clp protease adaptor protein ClpS [Alicycliphilus
           denitrificans BC]
          Length = 120

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/101 (43%), Positives = 65/101 (64%), Gaps = 1/101 (0%)

Query: 38  AEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
              D    + +   + K + P++Y+V+++ND+YTPMEFV+ VLQ FF KD E A  IMLK
Sbjct: 18  PSRDEGGSAVLERRTQKTKPPQMYQVVMLNDDYTPMEFVVVVLQEFFNKDREAATQIMLK 77

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +H  G G CGVY  ++A  KV QV++ + +  +PLQC+ E 
Sbjct: 78  IHLDGKGVCGVYTRDVAATKVEQVLDAAHRAGHPLQCVSEP 118


>gi|27065491|pdb|1LZW|A Chain A, Structural Basis Of Clps-Mediated Switch In Clpa Substrate
           Recognition
 gi|27065646|pdb|1MG9|A Chain A, The Structural Basis Of Clps-Mediated Switch In Clpa
           Substrate Recognition
          Length = 106

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 64/97 (65%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    +E +    ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML V +Q
Sbjct: 9   DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVAYQ 68

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G   CGV+  E+AE KV  V  Y+R++++PL C +E+
Sbjct: 69  GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEK 105


>gi|320335153|ref|YP_004171864.1| ATP-dependent Clp protease adapter protein clpS [Deinococcus
           maricopensis DSM 21211]
 gi|319756442|gb|ADV68199.1| ATP-dependent Clp protease adapter protein clpS [Deinococcus
           maricopensis DSM 21211]
          Length = 114

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 63/99 (63%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            D+   +++    ++  P+ Y VLL+ND+YTPM+FV++VL++ F +D   A  IML VHH
Sbjct: 8   PDSGAGTQLAQRPRLARPRRYTVLLLNDDYTPMDFVVYVLEHHFGRDEPDATRIMLAVHH 67

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           QG G  GVY  E+AE KV QV   +R   YPL+ + E +
Sbjct: 68  QGRGVAGVYTREVAETKVAQVTRLARAQGYPLELLAEPE 106


>gi|319783684|ref|YP_004143160.1| ATP-dependent Clp protease adaptor protein ClpS [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317169572|gb|ADV13110.1| ATP-dependent Clp protease adaptor protein ClpS [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 122

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 54/82 (65%), Positives = 71/82 (86%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
           P LYRVL++ND+YTPMEFV+HVL+ FF KD E A  IML VH+ G+GECGVY +E+AE K
Sbjct: 41  PSLYRVLILNDDYTPMEFVVHVLERFFQKDREAATRIMLHVHNHGVGECGVYTFEVAETK 100

Query: 117 VNQVMNYSRQHQYPLQCIMEQK 138
           V+QVM+++RQ+Q+PLQC+ME+K
Sbjct: 101 VSQVMDFARQNQHPLQCVMEKK 122


>gi|118594453|ref|ZP_01551800.1| ATP-dependent Clp protease adaptor protein ClpS [Methylophilales
           bacterium HTCC2181]
 gi|118440231|gb|EAV46858.1| ATP-dependent Clp protease adaptor protein ClpS [Methylophilales
           bacterium HTCC2181]
          Length = 103

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 47/102 (46%), Positives = 75/102 (73%), Gaps = 1/102 (0%)

Query: 37  IAEFDNCLDSEVRF-SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
           ++E ++  D +     +K ++P LY+V+++ND+YTPMEFV+  +Q  F K H+ A  IML
Sbjct: 1   MSEINHSDDVKTSPNRTKPKLPSLYKVIILNDDYTPMEFVVFSIQKVFQKSHDEATRIML 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           K+H +GIG CG++  EIAE K+ QV+N +++HQ+PLQCI+E+
Sbjct: 61  KIHTEGIGVCGMFPLEIAETKMKQVLNLAKEHQHPLQCIIEK 102


>gi|308049699|ref|YP_003913265.1| ATP-dependent Clp protease adaptor protein ClpS [Ferrimonas
           balearica DSM 9799]
 gi|307631889|gb|ADN76191.1| ATP-dependent Clp protease adaptor protein ClpS [Ferrimonas
           balearica DSM 9799]
          Length = 104

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 63/100 (63%), Gaps = 3/100 (3%)

Query: 41  DNCLDSEVRFSSK---VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
           D  LD  V    +   V  P LY+V+L ND+YTPMEFV+ VL  FF    E A  +ML V
Sbjct: 4   DTELDHVVEHEKQSQAVEPPPLYKVVLNNDDYTPMEFVVEVLTKFFALTQEQATEVMLTV 63

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H++G G CGV+ Y++AE K  QV  YSR+H++PL C  E+
Sbjct: 64  HYKGKGVCGVFTYDVAETKAAQVNRYSREHEHPLLCSTEK 103


>gi|284007607|emb|CBA73211.1| ATP-dependent Clp protease adaptor protein [Arsenophonus nasoniae]
          Length = 89

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 59/87 (67%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
              ++ P +Y+V+L ND++TPM+FV+ VL+ +F  D E A  IML VH  G G CGVY  
Sbjct: 2   EHALQPPSMYKVILNNDDFTPMDFVVQVLKKYFSFDEEQATQIMLDVHFHGKGICGVYTA 61

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           E+AE K  QV  Y+R+H+YPL C +E+
Sbjct: 62  EVAETKAAQVNIYAREHEYPLLCTIEE 88


>gi|330825577|ref|YP_004388880.1| ATP-dependent Clp protease adapter protein clpS [Alicycliphilus
           denitrificans K601]
 gi|329310949|gb|AEB85364.1| ATP-dependent Clp protease adapter protein clpS [Alicycliphilus
           denitrificans K601]
          Length = 120

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/98 (44%), Positives = 64/98 (65%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            +       R + K + P++Y+V+++ND+YTPMEFV+ VLQ FF KD E A  IMLK+H 
Sbjct: 21  DEGGSAVLERRTQKTKPPQMYQVVMLNDDYTPMEFVVVVLQEFFNKDREAATQIMLKIHL 80

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G G CGVY  ++A  KV QV++ + +  +PLQC+ E 
Sbjct: 81  DGKGVCGVYTRDVAATKVEQVLDAAHRAGHPLQCVSEP 118


>gi|262198176|ref|YP_003269385.1| ATP-dependent Clp protease adaptor protein ClpS [Haliangium
           ochraceum DSM 14365]
 gi|262081523|gb|ACY17492.1| ATP-dependent Clp protease adaptor protein ClpS [Haliangium
           ochraceum DSM 14365]
          Length = 116

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 62/109 (56%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
            S  + K            ++  ++ + P LY+VLL ND+YT  EFV+ VLQ+ F +   
Sbjct: 6   SSHDSGKKRPGTKEERGVAIKERTRTKKPPLYKVLLHNDDYTTKEFVVWVLQSIFQRSES 65

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            A  IM+ VH+ G+G  G+Y  E+AE K+ +  N ++ H+YPLQC ME 
Sbjct: 66  EAVRIMMHVHNTGVGIAGIYTLEVAETKMTKTTNLAQAHEYPLQCSMEP 114


>gi|261856347|ref|YP_003263630.1| ATP-dependent Clp protease adaptor protein ClpS [Halothiobacillus
           neapolitanus c2]
 gi|261836816|gb|ACX96583.1| ATP-dependent Clp protease adaptor protein ClpS [Halothiobacillus
           neapolitanus c2]
          Length = 104

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/96 (44%), Positives = 64/96 (66%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              D+E    + V  P +Y+V+L+ND++TPM+FVI +L   FY   E A+ +ML+VHH+G
Sbjct: 6   TTTDTESIPEAIVAEPPMYQVILLNDDFTPMDFVIRILVELFYLSTEQAERVMLEVHHKG 65

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CG++  EIAE +V QV   +RQ+ +PL C+ME 
Sbjct: 66  RGVCGIFTREIAETRVAQVNQVARQNDHPLLCVMEP 101


>gi|149919976|ref|ZP_01908451.1| ATP-dependent Clp protease adaptor protein clpS [Plesiocystis
           pacifica SIR-1]
 gi|149819249|gb|EDM78683.1| ATP-dependent Clp protease adaptor protein clpS [Plesiocystis
           pacifica SIR-1]
          Length = 113

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 64/107 (59%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+ K   +    +  + R   K + P++YRVLL ND+YTPM+FV+ +LQ  F      A 
Sbjct: 1   MSDKRKDDPQRGVALKTRDERKSKRPRMYRVLLHNDDYTPMDFVVRLLQTVFRHSEGRAT 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML VH++G+G  GV+ +EIAE KV Q    +RQ++ PL   ME +
Sbjct: 61  EIMLHVHNKGVGVAGVFTHEIAETKVAQTHMLARQNECPLMASMEPE 107


>gi|323697696|ref|ZP_08109608.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio sp.
           ND132]
 gi|323457628|gb|EGB13493.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           desulfuricans ND132]
          Length = 104

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 62/102 (60%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
                +  DSE+    +V+ PK Y+VLL ND+YT M+FV+ +L   F++    A  IML 
Sbjct: 3   DPFTGDRSDSELLGQHEVKEPKKYKVLLHNDDYTTMDFVVEILVRVFHRTEAQATAIMLS 62

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           VH+QG G CGVY  E+AE KV+ V   ++   +PL+C ME +
Sbjct: 63  VHNQGYGVCGVYTAEVAETKVDLVHRLAKSAGFPLKCSMEGE 104


>gi|119470167|ref|ZP_01612933.1| modulator of ClpA substrate specificity [Alteromonadales bacterium
           TW-7]
 gi|119446588|gb|EAW27862.1| modulator of ClpA substrate specificity [Alteromonadales bacterium
           TW-7]
          Length = 105

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
           K     D   DSE     K++ P+ Y+V+L ND+YTPM+FVI VL  FF  D + A  +M
Sbjct: 5   KDSGVIDTVRDSE---KQKLQPPRKYKVVLNNDDYTPMDFVIEVLTTFFNMDSDRATDVM 61

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+VH +G G CGVY+ ++A  KV QV  YSR +++PL C  EQ+
Sbjct: 62  LQVHEKGKGICGVYSADVAYTKVEQVNRYSRDNEHPLLCSCEQE 105


>gi|171464059|ref|YP_001798172.1| ATP-dependent Clp protease adaptor protein ClpS [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171193597|gb|ACB44558.1| ATP-dependent Clp protease adaptor protein ClpS [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 118

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 47/112 (41%), Positives = 69/112 (61%)

Query: 26  FMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYK 85
               +         +        +   +V+VP +Y+VLL+ND+YTPMEFV+ V+Q +F K
Sbjct: 6   RAPKNPTTGNPGNPYIEDTILLEKQVEQVKVPSMYKVLLLNDDYTPMEFVVMVIQEYFNK 65

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           D+ETA  IML+VH  G G CGV+  ++A  KV+QV+  SR+  +PLQC ME+
Sbjct: 66  DYETATRIMLQVHLVGKGACGVFTRDVAATKVHQVIELSREAGHPLQCTMEE 117


>gi|331004964|ref|ZP_08328374.1| ATP-dependent Clp protease adaptor protein ClpS [gamma
           proteobacterium IMCC1989]
 gi|330421206|gb|EGG95462.1| ATP-dependent Clp protease adaptor protein ClpS [gamma
           proteobacterium IMCC1989]
          Length = 126

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/101 (36%), Positives = 60/101 (59%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
           K   ++ +           V+ P +Y+V+++ND+YTPMEFV++ L++FF    E A  +M
Sbjct: 20  KEDDDYHHDHLLVEEAKPVVKKPPMYKVIMLNDDYTPMEFVVYALESFFGMGTEQATKVM 79

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
           L+VH +G   CGVY  +IAE K  QV   +  +++PL C +
Sbjct: 80  LQVHTEGKAICGVYTKDIAETKAAQVNQCAADNEHPLLCEI 120


>gi|298530330|ref|ZP_07017732.1| ATP-dependent Clp protease adaptor protein ClpS
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509704|gb|EFI33608.1| ATP-dependent Clp protease adaptor protein ClpS
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 104

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 58/87 (66%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
             +++ P+ Y+VLL ND+YT MEFV+HVLQ  F+K    A  IML VH  G G CG+Y  
Sbjct: 17  EEEIKEPQRYKVLLHNDDYTTMEFVVHVLQKVFHKTESEAMHIMLSVHKNGTGVCGIYTG 76

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           E+AE KV  V + +R+  YPL+C ME+
Sbjct: 77  EVAETKVAMVTSMARKKGYPLKCTMEE 103


>gi|34499123|ref|NP_903338.1| hypothetical protein CV_3668 [Chromobacterium violaceum ATCC 12472]
 gi|39930967|sp|Q7NRW1|CLPS_CHRVO RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|34104974|gb|AAQ61330.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 106

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 63/83 (75%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAE 114
             P +Y+VLL+ND++TPM+FV+ VLQ FF+ + E A  IML+VH QG G CGVY  ++A 
Sbjct: 23  NPPPMYKVLLLNDDFTPMDFVVQVLQQFFHMNREKATHIMLQVHTQGHGVCGVYTKDVAA 82

Query: 115 MKVNQVMNYSRQHQYPLQCIMEQ 137
            KV QV+ Y++ HQ+PLQC+ME+
Sbjct: 83  TKVEQVLQYAKAHQHPLQCVMEE 105


>gi|12230837|sp|Q9RWS9|CLPS_DEIRA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
          Length = 113

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 68/109 (62%), Gaps = 2/109 (1%)

Query: 32  MNKKGIAEFDNCLDSEVRF--SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET 89
           M +  I       +   +    ++ + P+L+RVLL+ND+YTPM++V+ VL+ FF K  + 
Sbjct: 1   MTRPTIPPGPPGAEGRTQTLERTETKKPRLWRVLLLNDDYTPMDYVVQVLEQFFRKTEQE 60

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           A+ IML VHH+G G  GVY  ++AE KV QV  ++++  +PL+ + E +
Sbjct: 61  AELIMLAVHHKGQGVAGVYTRDVAETKVAQVTAHAQREGHPLRVVAEPE 109


>gi|332035126|gb|EGI71639.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 102

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
           K     D   DSE     K++ P+ Y+V+L ND+YTPM+FVI VL  FF  D + A  +M
Sbjct: 2   KDSGVIDTVRDSE---KQKLQPPRKYKVVLNNDDYTPMDFVIEVLTTFFNMDSDRATDVM 58

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+VH +G G CGVY+ ++A  KV QV  YSR +++PL C  EQ+
Sbjct: 59  LQVHEKGKGICGVYSADVAHTKVEQVNRYSRDNEHPLLCSCEQE 102


>gi|86157217|ref|YP_464002.1| ATP-dependent Clp protease adaptor protein ClpS [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85773728|gb|ABC80565.1| ATP-dependent Clp protease adaptor protein ClpS [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 108

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 62/108 (57%), Gaps = 1/108 (0%)

Query: 32  MNKKGIAEFDNCLDS-EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
           M ++     D  +   + R   + + P LY+VLL ND+YT  EFV +VL   F  D E+A
Sbjct: 1   MAERTRPGGDTDVVVPKTRAERETKRPPLYKVLLHNDHYTTQEFVDYVLMTVFNHDPESA 60

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             IML VH  G+G  G+Y YEIAE K  + ++ +R+ +YPL   +E +
Sbjct: 61  HRIMLHVHMHGVGVAGIYPYEIAETKARKTLDLAREAEYPLLVTIEPE 108


>gi|317487405|ref|ZP_07946193.1| ATP-dependent Clp protease adaptor protein ClpS [Bilophila
           wadsworthia 3_1_6]
 gi|316921337|gb|EFV42635.1| ATP-dependent Clp protease adaptor protein ClpS [Bilophila
           wadsworthia 3_1_6]
          Length = 108

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/111 (40%), Positives = 67/111 (60%), Gaps = 6/111 (5%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M+ +  +     + D  +D E      V  PK+Y+VLL ND+YT MEFV+++L   F+K 
Sbjct: 1   MSQNPFHAAPGGQPDVIMDVE------VAEPKMYQVLLHNDDYTTMEFVVNILMTVFHKT 54

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            + A  IML VH +G G  GVY +EIAE KV++    +R+  YPL+C +E+
Sbjct: 55  ADQATNIMLAVHKRGKGIAGVYPHEIAETKVDKTHFLAREAGYPLRCTLEE 105


>gi|257453454|ref|ZP_05618749.1| ATP-dependent Clp protease adaptor protein ClpS [Enhydrobacter
           aerosaccus SK60]
 gi|257449206|gb|EEV24154.1| ATP-dependent Clp protease adaptor protein ClpS [Enhydrobacter
           aerosaccus SK60]
          Length = 161

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
           +G    D   D  +    +++ P++Y V++ ND+YTPMEFV+ VLQN F    ++A  IM
Sbjct: 58  EGEPNTDPVEDVLL-ADPELKKPQMYAVVMYNDDYTPMEFVVDVLQNHFKHTLDSAISIM 116

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L +H QG G  G+Y  +IAE K   V   +RQ  YPL   +E +
Sbjct: 117 LAIHQQGKGIAGIYPKDIAETKAQAVNREARQAGYPLLSQIEPQ 160


>gi|254496296|ref|ZP_05109183.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254354484|gb|EET13132.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 107

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 70/107 (65%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+ + I E      +E    ++ ++P+ YRV+L+ND+YTPM+FV+ VL++FF+   E A 
Sbjct: 1   MSGQNIEEIVRHKVAEPEVRTENKLPRKYRVVLLNDDYTPMDFVVDVLKHFFHLSEEMAV 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +ML+VH QG G CGV+  +IAE KV  V  Y+R +Q+PL   ME +
Sbjct: 61  QVMLQVHIQGKGVCGVFTRDIAETKVALVNEYARMNQHPLLSSMEPE 107


>gi|320354854|ref|YP_004196193.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfobulbus
           propionicus DSM 2032]
 gi|320123356|gb|ADW18902.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfobulbus
           propionicus DSM 2032]
          Length = 105

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/96 (43%), Positives = 63/96 (65%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               + R   +++ P LY+VLL ND+YT M+FV+ +LQ  F+K+ + A  IML VHHQG+
Sbjct: 9   QDKIQTRDKEQLQEPPLYKVLLHNDDYTTMDFVVMILQTVFHKNTDEATRIMLNVHHQGV 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G  GVY  EI E KV  V   ++++Q+PL+C +E+ 
Sbjct: 69  GIAGVYTREIGETKVAIVHRLAKRNQFPLRCSLEKD 104


>gi|89901532|ref|YP_524003.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodoferax
           ferrireducens T118]
 gi|122478825|sp|Q21UT1|CLPS_RHOFD RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|89346269|gb|ABD70472.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodoferax
           ferrireducens T118]
          Length = 120

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/103 (41%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 36  GIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
              + D      +   + K + P +Y+V+++ND+YTPMEFV+ V+Q FF KD E A  IM
Sbjct: 15  QEPDRDEGGAVVLERRTQKTKPPHMYQVVMLNDDYTPMEFVVVVIQEFFGKDLEAATRIM 74

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           LK+H  G G CGVY+ ++A  KV+QV++ + +  +PL+CI E 
Sbjct: 75  LKIHLDGKGVCGVYSKDVAATKVDQVLDAANKAGHPLKCISEP 117


>gi|319956042|ref|YP_004167305.1| ATP-dependent clp protease adaptor protein clps [Nitratifractor
           salsuginis DSM 16511]
 gi|319418446|gb|ADV45556.1| ATP-dependent Clp protease adaptor protein ClpS [Nitratifractor
           salsuginis DSM 16511]
          Length = 99

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 55/82 (67%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
           P+LYRV+L ND+YT MEFVI VL++ F+K    A+ IM  VH +G   CGVY YEIAE K
Sbjct: 17  PELYRVILHNDDYTTMEFVIDVLRSIFHKSTREAEEIMWTVHEKGQAVCGVYTYEIAETK 76

Query: 117 VNQVMNYSRQHQYPLQCIMEQK 138
           V QV   +RQ+ +PL   +E  
Sbjct: 77  VEQVKLKARQNGFPLLATLEAD 98


>gi|330427907|gb|AEC19241.1| ATP-dependent Clp protease adaptor protein ClpS [Pusillimonas sp.
           T7-7]
          Length = 107

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/101 (44%), Positives = 64/101 (63%), Gaps = 1/101 (0%)

Query: 38  AEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
            + +N   + +     K+  P +Y+V+L+ND+YTPMEFV+ VLQ  F K+ + A  IMLK
Sbjct: 3   PQIENQRTTVLDRQPAKLAPPPMYQVVLLNDDYTPMEFVVAVLQRIFGKNEDEAARIMLK 62

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VHH+G G CGVY  +IA  +V  V   +   Q+PLQC+ME 
Sbjct: 63  VHHEGRGVCGVYPRDIAATRVEMVRQMAHARQHPLQCVMEP 103


>gi|317153522|ref|YP_004121570.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316943773|gb|ADU62824.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 104

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 58/102 (56%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
                +    E+    +VR P+ Y+VLL ND+YT M+FVI VL   F K    A  IML 
Sbjct: 3   DPFTGDRTSPELFDEREVREPRKYKVLLHNDDYTTMDFVIEVLVRVFRKSEAQAMAIMLA 62

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           VH++G G CG Y  E+AE KV+ V   +R   +PL+C ME +
Sbjct: 63  VHNEGYGVCGTYTAEVAETKVDMVHRLARSAGFPLKCSMEGE 104


>gi|218885563|ref|YP_002434884.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|226706562|sp|B8DJU4|CLPS_DESVM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|218756517|gb|ACL07416.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           vulgaris str. 'Miyazaki F']
          Length = 100

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/98 (45%), Positives = 64/98 (65%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            D   D+E+    +VR P+++RVLL ND+YT MEFV+ +L   F +  + A  IML VH 
Sbjct: 2   PDGGRDTELLIEDEVREPRMFRVLLHNDDYTTMEFVVSILIEVFRRTPDEATRIMLAVHE 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G+GECGVY  E+AE KV  V   +R+  YPL+C +E+
Sbjct: 62  KGVGECGVYTAEVAETKVALVHARARREGYPLRCTLEE 99


>gi|94985574|ref|YP_604938.1| ATP-dependent Clp protease adaptor protein ClpS [Deinococcus
           geothermalis DSM 11300]
 gi|94555855|gb|ABF45769.1| ATP-dependent Clp protease adaptor protein ClpS [Deinococcus
           geothermalis DSM 11300]
          Length = 113

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 65/106 (61%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
            + G         +  R  +  + P+LYRVLL+ND+YTPM+FV+ VLQ +F K    A+ 
Sbjct: 5   RRDGEGRTGTLERAGTREQTTTQRPRLYRVLLLNDDYTPMDFVVEVLQTYFRKSETEAQL 64

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           IML VHH+G G  GVY  ++AE KV QV  ++R+  YPL+ + E +
Sbjct: 65  IMLAVHHKGQGVAGVYTRDVAETKVAQVTAHARRAGYPLRLVAEPE 110


>gi|77919855|ref|YP_357670.1| ATP-dependent Clp protease adaptor protein ClpS [Pelobacter
           carbinolicus DSM 2380]
 gi|77545938|gb|ABA89500.1| ATP-dependent Clp protease adaptor protein ClpS [Pelobacter
           carbinolicus DSM 2380]
          Length = 104

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 65/99 (65%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
           +  + +  E R +++   P L+RVL+ ND+YT MEFV+ VLQ  F+K    A  IML +H
Sbjct: 5   KTSSDVHIEERKATRTAPPPLFRVLMHNDDYTTMEFVVEVLQGVFHKSAAEAHRIMLNIH 64

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ++G G+CG + +EIAE KV +V   +RQ  +PL+C +E+
Sbjct: 65  NEGTGQCGTFPHEIAETKVARVHQVARQAGFPLRCSLEE 103


>gi|152997267|ref|YP_001342102.1| ATP-dependent Clp protease adaptor protein ClpS [Marinomonas sp.
           MWYL1]
 gi|150838191|gb|ABR72167.1| ATP-dependent Clp protease adaptor protein ClpS [Marinomonas sp.
           MWYL1]
          Length = 116

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
           ++       + +       ++++ P +Y+V+L ND+YTPM+FV+ VLQ FF  D E A  
Sbjct: 11  SEDDEQHGHSSIAIAPE-ETELKPPSMYQVVLFNDDYTPMDFVVFVLQRFFSMDGEKANQ 69

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +ML+VH +G G CG+Y ++IAE KV  V  +  Q+++PL C +++
Sbjct: 70  VMLEVHQKGKGVCGIYPFDIAETKVAMVQQFVEQNEHPLMCDLQK 114


>gi|332039758|gb|EGI76158.1| ATP-dependent Clp protease adaptor protein ClpS [Hylemonella
           gracilis ATCC 19624]
          Length = 126

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 47/115 (40%), Positives = 69/115 (60%), Gaps = 2/115 (1%)

Query: 25  IFMADSRMNKKGIAEFDNCLD--SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF 82
                  + K       N  D     R   KV+ P++++V+++ND+YTPMEFV+ V+Q +
Sbjct: 10  PAPPKLPVVKPDRENQGNGGDAVVLERRPQKVQPPQMFQVVMLNDDYTPMEFVVVVIQEY 69

Query: 83  FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           F KD ETA  IMLK+H  G G CGVY  ++A  KV+QV+  +R+  +PLQC+ E 
Sbjct: 70  FNKDLETATQIMLKIHLDGRGICGVYTKDVAATKVDQVLEAARKAGHPLQCVAEP 124


>gi|315126397|ref|YP_004068400.1| modulator of ClpA substrate specificity [Pseudoalteromonas sp.
           SM9913]
 gi|315014911|gb|ADT68249.1| modulator of ClpA substrate specificity [Pseudoalteromonas sp.
           SM9913]
          Length = 102

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/104 (44%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
           K     D   DSE     K++ P+ Y+V+L ND+YTPM+FVI +L  FF  D + A  +M
Sbjct: 2   KDSGVIDTVRDSE---KQKLQPPRKYKVVLNNDDYTPMDFVIEILMTFFNMDSDRATDVM 58

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L++H QG G CGVY+ ++A  K  QV  YSR +++PL C  EQ+
Sbjct: 59  LQIHQQGKGICGVYSADVAHTKAEQVNRYSRDNEHPLLCSCEQE 102


>gi|95930477|ref|ZP_01313213.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfuromonas
           acetoxidans DSM 684]
 gi|95133517|gb|EAT15180.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfuromonas
           acetoxidans DSM 684]
          Length = 103

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 56/100 (56%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
                  + EV    +   P  Y V++ ND+YT MEFV+ VL+N + K    A  IML +
Sbjct: 3   PPTQTTPEGEVLSKEQTARPPRYNVIMHNDDYTTMEFVVEVLENIYRKQPAEATRIMLAI 62

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           HH+G+  CG Y +EIAE KV Q    +R   +PL+C +E+
Sbjct: 63  HHEGLAVCGNYPFEIAETKVEQTHRRARSAGHPLRCSIEE 102


>gi|329905634|ref|ZP_08274165.1| ATP-dependent Clp protease adaptor protein ClpS [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327547556|gb|EGF32362.1| ATP-dependent Clp protease adaptor protein ClpS [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 102

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 46/101 (45%), Positives = 66/101 (65%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +A         VR + K++ P +Y+V L+ND+YTPMEFV+ ++Q +F KD E A  IML 
Sbjct: 1   MATKHENGTVLVRQTQKLKPPSMYQVYLLNDDYTPMEFVVAIIQEYFNKDRENATQIMLM 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VH  G G CGVY  +IA  KV  V+ ++R+  +PLQC+ME+
Sbjct: 61  VHRDGKGMCGVYPKDIASTKVELVLTHARKAGHPLQCVMEE 101


>gi|303327023|ref|ZP_07357465.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio sp.
           3_1_syn3]
 gi|302863011|gb|EFL85943.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio sp.
           3_1_syn3]
          Length = 106

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 62/98 (63%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            +   +S      K++ P  YRVLL ND+YT M+FVI++L   F+K  E A  IML VH 
Sbjct: 7   GEADGESRTIVVKKLKEPDRYRVLLHNDDYTSMDFVINILCGVFHKPLEEATAIMLAVHQ 66

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           QG+G+CG+Y  E+AE KV++V   +    +PL+C ME+
Sbjct: 67  QGVGQCGIYTREVAEAKVSRVHREAHGAGFPLRCTMEK 104


>gi|197121252|ref|YP_002133203.1| ATP-dependent Clp protease adaptor protein ClpS [Anaeromyxobacter
           sp. K]
 gi|220915956|ref|YP_002491260.1| ATP-dependent Clp protease adaptor protein ClpS [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|196171101|gb|ACG72074.1| ATP-dependent Clp protease adaptor protein ClpS [Anaeromyxobacter
           sp. K]
 gi|219953810|gb|ACL64194.1| ATP-dependent Clp protease adaptor protein ClpS [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 108

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 61/108 (56%), Gaps = 1/108 (0%)

Query: 32  MNKKGIAEFDNCLDS-EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
           M ++     D  +   + R   + + P LYRVLL ND+YT  EFV  VL   F  D E+A
Sbjct: 1   MAERTRPGGDTEVVVPKTRAERETKRPPLYRVLLHNDHYTTQEFVDFVLMTVFNHDPESA 60

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             IML VH  G+G  G+Y YEIAE K  + M+ +R+ +YPL   +E +
Sbjct: 61  HRIMLHVHMHGVGVAGIYPYEIAETKARKTMDLAREAEYPLLVTIEPE 108


>gi|85858021|ref|YP_460223.1| ATP-dependent Clp protease adaptor protein [Syntrophus
           aciditrophicus SB]
 gi|123515753|sp|Q2LQK8|CLPS_SYNAS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|85721112|gb|ABC76055.1| ATP-dependent Clp protease adaptor protein [Syntrophus
           aciditrophicus SB]
          Length = 107

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 65/106 (61%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M  +     +   +  + +  KV  P++YRV+L ND+YT M+FV+ +L   F+K    A 
Sbjct: 1   MQNETDVIKNFDQELNIEWEDKVMEPRMYRVILHNDHYTTMDFVVQILMTIFHKPAAQAT 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IML VH +G G CGVY Y+IA  K+ QV   +RQ++YPL+C M++
Sbjct: 61  RIMLDVHRKGQGVCGVYTYDIASTKIAQVHFMARQNEYPLRCSMDE 106


>gi|92114559|ref|YP_574487.1| ATP-dependent Clp protease adaptor protein ClpS [Chromohalobacter
           salexigens DSM 3043]
 gi|91797649|gb|ABE59788.1| ATP-dependent Clp protease adaptor protein ClpS [Chromohalobacter
           salexigens DSM 3043]
          Length = 131

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 38/87 (43%), Positives = 59/87 (67%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
             ++  P +Y+V+L ND++TPMEFV+ VLQ+FF  + E A  +ML VH  G   CG++  
Sbjct: 43  DPELAQPPMYKVVLHNDDFTPMEFVVEVLQSFFAMEREKAVQVMLVVHTHGKATCGIFTR 102

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +IAE K +QV  Y+R+ Q+PL C +++
Sbjct: 103 DIAETKCHQVNEYARECQHPLLCDIDK 129


>gi|49475405|ref|YP_033446.1| hypothetical protein BH06170 [Bartonella henselae str. Houston-1]
 gi|49238211|emb|CAF27421.1| hypothetical protein BH06170 [Bartonella henselae str. Houston-1]
          Length = 123

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 55/116 (47%), Positives = 78/116 (67%)

Query: 21  LMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ 80
           + + I         K   E+ +      +  SK++ PKLYRVLL++D+YTPM+FVI VL+
Sbjct: 6   IKNSITHFMHNEKGKNGDEYRHDAFIMPKMRSKLQKPKLYRVLLLDDDYTPMDFVIFVLK 65

Query: 81  NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           +FF K+ E A  IML VH  G+GECG+Y YE+AEMK+ QV   +RQ+++PLQC+ME
Sbjct: 66  SFFKKNFEEAMHIMLSVHQNGVGECGIYNYEVAEMKIIQVRECARQNEHPLQCVME 121


>gi|313498102|gb|ADR59468.1| ClpS [Pseudomonas putida BIRD-1]
          Length = 81

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 55/80 (68%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
           +Y+V+L ND+YTPM+FV+ VL+ FF  + E A  IML VH +G   CG++  +IAE K  
Sbjct: 1   MYKVVLFNDDYTPMDFVVEVLETFFSLNRELATKIMLTVHTEGRAVCGLFTRDIAETKAM 60

Query: 119 QVMNYSRQHQYPLQCIMEQK 138
           QV  Y+R+ Q+PL C +E+ 
Sbjct: 61  QVNQYARESQHPLLCEIEKD 80


>gi|268680246|ref|YP_003304677.1| ATP-dependent Clp protease adaptor protein ClpS [Sulfurospirillum
           deleyianum DSM 6946]
 gi|268618277|gb|ACZ12642.1| ATP-dependent Clp protease adaptor protein ClpS [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 102

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 69/102 (67%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           + + +   ++E     +++ P+LY+VLL+ND+Y+ MEFVI VL   F+   E A  IML 
Sbjct: 1   MHQSNPAFENETVELIEIKEPRLYKVLLLNDDYSSMEFVIKVLMQIFHHSFEKATEIMLS 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           VH +G G CGVYAYEIAE KV+QV   +++ ++PL+ IME +
Sbjct: 61  VHEKGKGLCGVYAYEIAETKVSQVRKMAKEEKFPLRAIMEAE 102


>gi|218779933|ref|YP_002431251.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfatibacillum
           alkenivorans AK-01]
 gi|259491244|sp|B8FGA3|CLPS_DESAA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|218761317|gb|ACL03783.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfatibacillum
           alkenivorans AK-01]
          Length = 104

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 60/98 (61%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           ++  D     + K   P++++VLL ND+YT MEFV+ VLQ  F K    A  IML VH++
Sbjct: 7   EDLGDVLTEPTQKTERPRMFKVLLHNDDYTTMEFVVGVLQRVFNKSVPEATRIMLNVHNR 66

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G+G  GVY  E+AE K+  V + ++   +PL+C ME +
Sbjct: 67  GVGVAGVYTAEVAETKIETVHSMAQADGFPLKCSMEPE 104


>gi|120611897|ref|YP_971575.1| ATP-dependent Clp protease adaptor protein ClpS [Acidovorax
           citrulli AAC00-1]
 gi|158513033|sp|A1TS63|CLPS_ACIAC RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|120590361|gb|ABM33801.1| ATP-dependent Clp protease adaptor protein ClpS [Acidovorax
           citrulli AAC00-1]
          Length = 122

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 45/98 (45%), Positives = 63/98 (64%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            D       R + + + P++Y+V+++ND+YTPMEFVI VLQ FF KD E A  IMLK+H 
Sbjct: 23  DDGGSVVLERRTQRTQPPQMYQVVMLNDDYTPMEFVIVVLQEFFGKDREAATQIMLKIHL 82

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G G CGVY+ ++A  KV QV   + +  +PLQC+ E 
Sbjct: 83  DGKGVCGVYSRDVAATKVEQVREAAHKAGHPLQCLSEP 120


>gi|46580012|ref|YP_010820.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120602577|ref|YP_966977.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           vulgaris DP4]
 gi|67460332|sp|Q72BN4|CLPS_DESVH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|166214734|sp|A1VDN4|CLPS_DESVV RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|46449428|gb|AAS96079.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120562806|gb|ABM28550.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           vulgaris DP4]
 gi|311233989|gb|ADP86843.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           vulgaris RCH1]
          Length = 104

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 61/96 (63%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              DS++     VR+P++YRVLL ND+YT MEFV+ +L   F K  E A  IML VH  G
Sbjct: 8   PGYDSDILVEDDVRLPRMYRVLLHNDDYTTMEFVVSILVEVFRKTAEQATAIMLAVHRDG 67

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +GECGVY +E+AE K   V   +R+  YPL+C  E+
Sbjct: 68  VGECGVYTFEVAETKAAIVHARARREGYPLRCSTEE 103


>gi|320539589|ref|ZP_08039254.1| putative regulatory protein for ClpA substrate specificity
           [Serratia symbiotica str. Tucson]
 gi|320030348|gb|EFW12362.1| putative regulatory protein for ClpA substrate specificity
           [Serratia symbiotica str. Tucson]
          Length = 106

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 65/104 (62%)

Query: 34  KKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCI 93
                  +    +E +    ++ P +Y+V+L  D+YTPMEFVI VLQ FF+ D E A  +
Sbjct: 2   GNNNDWLNFEHLTEEKQIDALKPPSMYKVILNKDDYTPMEFVIDVLQKFFFYDIERATQL 61

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML+VH+QG   CGV+  E+AE KV  V  Y+R+++YPL C +E+
Sbjct: 62  MLRVHYQGKAICGVFTAEVAETKVIHVNCYARENEYPLLCTLEK 105


>gi|94263020|ref|ZP_01286839.1| ATP-dependent Clp protease adaptor protein ClpS [delta
           proteobacterium MLMS-1]
 gi|93456563|gb|EAT06671.1| ATP-dependent Clp protease adaptor protein ClpS [delta
           proteobacterium MLMS-1]
          Length = 103

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 60/97 (61%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           +           +R P LY+VLL ND+YT M+FV+ VL+  F+ D   A  IM+ VH +G
Sbjct: 7   HDHGVVTEKQQDLRRPPLYKVLLHNDDYTTMDFVVMVLEMVFHHDQAAAHRIMMNVHREG 66

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +G  GVY  + AE KV  V N +R+H+YPL+C +EQ+
Sbjct: 67  VGVAGVYPRDSAETKVAMVHNLARKHEYPLKCSLEQE 103


>gi|67460279|sp|Q6G5D4|CLPS_BARHE RecName: Full=ATP-dependent Clp protease adapter protein ClpS
          Length = 110

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 54/106 (50%), Positives = 75/106 (70%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
               K   E+ +      +  SK++ PKLYRVLL++D+YTPM+FVI VL++FF K+ E A
Sbjct: 3   NEKGKNGDEYRHDAFIMPKMRSKLQKPKLYRVLLLDDDYTPMDFVIFVLKSFFKKNFEEA 62

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
             IML VH  G+GECG+Y YE+AEMK+ QV   +RQ+++PLQC+ME
Sbjct: 63  MHIMLSVHQNGVGECGIYNYEVAEMKIIQVRECARQNEHPLQCVME 108


>gi|78357143|ref|YP_388592.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|123552230|sp|Q30ZJ9|CLPS_DESDG RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|78219548|gb|ABB38897.1| ATP-dependent clp protease adaptor protein ClpS [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 104

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 62/99 (62%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
           +     D++V    +++ P+ +RVLL ND+YT M+FV+ VL + F K  E A  IML VH
Sbjct: 5   KLSTREDADVLLEEELKEPRRFRVLLHNDDYTSMDFVVAVLIDIFRKSREQAMSIMLSVH 64

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +GIG CGVY  E+AE KV  V   +R   +PL+C ME+
Sbjct: 65  EKGIGVCGVYTAEVAETKVAMVHARARAEGFPLRCSMEE 103


>gi|237749126|ref|ZP_04579606.1| ATP-dependent Clp protease adaptor protein ClpS [Oxalobacter
           formigenes OXCC13]
 gi|229380488|gb|EEO30579.1| ATP-dependent Clp protease adaptor protein ClpS [Oxalobacter
           formigenes OXCC13]
          Length = 102

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 63/84 (75%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           ++ P +Y+V+L+ND++TPMEFVI VLQ +F+KD E A  IMLKVHH+G G CG++  +IA
Sbjct: 18  LKAPPMYKVVLLNDDFTPMEFVISVLQEYFFKDREAATRIMLKVHHEGKGICGIFPKDIA 77

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQ 137
             KV  V+ ++R   +PLQC ME+
Sbjct: 78  NTKVELVLKHARGEGHPLQCTMEE 101


>gi|240850299|ref|YP_002971692.1| ATP-dependent Clp protease adaptor protein ClpS [Bartonella
           grahamii as4aup]
 gi|240267422|gb|ACS51010.1| ATP-dependent Clp protease adaptor protein ClpS [Bartonella
           grahamii as4aup]
          Length = 110

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 54/106 (50%), Positives = 70/106 (66%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
               K   E  +      +  +K+  PKL RV L+ND+YTPM+FV+ VL+NFF K  E A
Sbjct: 3   NEKGKNWDEVRHGAVIMPKARAKLEKPKLCRVFLLNDDYTPMDFVVFVLKNFFKKSFEEA 62

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
             IML VHH GIGECG Y YE+AEMK+ QV   +RQ+++PLQC+ME
Sbjct: 63  TRIMLNVHHSGIGECGTYTYEVAEMKILQVRECARQNEHPLQCVME 108


>gi|115376673|ref|ZP_01463901.1| ATP-dependent Clp protease adaptor protein ClpS [Stigmatella
           aurantiaca DW4/3-1]
 gi|310823925|ref|YP_003956283.1| ATP-dependent CLP protease, adapter protein CLPs [Stigmatella
           aurantiaca DW4/3-1]
 gi|115366290|gb|EAU65297.1| ATP-dependent Clp protease adaptor protein ClpS [Stigmatella
           aurantiaca DW4/3-1]
 gi|309396997|gb|ADO74456.1| ATP-dependent Clp protease, adapter protein ClpS [Stigmatella
           aurantiaca DW4/3-1]
          Length = 107

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 62/100 (62%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
           E D  + +E R   K++ P LY+VLL NDNYT  EFV+ VL+  F+K    A  IML VH
Sbjct: 6   ENDENVVTETRPEKKLKKPTLYKVLLHNDNYTTREFVVAVLKEIFHKSEGDAVQIMLHVH 65

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + GIG  GVY YE+AE K+  V   +R + YPL+  ME +
Sbjct: 66  YNGIGVAGVYTYEVAETKIKTVEAAARDNGYPLRLSMEPE 105


>gi|226355736|ref|YP_002785476.1| ATP-dependent Clp protease adaptor protein clpS [Deinococcus
           deserti VCD115]
 gi|226317726|gb|ACO45722.1| putative ATP-dependent Clp protease adaptor protein clpS
           [Deinococcus deserti VCD115]
          Length = 105

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/98 (45%), Positives = 65/98 (66%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    ++    S  + P+LYRVLL+ND+YTPMEFV+ VL+ +F K  + A+ IML VHH+
Sbjct: 5   DGESHTQTLERSATQRPRLYRVLLLNDDYTPMEFVVRVLELYFRKTEQEAELIMLAVHHK 64

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G G  G+Y  ++AE KV QV + +RQ  YPL+ + E +
Sbjct: 65  GQGVAGIYTRDVAETKVAQVTDRARQEGYPLRLVSEPE 102


>gi|301167864|emb|CBW27449.1| ATP-dependent Clp protease adaptor protein clpS [Bacteriovorax
           marinus SJ]
          Length = 123

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 61/79 (77%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           Y+VL+ ND+YT MEFVI++LQ  F K+ E A+ IMLKVH++GIG CGVY+YEIAE K  +
Sbjct: 44  YKVLIHNDDYTTMEFVIYILQKVFAKNLEEAQAIMLKVHNEGIGVCGVYSYEIAETKSEK 103

Query: 120 VMNYSRQHQYPLQCIMEQK 138
           V   ++++ +PL+C +E +
Sbjct: 104 VNQEAKENGHPLKCTIEPE 122


>gi|283850415|ref|ZP_06367704.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio sp.
           FW1012B]
 gi|283574441|gb|EFC22412.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio sp.
           FW1012B]
          Length = 100

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 61/97 (62%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           +      V     VR P+ Y+VLL ND+YT MEFV+ VL   F+K+   A  IML VH+ 
Sbjct: 3   EEQPGLGVDVEEDVREPRRYKVLLHNDDYTTMEFVVQVLVGVFHKNENEATQIMLNVHNN 62

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G+G CG +  E+AE+KV+ V   ++++ YPL+C ME+
Sbjct: 63  GVGVCGEFTAEVAELKVSLVHRLAKENGYPLKCSMEE 99


>gi|198282816|ref|YP_002219137.1| ATP-dependent Clp protease adaptor protein ClpS [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|198247337|gb|ACH82930.1| ATP-dependent Clp protease adaptor protein ClpS [Acidithiobacillus
           ferrooxidans ATCC 53993]
          Length = 102

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 69/91 (75%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
           +    + + P++YRVLLVND++TPM++V+H+L+ +F+K H+ A  +M+ VH QG G CG+
Sbjct: 12  LEREPQAQEPRMYRVLLVNDDFTPMDYVVHILEAYFHKPHDEAVAVMMAVHQQGRGLCGI 71

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + Y++AE KV  V   +RQHQ+PL+CIME++
Sbjct: 72  FPYDLAETKVALVTADARQHQHPLRCIMEKE 102


>gi|87122218|ref|ZP_01078101.1| hypothetical protein MED121_05518 [Marinomonas sp. MED121]
 gi|86162538|gb|EAQ63820.1| hypothetical protein MED121_05518 [Marinomonas sp. MED121]
          Length = 114

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/87 (45%), Positives = 66/87 (75%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
            ++++ P +Y+V+L+ND++TPM+FV+ VLQ FFY D E A+ +ML+VH++G G CGVY +
Sbjct: 26  ETELKPPSMYQVVLLNDDFTPMDFVVFVLQKFFYMDGEKAQKVMLEVHNKGKGVCGVYPF 85

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +IAE KV  V  +  Q+++PL C +++
Sbjct: 86  DIAETKVAMVQQFVEQNEHPLMCDLQK 112


>gi|218668114|ref|YP_002425013.1| ATP-dependent Clp protease adaptor protein ClpS [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|218520327|gb|ACK80913.1| ATP-dependent Clp protease adaptor protein ClpS [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 114

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 69/91 (75%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
           +    + + P++YRVLLVND++TPM++V+H+L+ +F+K H+ A  +M+ VH QG G CG+
Sbjct: 24  LEREPQAQEPRMYRVLLVNDDFTPMDYVVHILEAYFHKPHDEAVAVMMAVHQQGRGLCGI 83

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + Y++AE KV  V   +RQHQ+PL+CIME++
Sbjct: 84  FPYDLAETKVALVTADARQHQHPLRCIMEKE 114


>gi|121601730|ref|YP_988887.1| ATP-dependent Clp protease adaptor protein ClpS [Bartonella
           bacilliformis KC583]
 gi|120613907|gb|ABM44508.1| ATP-dependent Clp protease adaptor protein ClpS [Bartonella
           bacilliformis KC583]
          Length = 92

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 51/88 (57%), Positives = 71/88 (80%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
           +   K++ PKLYRVLL++D+YTPM+FV+ +L+NFF K+ E A  IML +HH GIGECG Y
Sbjct: 3   QVRQKLQKPKLYRVLLLDDDYTPMDFVVFILKNFFKKNFEEATRIMLNIHHNGIGECGTY 62

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIME 136
            YE+AEMK+ QVM  +RQ+++PLQC++E
Sbjct: 63  TYEVAEMKIVQVMECARQNEHPLQCVIE 90


>gi|77360665|ref|YP_340240.1| modulator of ClpA substrate specificity [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76875576|emb|CAI86797.1| modulator of ClpA substrate specificity [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 102

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/93 (44%), Positives = 61/93 (65%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
              +   K++ P+ Y+V+L ND+YTPM+FVI VL  FF  D + A  +ML++H QG G C
Sbjct: 10  VRDKEKQKLQPPRKYKVVLNNDDYTPMDFVIEVLMTFFNMDSDRATDVMLQIHQQGKGIC 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           GV++ ++A  K  QV  YSR +++PL C  EQ+
Sbjct: 70  GVFSSDVAHTKAEQVNRYSRDNEHPLLCSCEQE 102


>gi|298368623|ref|ZP_06979941.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|298282626|gb|EFI24113.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 123

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 1/105 (0%)

Query: 34  KKGIAEFDNCLDSEV-RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKC 92
           K       +  D+ +     K   PK Y V L+ND+YT M+FV+ VL   F    E A  
Sbjct: 18  KMNRPNTSHESDTLLNENDRKTAPPKRYGVFLLNDDYTTMDFVVEVLSEVFMLGEEQAVA 77

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +ML VHH+G G CG Y  +IA+ K  QVM  ++   +PLQC +E+
Sbjct: 78  VMLLVHHEGKGLCGTYTRDIAQTKQLQVMQRAKAAGHPLQCTVEE 122


>gi|114707424|ref|ZP_01440320.1| ATP-dependent Clp protease adaptor protein ClpS [Fulvimarina pelagi
           HTCC2506]
 gi|114536983|gb|EAU40111.1| ATP-dependent Clp protease adaptor protein ClpS [Fulvimarina pelagi
           HTCC2506]
          Length = 101

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/98 (36%), Positives = 57/98 (58%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D  ++ + R   KV  PKLY+VLL+ND+YTP EFV+ VL+  F      A+ +M+  H +
Sbjct: 3   DTTVERKTRVKPKVERPKLYKVLLLNDDYTPREFVVMVLRAVFRLSDSQAETVMMTAHQK 62

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G     VY  ++AE K ++  + +++H YPL    E +
Sbjct: 63  GSCVVSVYPRDVAETKASEATDLAKEHGYPLLFSTEPE 100


>gi|219855399|ref|YP_002472521.1| hypothetical protein CKR_2056 [Clostridium kluyveri NBRC 12016]
 gi|219569123|dbj|BAH07107.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 104

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/93 (37%), Positives = 56/93 (60%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            +     +++ P +Y+V++ ND+YT MEFV++VL   F K    A  IM  VH +GIG  
Sbjct: 12  LKQNSKVEIKRPPMYKVIIYNDDYTTMEFVVNVLVKIFKKSDVEAVQIMYDVHRKGIGIA 71

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G+Y Y+IA  K  Q ++ +R   +PL+  ME++
Sbjct: 72  GIYVYDIAVTKTAQAISMARNSGFPLKFSMEEE 104


>gi|237752679|ref|ZP_04583159.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           winghamensis ATCC BAA-430]
 gi|229376168|gb|EEO26259.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           winghamensis ATCC BAA-430]
          Length = 101

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D   D       K++ P  YRV+L+ND+YT  EFVI VLQ  F+KD E +  +ML++HH 
Sbjct: 4   DAQFDQITETLEKIQEPIRYRVILLNDDYTTQEFVIEVLQAIFHKDFEESLNLMLQIHHN 63

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G G CG+Y Y+IAE+KV QV   +++ QYPL+ I+E+
Sbjct: 64  GKGVCGIYPYDIAEIKVAQVRKMAKEKQYPLRAILEK 100


>gi|153954954|ref|YP_001395719.1| ClpS [Clostridium kluyveri DSM 555]
 gi|146347812|gb|EDK34348.1| ClpS [Clostridium kluyveri DSM 555]
          Length = 99

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/93 (37%), Positives = 56/93 (60%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            +     +++ P +Y+V++ ND+YT MEFV++VL   F K    A  IM  VH +GIG  
Sbjct: 7   LKQNSKVEIKRPPMYKVIIYNDDYTTMEFVVNVLVKIFKKSDVEAVQIMYDVHRKGIGIA 66

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G+Y Y+IA  K  Q ++ +R   +PL+  ME++
Sbjct: 67  GIYVYDIAVTKTAQAISMARNSGFPLKFSMEEE 99


>gi|307721665|ref|YP_003892805.1| ATP-dependent Clp protease adaptor protein ClpS [Sulfurimonas
           autotrophica DSM 16294]
 gi|306979758|gb|ADN09793.1| ATP-dependent Clp protease adaptor protein ClpS [Sulfurimonas
           autotrophica DSM 16294]
          Length = 99

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 62/97 (63%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
                E+   + ++ PK Y+V L+ND+YT M+FV+ +L + F+K +E A+ IML+VH   
Sbjct: 3   TNTHLEIDEDTALKYPKKYKVFLLNDDYTSMDFVVDILMSIFHKSYEQAQDIMLEVHKND 62

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            G CGVY YEIAE K+ QV   ++   +PL+  ME++
Sbjct: 63  RGLCGVYTYEIAETKIMQVRRKAKDSGFPLKATMEEE 99


>gi|224436508|ref|ZP_03657522.1| hypothetical protein HcinC1_01115 [Helicobacter cinaedi CCUG 18818]
          Length = 105

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 62/98 (63%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
           FD   +S     + +  PKLYRVLL+ND++T M FV H+L   F K  + A+ I LKVH+
Sbjct: 6   FDTSFESWTHTGTMLEEPKLYRVLLLNDDWTAMNFVTHILMEVFDKTSQEARAITLKVHN 65

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G G CG+Y Y+IAE+K   V   +++  YPL+ I E+
Sbjct: 66  EGKGVCGIYPYDIAELKTQLVSQKAKEQGYPLRVITEE 103


>gi|149909598|ref|ZP_01898251.1| ATP-dependent Clp protease adaptor protein ClpS [Moritella sp.
           PE36]
 gi|149807302|gb|EDM67255.1| ATP-dependent Clp protease adaptor protein ClpS [Moritella sp.
           PE36]
          Length = 104

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/95 (47%), Positives = 62/95 (65%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
              + +    +++ P  Y+V L ND+YTPM+FV+ VLQ FF  D + A  IML VHH+G 
Sbjct: 9   DFKTSIESELELKPPSFYKVFLNNDDYTPMDFVVDVLQRFFSMDIDKANQIMLTVHHRGR 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGV+  EIAE KV+QVM Y++ ++  L C MEQ
Sbjct: 69  GVCGVFTAEIAETKVSQVMQYAKDNEQSLLCTMEQ 103


>gi|153003706|ref|YP_001378031.1| ATP-dependent Clp protease adaptor protein ClpS [Anaeromyxobacter
           sp. Fw109-5]
 gi|152027279|gb|ABS25047.1| ATP-dependent Clp protease adaptor protein ClpS [Anaeromyxobacter
           sp. Fw109-5]
          Length = 108

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 60/108 (55%), Gaps = 1/108 (0%)

Query: 32  MNKKGIAEFDNCLDS-EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
           M ++     D  +     +   + + P L+RVLL ND+YT  EFV  VL   F+ D E+A
Sbjct: 1   MAERSRPGGDTDVVVPRTKAEKETKRPSLFRVLLHNDDYTTQEFVDWVLVTVFHHDPESA 60

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             IML VH  G+G  G+Y +EIAE K  + M  +R+ +YPL   +E +
Sbjct: 61  HRIMLHVHMHGVGLAGIYPFEIAETKAEKTMALAREAEYPLLVTVEPE 108


>gi|257460421|ref|ZP_05625522.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           gracilis RM3268]
 gi|257441752|gb|EEV16894.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           gracilis RM3268]
          Length = 101

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
             +    R  +K  VP+ Y+V+L+ND+ T M+FV+++L   F K+   A  +M+KVH QG
Sbjct: 5   TGVQIRTRAKTKSFVPRPYKVILLNDDVTTMDFVVYILMEIFAKNFNDAVDLMMKVHKQG 64

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              CG Y  EIAE K   V+  ++   +PL+C +E+ 
Sbjct: 65  RAVCGAYPKEIAECKQQAVLQAAKAAGFPLRCEIEED 101


>gi|157738129|ref|YP_001490813.1| ATP-dependent Clp protease adaptor protein ClpS [Arcobacter
           butzleri RM4018]
 gi|315636272|ref|ZP_07891522.1| ATP-dependent Clp protease adaptor protein ClpS [Arcobacter
           butzleri JV22]
 gi|157699983|gb|ABV68143.1| ATP-dependent Clp protease adaptor protein ClpS [Arcobacter
           butzleri RM4018]
 gi|315479361|gb|EFU70044.1| ATP-dependent Clp protease adaptor protein ClpS [Arcobacter
           butzleri JV22]
          Length = 99

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 61/98 (62%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
            N ++ E+     ++ PK Y V L+ND+Y+ M+FVI VL   F K  + A  IML +H+ 
Sbjct: 2   SNEIEVELNDELDLQEPKKYNVFLLNDDYSTMDFVIDVLVKIFRKSTQDATEIMLNIHNN 61

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G G CG+Y +EIA  KV QV   +R+  +PL+ +ME++
Sbjct: 62  GKGLCGIYTHEIALTKVMQVKTMAREKGFPLKAVMEEE 99


>gi|118475182|ref|YP_891885.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           fetus subsp. fetus 82-40]
 gi|118414408|gb|ABK82828.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           fetus subsp. fetus 82-40]
          Length = 99

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 58/97 (59%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
               S  +   K   P L++V+L+ND  T M+FV+ +L + F K    A  +MLK+H  G
Sbjct: 3   TKKSSITKTKIKDFKPNLFKVMLLNDEVTTMDFVVMILIDIFNKSKNEAIELMLKIHQSG 62

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              CG+Y  EIA+ K  +V+N ++ + +PL+C++E++
Sbjct: 63  RAICGIYTKEIAQTKQMEVLNLAKANGFPLKCVIEEE 99


>gi|320537709|ref|ZP_08037635.1| ATP-dependent Clp protease adaptor protein ClpS [Treponema
           phagedenis F0421]
 gi|320145446|gb|EFW37136.1| ATP-dependent Clp protease adaptor protein ClpS [Treponema
           phagedenis F0421]
          Length = 120

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 65/100 (65%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
             +  ++S V    K++ P  YRVLL+ND+ T M+FVI +L   F+K+++ A+ IML +H
Sbjct: 21  NDEIKIESTVLIKEKIKEPGFYRVLLLNDDITTMDFVISILIEVFHKNYKEAEIIMLTIH 80

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            QG G  G Y Y+IA  +  +V   ++++ +PL+CIME++
Sbjct: 81  TQGSGLVGTYTYDIAATRCKKVEMLAQENGFPLKCIMEKE 120


>gi|255527633|ref|ZP_05394494.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           carboxidivorans P7]
 gi|296185311|ref|ZP_06853721.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           carboxidivorans P7]
 gi|255508675|gb|EET85054.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           carboxidivorans P7]
 gi|296050145|gb|EFG89569.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           carboxidivorans P7]
          Length = 99

 Score =  124 bits (311), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 58/92 (63%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           +     K+R PK+Y+V++ ND+YT MEFV+ +L   F K    A  IM  VH  GIG  G
Sbjct: 8   KQDTKIKIRKPKMYKVIIYNDDYTTMEFVVKILIEIFKKSVVEATKIMYDVHRSGIGIAG 67

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +Y+Y+IA  K+ Q M+ SR+  +PL+  +E++
Sbjct: 68  IYSYDIAATKITQAMSASRESGFPLKFSIEEE 99


>gi|258546117|ref|ZP_05706351.1| ATP-dependent Clp protease adaptor protein ClpS [Cardiobacterium
           hominis ATCC 15826]
 gi|258518542|gb|EEV87401.1| ATP-dependent Clp protease adaptor protein ClpS [Cardiobacterium
           hominis ATCC 15826]
          Length = 104

 Score =  124 bits (311), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 65/99 (65%), Gaps = 1/99 (1%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
           +FD   ++      ++  P+ Y V+L+ND+YT M+FV+ VL  +F K+   A+ IM +VH
Sbjct: 6   DFDPDTETLT-ADPELGEPRQYEVVLLNDDYTTMDFVVDVLMRYFNKNFAEAEDIMYQVH 64

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            QG G CG+Y ++IAE KVNQV+ ++R + YPL C++  
Sbjct: 65  EQGSGVCGIYPFDIAESKVNQVIEHARANNYPLLCVLRP 103


>gi|297183971|gb|ADI20091.1| uncharacterized conserved protein [uncultured alpha proteobacterium
           EB080_L06A09]
          Length = 111

 Score =  124 bits (311), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 60/80 (75%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
           +Y+VLL+ND+YTPMEFV+H+L+ +F      A  +M+ VH +G+   GV++++IAE KV 
Sbjct: 32  MYKVLLLNDDYTPMEFVVHILERYFGTSGSQAYELMMVVHQKGLAVVGVFSHDIAETKVM 91

Query: 119 QVMNYSRQHQYPLQCIMEQK 138
           QV   +R+HQ+PLQC ME++
Sbjct: 92  QVTELARKHQHPLQCTMEKE 111


>gi|254468722|ref|ZP_05082128.1| ATP-dependent Clp protease adaptor protein ClpS [beta
           proteobacterium KB13]
 gi|207087532|gb|EDZ64815.1| ATP-dependent Clp protease adaptor protein ClpS [beta
           proteobacterium KB13]
          Length = 102

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 44/101 (43%), Positives = 72/101 (71%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +A+ D+ +  E +   K  +PK+++VL++ND++TPMEFV+ V+   F K  + A  IMLK
Sbjct: 1   MAQEDHKIIVEPKKKVKPNLPKMFKVLVLNDDFTPMEFVVDVIMKVFTKTEDEATRIMLK 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +H +G+  CG+Y YEIAE K+NQV+  +++ Q+PLQ I+E+
Sbjct: 61  IHTEGMAICGIYPYEIAETKMNQVLKLAKEAQHPLQSIIEK 101


>gi|116747493|ref|YP_844180.1| ATP-dependent Clp protease adaptor protein ClpS [Syntrophobacter
           fumaroxidans MPOB]
 gi|116696557|gb|ABK15745.1| ATP-dependent Clp protease adaptor protein ClpS [Syntrophobacter
           fumaroxidans MPOB]
          Length = 80

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 41/79 (51%), Positives = 55/79 (69%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
           +YRVLL ND+YT MEFV+ +LQ+ F+K    A  IML VH  G G CGV+  E+AE KV 
Sbjct: 1   MYRVLLHNDDYTTMEFVVEILQSVFHKSPSEATRIMLLVHKSGTGVCGVFTAEVAETKVE 60

Query: 119 QVMNYSRQHQYPLQCIMEQ 137
            V + +R++ +PLQC ME+
Sbjct: 61  LVHHLARKNGFPLQCSMEE 79


>gi|212703188|ref|ZP_03311316.1| hypothetical protein DESPIG_01230 [Desulfovibrio piger ATCC 29098]
 gi|212673454|gb|EEB33937.1| hypothetical protein DESPIG_01230 [Desulfovibrio piger ATCC 29098]
          Length = 106

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 61/102 (59%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                +   D+      K++ P  Y VLL ND+YT M+FV+ VL + F+K  E A  IML
Sbjct: 3   DETWNEPGTDTATIVKKKIKEPDRYVVLLHNDDYTSMDFVVGVLCDIFHKTPEEATAIML 62

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            VH QGIG+CGVY +EIAE KV  V   +R   +PL+C ME+
Sbjct: 63  AVHQQGIGQCGVYTHEIAETKVALVRRRARAAGFPLRCTMEK 104


>gi|302339654|ref|YP_003804860.1| ATP-dependent Clp protease adaptor protein ClpS [Spirochaeta
           smaragdinae DSM 11293]
 gi|301636839|gb|ADK82266.1| ATP-dependent Clp protease adaptor protein ClpS [Spirochaeta
           smaragdinae DSM 11293]
          Length = 103

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 60/102 (58%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++F      E R   + R P +YRV+L+ND+YT M+FV+ V++  F+   E A  IM  
Sbjct: 1   MSDFRFGTKLEDRSQEQYREPPMYRVILLNDDYTTMDFVVKVIRQVFHHSSEEAVKIMFD 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           VH +G G  G Y+ +IA  K  QV+  ++  ++PL+C +E  
Sbjct: 61  VHKKGKGLVGCYSQDIAVTKQRQVLVMAKSEEFPLRCEIEPD 102


>gi|39931007|sp|Q7VFW0|CLPS_HELHP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
          Length = 99

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 40/95 (42%), Positives = 59/95 (62%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               E    + +  PK+YRVLL+ND++T M+FV  +L   F K  + A  I LK+H+ G 
Sbjct: 3   HTAFETSLDTLLEEPKMYRVLLLNDDWTAMDFVARILMEVFDKTSDEATAITLKIHNDGK 62

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CG+Y Y+IAE+K+  V   ++QH YPL+ I E+
Sbjct: 63  GVCGIYTYDIAELKMQIVSQMAKQHGYPLRVITEE 97


>gi|254458761|ref|ZP_05072185.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacterales
           bacterium GD 1]
 gi|207084527|gb|EDZ61815.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacterales
           bacterium GD 1]
          Length = 99

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 63/95 (66%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
            D E+    K++ PK Y+V L+ND+YT M+FVI +L   F+K +  A+ IML +H +  G
Sbjct: 5   TDLELYNEVKLKHPKKYKVFLLNDDYTSMDFVIDILITIFHKSYSQAESIMLDIHKKERG 64

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            CGVY +EIAE KV QV   ++ + +PL+ +ME++
Sbjct: 65  LCGVYTHEIAETKVMQVRRKAKDNGFPLKAMMEEE 99


>gi|313683054|ref|YP_004060792.1| ATP-dependent clp protease adaptor protein clps [Sulfuricurvum
           kujiense DSM 16994]
 gi|313155914|gb|ADR34592.1| ATP-dependent Clp protease adaptor protein ClpS [Sulfuricurvum
           kujiense DSM 16994]
          Length = 99

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 60/96 (62%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              +   +  + +  PK Y V L+ND+YT M+FV+ +L   F K+   A  IM++VH  G
Sbjct: 3   TQHEHSTQLENILEHPKQYNVFLLNDDYTSMDFVVDILMKLFRKNFHDAHRIMIEVHQNG 62

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CGVY YE+AE KV+QV   +R++ +PL+ IME+
Sbjct: 63  RGLCGVYPYEVAETKVHQVSILARENGFPLKAIMEE 98


>gi|238020305|ref|ZP_04600731.1| hypothetical protein GCWU000324_00183 [Kingella oralis ATCC 51147]
 gi|237867285|gb|EEP68291.1| hypothetical protein GCWU000324_00183 [Kingella oralis ATCC 51147]
          Length = 101

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 56/87 (64%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
            +++  PK Y V L+ND+YTPM+FV+ VLQ+ F      A  IML+VHH G G CGVY  
Sbjct: 12  KTQLAPPKKYGVFLLNDHYTPMDFVVDVLQDVFRLPESKAVSIMLEVHHHGKGLCGVYTR 71

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +IAE K  QVM  + +  +PL C +E+
Sbjct: 72  DIAETKQQQVMQLADEAGHPLMCTIEE 98


>gi|316984242|gb|EFV63218.1| ATP-dependent Clp protease adaptor ClpS family protein [Neisseria
           meningitidis H44/76]
          Length = 183

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/82 (47%), Positives = 52/82 (63%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
            PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y  +IA+ 
Sbjct: 101 PPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLLVHHEGKGLCGTYTRDIAQT 160

Query: 116 KVNQVMNYSRQHQYPLQCIMEQ 137
           K  QVM  ++   +PLQCI+E+
Sbjct: 161 KQQQVMQRAKAEGHPLQCIVEE 182


>gi|114771314|ref|ZP_01448734.1| ATP-dependent Clp protease, adaptor protein ClpS [alpha
           proteobacterium HTCC2255]
 gi|114548239|gb|EAU51126.1| ATP-dependent Clp protease, adaptor protein ClpS [alpha
           proteobacterium HTCC2255]
          Length = 120

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 60/80 (75%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
           +Y+V+L+ND+YTPMEFV+H+L+ +F      A  +M+ VH +G+   GV++++IAE KV 
Sbjct: 41  MYKVILLNDDYTPMEFVVHILERYFGTTGSQAYELMMLVHQKGLAVVGVFSHDIAETKVM 100

Query: 119 QVMNYSRQHQYPLQCIMEQK 138
           QV   +++HQ+PLQC ME++
Sbjct: 101 QVTELAQKHQHPLQCTMEKE 120


>gi|148653394|ref|YP_001280487.1| ATP-dependent Clp protease adaptor protein ClpS [Psychrobacter sp.
           PRwf-1]
 gi|148572478|gb|ABQ94537.1| ATP-dependent Clp protease adaptor protein ClpS [Psychrobacter sp.
           PRwf-1]
          Length = 140

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/86 (41%), Positives = 55/86 (63%)

Query: 52  SKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYE 111
            ++  P +Y V++ ND+YTPMEFV++VLQ+ F  + + A  IML +H+QG G  G+Y  +
Sbjct: 51  PEITEPPMYAVVMYNDDYTPMEFVVYVLQSEFRHNMDKAVEIMLNIHNQGRGIAGIYPKD 110

Query: 112 IAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           IAE K  +V   +R+  YPL   +E 
Sbjct: 111 IAETKAKKVNQTARKEGYPLLTQIEP 136


>gi|313201916|ref|YP_004040574.1| ATP-dependent clp protease adaptor protein clps [Methylovorus sp.
           MP688]
 gi|312441232|gb|ADQ85338.1| ATP-dependent Clp protease adaptor protein ClpS [Methylovorus sp.
           MP688]
          Length = 77

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/75 (61%), Positives = 60/75 (80%)

Query: 63  LLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           +L+ND+YTPMEFV+ V+Q FF K  E A  IMLKVH +G G CGVY ++IAE KVNQV+ 
Sbjct: 2   ILLNDDYTPMEFVVEVIQRFFNKSREQATQIMLKVHTEGAGICGVYPHDIAETKVNQVLG 61

Query: 123 YSRQHQYPLQCIMEQ 137
           Y+R++Q+PLQC ME+
Sbjct: 62  YAREYQHPLQCAMEE 76


>gi|317051275|ref|YP_004112391.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfurispirillum
           indicum S5]
 gi|316946359|gb|ADU65835.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfurispirillum
           indicum S5]
          Length = 100

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 54/92 (58%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E      V+ P+ Y VLL+ND+++  +FV+ VL   F K  + A  I   VHH G G C
Sbjct: 8   IEEELDLAVKEPRPYMVLLLNDDFSTWDFVVEVLVRVFRKTRDDADKITYHVHHNGQGVC 67

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G+Y +EIA+ KV QV   ++   YPL+C+M +
Sbjct: 68  GIYPFEIAQTKVQQVHELAKSRGYPLRCVMRE 99


>gi|34556771|ref|NP_906586.1| hypothetical protein WS0336 [Wolinella succinogenes DSM 1740]
 gi|39930938|sp|Q7MSL3|CLPS_WOLSU RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|34482485|emb|CAE09486.1| conserved hypothetical protein [Wolinella succinogenes]
          Length = 102

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 65/95 (68%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             ++E++    V  P+ ++V+L+ND+Y+ M+FV+ VL   F K+ + A  +MLKVH++G 
Sbjct: 7   DFETEIKEEIIVAEPRRFKVILLNDDYSTMDFVVEVLMVIFNKNFDEALGVMLKVHNEGR 66

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CG+Y Y++AE KV+QV   + +  +PL+ I+E+
Sbjct: 67  GVCGIYPYDVAETKVSQVKKKAEESGFPLRAILEE 101


>gi|253828028|ref|ZP_04870913.1| ATP-dependent Clp protease adaptor protein ClpS [Helicobacter
           canadensis MIT 98-5491]
 gi|253511434|gb|EES90093.1| ATP-dependent Clp protease adaptor protein ClpS [Helicobacter
           canadensis MIT 98-5491]
          Length = 101

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 64/96 (66%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           N +++      K++ P  Y+V+L+ND+YT  +FVI +LQ  F+K  E +  +ML++HH G
Sbjct: 5   NQIENATETLEKLQEPIRYKVILLNDDYTTQDFVIEILQKVFHKGFEESLNLMLQIHHNG 64

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G CG+Y Y+IAE K  QV   +++ Q+PL+ I+E+
Sbjct: 65  RGMCGIYPYDIAETKAMQVRKMAKEKQFPLRAILEK 100


>gi|293606229|ref|ZP_06688592.1| ATP-dependent Clp protease adaptor protein ClpS [Achromobacter
           piechaudii ATCC 43553]
 gi|292815376|gb|EFF74494.1| ATP-dependent Clp protease adaptor protein ClpS [Achromobacter
           piechaudii ATCC 43553]
          Length = 104

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 50/98 (51%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 41  DNCLDSEVRFSSKVRVPK-LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
           D   D  V  +     P  +Y+VLL+ND+YTPMEFV+ VLQ FF K+HE A  IML+VHH
Sbjct: 6   DTQHDLAVEKAPARAAPPPMYQVLLLNDDYTPMEFVVKVLQKFFNKNHEEATRIMLQVHH 65

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G G CGVY  ++A  ++ QV  Y+R  Q+PLQC+ME 
Sbjct: 66  EGRGVCGVYPRDLAATRIAQVGQYARARQHPLQCVMEP 103


>gi|71066054|ref|YP_264781.1| ATP-dependent Clp protease adapter protein [Psychrobacter arcticus
           273-4]
 gi|71039039|gb|AAZ19347.1| probable ATP-dependent Clp protease adapter protein [Psychrobacter
           arcticus 273-4]
          Length = 138

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 61/123 (49%), Gaps = 3/123 (2%)

Query: 18  ILALMSFIFMADSRMNKKGIAEFDNCLDSEVRF---SSKVRVPKLYRVLLVNDNYTPMEF 74
              ++S        M    + E D     +        +V  P +Y V++ NDNYTPMEF
Sbjct: 12  AAPIISDWHFPHMPMRLAQVGEPDGETTPQADVLVAEPEVAKPPMYAVVMYNDNYTPMEF 71

Query: 75  VIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCI 134
           V+++LQ+ F    ++A  IML +H+   G  G+Y  +IAE K  +V + + +  YPL   
Sbjct: 72  VVYILQSEFRHSMDSAVEIMLTIHNSSKGIAGIYPKDIAETKAKKVNSLAHREGYPLLTQ 131

Query: 135 MEQ 137
           +E 
Sbjct: 132 IEP 134


>gi|311107314|ref|YP_003980167.1| ATP-dependent Clp protease adaptor protein ClpS [Achromobacter
           xylosoxidans A8]
 gi|310762003|gb|ADP17452.1| ATP-dependent Clp protease adaptor protein ClpS [Achromobacter
           xylosoxidans A8]
 gi|317407691|gb|EFV87624.1| ATP-dependent Clp protease adapter protein ClpS [Achromobacter
           xylosoxidans C54]
          Length = 104

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 50/98 (51%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 41  DNCLDSEVRFSSKVRVPK-LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
           D   D  V  +     P  +Y+VLL+ND+YTPMEFV+ VLQ FF K+HE A  IML+VHH
Sbjct: 6   DTQHDLAVEKAPARAAPPPMYQVLLLNDDYTPMEFVVKVLQKFFNKNHEEATRIMLQVHH 65

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +G G CGVY  ++A  ++ QV  Y+R  Q+PLQC+ME 
Sbjct: 66  EGRGVCGVYPRDLAATRIAQVAQYARARQHPLQCVMEP 103


>gi|315179860|gb|ADT86774.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio furnissii
           NCTC 11218]
          Length = 80

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/79 (51%), Positives = 57/79 (72%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
           +Y V+L ND+YTPM+FVI +L+ FF  D E A  +MLKVH++G   CG +  E+AE KV 
Sbjct: 1   MYNVVLNNDDYTPMDFVIEILERFFSMDIERATQVMLKVHYEGKAICGTFTAEVAETKVA 60

Query: 119 QVMNYSRQHQYPLQCIMEQ 137
           QV  YSR++++PL C ME+
Sbjct: 61  QVTMYSRENEHPLLCTMER 79


>gi|307718944|ref|YP_003874476.1| ATP-dependent Clp protease adaptor protein clpS [Spirochaeta
           thermophila DSM 6192]
 gi|306532669|gb|ADN02203.1| ATP-dependent Clp protease adaptor protein clpS [Spirochaeta
           thermophila DSM 6192]
          Length = 134

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 53/79 (67%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
           +Y V+L+ND++TPMEFV+ +L + F+KD   A  IML VH  G G+   Y Y+IA  KV 
Sbjct: 55  MYWVVLLNDDFTPMEFVVDILVDIFHKDRVEATKIMLTVHRTGKGKVATYPYDIAVTKVA 114

Query: 119 QVMNYSRQHQYPLQCIMEQ 137
           QV   +R+  +PL+C +E+
Sbjct: 115 QVHRRAREAGHPLRCTVEK 133


>gi|255065179|ref|ZP_05317034.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria sicca
           ATCC 29256]
 gi|255050600|gb|EET46064.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria sicca
           ATCC 29256]
          Length = 103

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 58/102 (56%), Gaps = 1/102 (0%)

Query: 37  IAEFDNCLDSEVRF-SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
           +   +   +S+      K   PK Y V L+ND+YT MEFV+ +L   F    E A  +ML
Sbjct: 1   MNNPNTHHESDTLLSDQKTAPPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVML 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            VHH+G G CG Y  +IA+ K  QVM  ++   +PLQCI+E+
Sbjct: 61  LVHHEGKGLCGTYTRDIAQTKQQQVMQRAKAEGHPLQCIVEE 102


>gi|296273990|ref|YP_003656621.1| ATP-dependent Clp protease adaptor protein ClpS [Arcobacter
           nitrofigilis DSM 7299]
 gi|296098164|gb|ADG94114.1| ATP-dependent Clp protease adaptor protein ClpS [Arcobacter
           nitrofigilis DSM 7299]
          Length = 99

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 62/97 (63%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           N  + E+    +V+ PK Y+VLL+NDNY+ M+FVI +L   F K  + A  IML +H+ G
Sbjct: 3   NEFEIELNDDLEVQEPKKYKVLLLNDNYSTMDFVIDILVKIFKKTTDEATVIMLNIHNNG 62

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              CG Y +EIA  KV QV N +RQ  +PL+ IME++
Sbjct: 63  KEVCGTYTHEIASTKVMQVKNLARQKGFPLKAIMEEE 99


>gi|161869772|ref|YP_001598940.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis 053442]
 gi|161595325|gb|ABX72985.1| conserved hypothetical protein [Neisseria meningitidis 053442]
          Length = 153

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/82 (47%), Positives = 52/82 (63%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
            PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y  +IA+ 
Sbjct: 71  PPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLLVHHEGKGLCGTYTRDIAQT 130

Query: 116 KVNQVMNYSRQHQYPLQCIMEQ 137
           K  QVM  ++   +PLQCI+E+
Sbjct: 131 KQQQVMQRAKAEGHPLQCIVEE 152


>gi|296315334|ref|ZP_06865275.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           polysaccharea ATCC 43768]
 gi|296837710|gb|EFH21648.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           polysaccharea ATCC 43768]
          Length = 100

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 53/85 (62%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           K   PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y  +I
Sbjct: 15  KTLPPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLLVHHEGKGLCGTYTRDI 74

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A+ K  QVM  ++   +PLQCI+E+
Sbjct: 75  AQTKQQQVMQRAKAEGHPLQCIVEE 99


>gi|269468372|gb|EEZ80037.1| hypothetical protein Sup05_1280 [uncultured SUP05 cluster
           bacterium]
          Length = 99

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 42/92 (45%), Positives = 64/92 (69%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
                  KV+ P  ++VLL+ND+YT M+FV+ VL  FF K  E A+ IMLK+H +G G C
Sbjct: 5   LAQNTKPKVKKPNRFQVLLLNDDYTTMDFVVEVLTKFFSKSEEAAQAIMLKIHLEGEGIC 64

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           GVY ++IA+ KV+QV+++SR+ + PL C++ +
Sbjct: 65  GVYPHDIAQTKVSQVIDFSRKKEQPLMCVIRE 96


>gi|329120145|ref|ZP_08248815.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327463676|gb|EGF09994.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 101

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 53/89 (59%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
             + K+R P+ Y V L+ND+YT M+FV  VL   F+   + A  +ML VHH+G G CG +
Sbjct: 11  ESAIKLRPPRKYGVFLLNDDYTTMDFVAQVLTEVFFLSEDRAFAVMLLVHHEGKGLCGTF 70

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             ++A+ K  QV   +    +PL+C +E+
Sbjct: 71  TRDVAQTKQAQVHRRAADAGFPLKCTIEE 99


>gi|242279301|ref|YP_002991430.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           salexigens DSM 2638]
 gi|242122195|gb|ACS79891.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           salexigens DSM 2638]
          Length = 102

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 44/101 (43%), Positives = 66/101 (65%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +AE+    +S+V    +++ P+ +RVLL ND+YT MEFV+ VL   F K  E +  IML+
Sbjct: 1   MAEYKENFESDVLLEDELKEPRKFRVLLHNDDYTSMEFVVAVLMQVFRKTEEESTKIMLQ 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VH+ G+G CGVY  E+AE +V  V   ++Q  YPL+C +E+
Sbjct: 61  VHNDGVGVCGVYTAEVAETRVEMVKQLAQQAGYPLKCTIEE 101


>gi|261381146|ref|ZP_05985719.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria subflava
           NJ9703]
 gi|284795952|gb|EFC51299.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria subflava
           NJ9703]
          Length = 103

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 59/102 (57%), Gaps = 1/102 (0%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                D+  D+ +      + PK Y V L+ND+YT MEFV+ +L   F    E A  +ML
Sbjct: 2   NHPNTDHQSDTLL-SDINTQPPKRYGVFLLNDDYTTMEFVVEILTEVFMLTQEQAVAVML 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            VHH+G G CG Y  +IA+ K +QVM  ++   +PL+CI+E+
Sbjct: 61  LVHHEGKGLCGTYTRDIAQTKQHQVMERAKAEGHPLKCIVEE 102


>gi|261364236|ref|ZP_05977119.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria mucosa
           ATCC 25996]
 gi|288567473|gb|EFC89033.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria mucosa
           ATCC 25996]
          Length = 103

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 58/102 (56%), Gaps = 1/102 (0%)

Query: 37  IAEFDNCLDSEVRF-SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
           +   +   +S+      K   PK Y V L+ND+YT MEFV+ +L   F    E A  +ML
Sbjct: 1   MNNPNTHHESDTLLSDQKTAPPKRYGVFLLNDDYTTMEFVVEILTEIFMLGEEQAVAVML 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            VHH+G G CG Y  +IA+ K  QVM  ++   +PLQCI+E+
Sbjct: 61  LVHHEGKGLCGTYTRDIAQTKQQQVMQRAKAEGHPLQCIVEE 102


>gi|82523955|emb|CAI78766.1| ATP-dependent Clp protease adaptor protein ClpS [uncultured epsilon
           proteobacterium]
          Length = 99

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 62/97 (63%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              + E    + ++ PK Y+V ++ND+YT M+FV+ VL   F+K +E ++ IML+VH + 
Sbjct: 3   TNTELEPVEKTLLQYPKKYKVFILNDDYTSMDFVVDVLMTIFHKSYEESEAIMLEVHKKD 62

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            G CGVY +EIAE KV QV   +R   +PL+  ME++
Sbjct: 63  RGLCGVYTHEIAETKVMQVHKKARDSGFPLKSTMEEE 99


>gi|256829859|ref|YP_003158587.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfomicrobium
           baculatum DSM 4028]
 gi|256579035|gb|ACU90171.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfomicrobium
           baculatum DSM 4028]
          Length = 104

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 39/101 (38%), Positives = 59/101 (58%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
                   D ++    +++ P+ ++VLL ND+YT M+FV+ VL N F K    +  IM+ 
Sbjct: 3   EPFEVPGSDPDIMVEDQLQEPRQFKVLLHNDDYTSMDFVVEVLMNVFGKSESESFAIMMS 62

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VH +GIG CG+Y  E+AE KV  V   +R   +PL+C ME+
Sbjct: 63  VHEKGIGLCGIYTAEVAETKVQLVHQMARARSFPLRCSMEE 103


>gi|32267064|ref|NP_861096.1| hypothetical protein HH1565 [Helicobacter hepaticus ATCC 51449]
 gi|32263116|gb|AAP78162.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 87

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 39/84 (46%), Positives = 57/84 (67%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +  PK+YRVLL+ND++T M+FV  +L   F K  + A  I LK+H+ G G CG+Y Y+IA
Sbjct: 2   LEEPKMYRVLLLNDDWTAMDFVARILMEVFDKTSDEATAITLKIHNDGKGVCGIYTYDIA 61

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQ 137
           E+K+  V   ++QH YPL+ I E+
Sbjct: 62  ELKMQIVSQMAKQHGYPLRVITEE 85


>gi|254417766|ref|ZP_05031490.1| ATP-dependent Clp protease adaptor protein ClpS [Brevundimonas sp.
           BAL3]
 gi|196183943|gb|EDX78919.1| ATP-dependent Clp protease adaptor protein ClpS [Brevundimonas sp.
           BAL3]
          Length = 77

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 43/76 (56%), Positives = 58/76 (76%)

Query: 63  LLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           L++ND+Y+PMEFV++VL+ FF K  E A  IML VH  G+G CGV+ YE+AE KV QV+ 
Sbjct: 2   LILNDDYSPMEFVVYVLERFFQKSREEATRIMLHVHQHGVGVCGVFTYEVAETKVAQVIE 61

Query: 123 YSRQHQYPLQCIMEQK 138
            +R+HQ+PLQC ME+ 
Sbjct: 62  TARRHQHPLQCTMEKD 77


>gi|146329659|ref|YP_001209565.1| ATP-dependent Clp protease adaptor protein ClpS [Dichelobacter
           nodosus VCS1703A]
 gi|146233129|gb|ABQ14107.1| ATP-dependent Clp protease adaptor protein ClpS [Dichelobacter
           nodosus VCS1703A]
          Length = 104

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 56/88 (63%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
            S V  P L+ V+L ND+YT M+FVI V+  FFY+  E A+ +MLKVH +G    G++  
Sbjct: 17  KSDVAQPDLFEVVLHNDDYTTMDFVIEVICRFFYQTAEVAEKLMLKVHFEGSAVVGIFPR 76

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +IAE K  QV+ Y+R+  +PL C +  +
Sbjct: 77  DIAETKARQVIAYAREKGHPLMCSIRPQ 104


>gi|330814167|ref|YP_004358406.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327487262|gb|AEA81667.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 101

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 58/90 (64%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           + + S+K   P  Y V+L+ND++T MEFVI VL  FF   +  AK +MLK+H  G   CG
Sbjct: 10  KRKLSTKTTKPPYYNVILLNDDFTTMEFVIQVLIIFFKMTNNKAKNVMLKIHEDGSAICG 69

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
            Y  +IA+   + V NY++Q+ +PL+CIME
Sbjct: 70  TYTKDIAKTLTSLVNNYAKQNLFPLKCIME 99


>gi|206889423|ref|YP_002249321.1| ATP-dependent Clp protease adaptor protein ClpS
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741361|gb|ACI20418.1| ATP-dependent Clp protease adaptor protein ClpS
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 101

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 40/91 (43%), Positives = 56/91 (61%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           + +    +  P+LYRV L+ND+YT M+FV++VL   F K    A  IML VH  G G  G
Sbjct: 8   DEKEEISIDRPELYRVYLLNDDYTTMDFVVYVLMTIFDKSKVEATAIMLHVHKHGKGLAG 67

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +Y  EIAE KV QV + +R   +PL+C +E+
Sbjct: 68  IYPKEIAETKVYQVESLARAKGFPLKCSIER 98


>gi|261400156|ref|ZP_05986281.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           lactamica ATCC 23970]
 gi|269210155|gb|EEZ76610.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           lactamica ATCC 23970]
          Length = 112

 Score =  119 bits (300), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 39/85 (45%), Positives = 54/85 (63%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
             + PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y  +I
Sbjct: 27  DTQPPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLLVHHEGKGLCGTYTRDI 86

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A+ K  QVM+ ++   +PLQCI+E+
Sbjct: 87  AQTKQRQVMDMAKAEGHPLQCIVEE 111


>gi|15895099|ref|NP_348448.1| hypothetical protein CA_C1823 [Clostridium acetobutylicum ATCC 824]
 gi|21542321|sp|Q97I31|CLPS_CLOAB RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|15024798|gb|AAK79788.1|AE007691_6 Uncharacterized conserved protein [Clostridium acetobutylicum ATCC
           824]
 gi|325509237|gb|ADZ20873.1| Conserved hypothetical protein [Clostridium acetobutylicum EA 2018]
          Length = 101

 Score =  119 bits (300), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 40/94 (42%), Positives = 55/94 (58%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              D  ++   K+  PK+Y+V+L ND+YT MEFVI +L N F K    A  I   VH  G
Sbjct: 5   TSFDENIKQKHKIEKPKMYKVILHNDDYTTMEFVIEILINVFNKVPANAVKITFDVHKNG 64

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
           IG  GVY Y+IA  K+N+V   + ++ YPL+  M
Sbjct: 65  IGIAGVYPYDIAATKINEVKKLAYKNGYPLKLTM 98


>gi|93006502|ref|YP_580939.1| ATP-dependent Clp protease adaptor protein ClpS [Psychrobacter
           cryohalolentis K5]
 gi|92394180|gb|ABE75455.1| ATP-dependent Clp protease adaptor protein ClpS [Psychrobacter
           cryohalolentis K5]
          Length = 135

 Score =  119 bits (300), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 3/123 (2%)

Query: 18  ILALMSFIFMADSRMNKKGIAEFDNCLDSEVRF---SSKVRVPKLYRVLLVNDNYTPMEF 74
              + S        M    + E +     +        +V  P +Y V++ NDNYTPMEF
Sbjct: 9   ATPITSDWHFPHIPMRLAQVGEPEGETAPQADVLVAEPEVAKPPMYAVVMYNDNYTPMEF 68

Query: 75  VIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCI 134
           V+++LQ+ F    ++A  IML +H+   G  G+Y  +IAE K  +V + + +  YPL   
Sbjct: 69  VVYILQSEFRHSMDSAVEIMLTIHNSSKGIAGIYPKDIAETKAKKVNSLAHREGYPLLTQ 128

Query: 135 MEQ 137
           +E 
Sbjct: 129 IEP 131


>gi|261377437|ref|ZP_05982010.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria cinerea
           ATCC 14685]
 gi|269146155|gb|EEZ72573.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria cinerea
           ATCC 14685]
          Length = 100

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 39/82 (47%), Positives = 52/82 (63%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
            PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y  +IA+ 
Sbjct: 18  PPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLLVHHEGKGLCGTYTRDIAQT 77

Query: 116 KVNQVMNYSRQHQYPLQCIMEQ 137
           K  QVM  ++   +PLQCI+E+
Sbjct: 78  KQQQVMQRAKAEGHPLQCIVEE 99


>gi|303249375|ref|ZP_07335601.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           fructosovorans JJ]
 gi|302489213|gb|EFL49178.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           fructosovorans JJ]
          Length = 104

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 55/78 (70%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           Y+VLL ND+YT MEFVI VL   F+K+   A  IML VH+ G+G CG Y  E+AE+KV+ 
Sbjct: 26  YKVLLHNDDYTTMEFVIQVLVGVFHKNENEATQIMLNVHNNGVGVCGEYTAEVAELKVSL 85

Query: 120 VMNYSRQHQYPLQCIMEQ 137
           V   ++++ YPL+C ME+
Sbjct: 86  VHRLAKENGYPLKCSMEE 103


>gi|222149341|ref|YP_002550298.1| ATP-dependent Clp protease adaptor [Agrobacterium vitis S4]
 gi|221736325|gb|ACM37288.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 103

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 50/96 (52%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               +V+   K+  P+LY+V+L ND+YTP EFV  VL+  F    ET   +M+  H  G 
Sbjct: 7   VGQPKVKTRPKLEQPRLYKVILTNDDYTPREFVTIVLKAVFRMSEETGNRVMMTAHRFGS 66

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               V   +IAE K  +  + +++  +PL   +E +
Sbjct: 67  AVVVVCTRDIAETKSTEANDLAKEAGFPLLFTIEPE 102


>gi|194098152|ref|YP_002001200.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae NCCP11945]
 gi|291044246|ref|ZP_06569955.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae DGI2]
 gi|293399443|ref|ZP_06643596.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae F62]
 gi|193933442|gb|ACF29266.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae NCCP11945]
 gi|291011140|gb|EFE03136.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae DGI2]
 gi|291610012|gb|EFF39134.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae F62]
 gi|317163877|gb|ADV07418.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 137

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 39/82 (47%), Positives = 52/82 (63%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
            PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y  +IA+ 
Sbjct: 55  PPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLSVHHEGKGLCGTYTRDIAQT 114

Query: 116 KVNQVMNYSRQHQYPLQCIMEQ 137
           K  QVM  ++   +PLQCI+E+
Sbjct: 115 KQQQVMQRAKAEGHPLQCIVEE 136


>gi|313668693|ref|YP_004048977.1| atp-dependent Clp protease adaptor protein ClpS [Neisseria
           lactamica ST-640]
 gi|313006155|emb|CBN87616.1| atp-dependent Clp protease adaptor protein ClpS [Neisseria
           lactamica 020-06]
          Length = 128

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 39/85 (45%), Positives = 54/85 (63%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
             + PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y  +I
Sbjct: 43  DTQPPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLLVHHEGKGLCGTYTRDI 102

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A+ K  QVM+ ++   +PLQCI+E+
Sbjct: 103 AQTKQRQVMDRAKAEGHPLQCIIEE 127


>gi|161610776|ref|NP_946554.2| ATP-dependent Clp protease adaptor [Rhodopseudomonas palustris
           CGA009]
 gi|192289806|ref|YP_001990411.1| ATP-dependent Clp protease adaptor [Rhodopseudomonas palustris
           TIE-1]
 gi|67460483|sp|Q6NAI2|CLPS1_RHOPA RecName: Full=ATP-dependent Clp protease adapter protein ClpS 1
 gi|192283555|gb|ACE99935.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris TIE-1]
          Length = 103

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 56/102 (54%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           ++  D    ++ +   KV  PKL++V+LVND+YTP EFV+ VL+  F    + A  +ML 
Sbjct: 1   MSNIDLKPKTKAKAKIKVERPKLHKVILVNDDYTPREFVVSVLKGEFRMTEDQATKVMLT 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H +G+   GV+  ++AE K  +  +  R   YPL    E +
Sbjct: 61  AHQRGVCVVGVFTKDVAETKATRATDAGRAKGYPLLFTTEPE 102


>gi|254804708|ref|YP_003082929.1| putative ATP-dependent Clp protease adaptor protein [Neisseria
           meningitidis alpha14]
 gi|254668250|emb|CBA05092.1| putative ATP-dependent Clp protease adaptor protein [Neisseria
           meningitidis alpha14]
 gi|308389011|gb|ADO31331.1| putative ATP-dependent Clp protease adaptor protein clpS [Neisseria
           meningitidis alpha710]
 gi|325127944|gb|EGC50846.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis N1568]
 gi|325129979|gb|EGC52775.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis OX99.30304]
          Length = 100

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 52/88 (59%)

Query: 50  FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYA 109
                  PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y 
Sbjct: 12  RRLNTLPPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLLVHHEGKGLCGTYT 71

Query: 110 YEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +IA+ K  QVM  ++   +PLQCI+E+
Sbjct: 72  RDIAQTKQQQVMQRAKAEGHPLQCIVEE 99


>gi|57167994|ref|ZP_00367133.1| Uncharacterized ACR, COG2127 [Campylobacter coli RM2228]
 gi|305431855|ref|ZP_07401022.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter coli
           JV20]
 gi|57020368|gb|EAL57037.1| Uncharacterized ACR, COG2127 [Campylobacter coli RM2228]
 gi|304444939|gb|EFM37585.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter coli
           JV20]
          Length = 96

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/94 (44%), Positives = 62/94 (65%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
             +V   SK++ PK+++V+L+ND+ T M+FVI VL N FY D ETA  IML+VH  G G 
Sbjct: 3   KLKVLEKSKLKEPKMFKVILLNDDVTTMDFVIEVLINIFYHDFETANKIMLEVHLNGSGI 62

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CG+Y  EIA  K  +V + ++   +PLQ  +E++
Sbjct: 63  CGIYTQEIALSKQKKVSDAAKLANFPLQTRVEEE 96


>gi|325267632|ref|ZP_08134284.1| ATP-dependent Clp protease adaptor protein ClpS [Kingella
           denitrificans ATCC 33394]
 gi|324980982|gb|EGC16642.1| ATP-dependent Clp protease adaptor protein ClpS [Kingella
           denitrificans ATCC 33394]
          Length = 100

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/95 (42%), Positives = 61/95 (64%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               ++    K+  PK Y V+L+ND+YTPM+FV+ VL   F  +HE A  +ML++HH+G 
Sbjct: 3   QKTEKIIQRQKLTPPKRYAVVLLNDHYTPMDFVVAVLTEIFALNHEKAVAVMLQIHHEGS 62

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G CGVY  +IAE K  QV+  + +  +PL CI+++
Sbjct: 63  GVCGVYTRDIAETKRQQVLQAADEAGHPLMCIVQE 97


>gi|315929892|gb|EFV09052.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Campylobacter jejuni subsp. jejuni 305]
          Length = 96

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 62/94 (65%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
            ++    +K+  PK+Y+V+L+ND+ T M+FVI +L N F+++ E A   ML++HH G G 
Sbjct: 3   KTQTLEQTKLSEPKMYKVILLNDDVTTMDFVIEILMNIFHQNPEKASQTMLEIHHNGSGI 62

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CG+Y  EIA  K  +V++ ++   +PLQ  +E++
Sbjct: 63  CGIYTQEIALSKQKKVIDAAKLANFPLQAKVEEE 96


>gi|304387855|ref|ZP_07370029.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis ATCC 13091]
 gi|304338120|gb|EFM04256.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis ATCC 13091]
          Length = 112

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/111 (37%), Positives = 57/111 (51%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M   R  + G           +        PK Y V L+ND+YT MEFV+ +L   F   
Sbjct: 1   MPSERGFQMGHTMTAQHQSDTLLRRLNTLPPKRYGVFLLNDDYTTMEFVVEILTEIFMLG 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            E A  +ML VHH+G G CG Y  +IA+ K  QVM  ++   +PLQCI+E+
Sbjct: 61  QEQAVAVMLLVHHEGKGLCGTYTRDIAQTKQQQVMQRAKAEGHPLQCIVEE 111


>gi|154148611|ref|YP_001406669.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           hominis ATCC BAA-381]
 gi|153804620|gb|ABS51627.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           hominis ATCC BAA-381]
          Length = 97

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 59/92 (64%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E +  +K+ +PK+YRV+L+ND+ T M+FV+ +L   F K  + A  IML +H  G G CG
Sbjct: 6   ESQTKTKIFIPKIYRVILLNDDVTTMDFVVMILMEIFEKTRDEAINIMLHIHKNGSGICG 65

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            Y  EIAE K ++V   +++  +PL C +E++
Sbjct: 66  SYIKEIAETKKDEVKMLAKKANFPLVCEIEEE 97


>gi|153952414|ref|YP_001397780.1| hypothetical protein JJD26997_0615 [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|166214731|sp|A7H2Q0|CLPS_CAMJD RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|152939860|gb|ABS44601.1| conserved hypothetical protein [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 96

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 63/95 (66%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
           L ++    +K+  PK+Y+V+L+ND+ T M+FVI +L N F+++ E A   ML++HH G G
Sbjct: 2   LKTQTLEQTKLSEPKMYKVILLNDDVTTMDFVIEILMNIFHQNLEKASQTMLEIHHNGSG 61

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            CG+Y  EIA  K  +V++ ++   +PLQ  +E++
Sbjct: 62  ICGIYTQEIALSKQKKVIDAAKLANFPLQAKVEEE 96


>gi|146339195|ref|YP_001204243.1| ATP-dependent Clp protease adaptor [Bradyrhizobium sp. ORS278]
 gi|146192001|emb|CAL76006.1| ATP-dependent Clp protease adaptor protein clpS 2 [Bradyrhizobium
           sp. ORS278]
          Length = 115

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 53/98 (54%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D     + +  +KV  P+LY+V+LVND++TP +FV+ +L+  F    + A  +M+  H  
Sbjct: 17  DAVTKPKTKVRTKVERPRLYKVILVNDDFTPRDFVVMILKAEFRMTEDQAYKVMITAHKL 76

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G+    V+  ++AE K  +  +  R   YPL   +E +
Sbjct: 77  GVCVVAVFTKDVAETKATRATDAGRAKGYPLLFTIEPE 114


>gi|309379405|emb|CBX21972.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 100

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/85 (45%), Positives = 54/85 (63%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
             + PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y  +I
Sbjct: 15  DTQPPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLLVHHEGKGLCGTYTRDI 74

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A+ K  QVM+ ++   +PLQCI+E+
Sbjct: 75  AQTKQRQVMDRAKAEGHPLQCIVEE 99


>gi|300855650|ref|YP_003780634.1| ATP-dependent protease adaptor protein ClpS [Clostridium
           ljungdahlii DSM 13528]
 gi|300435765|gb|ADK15532.1| ATP-dependent protease adaptor protein ClpS [Clostridium
           ljungdahlii DSM 13528]
          Length = 99

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/93 (38%), Positives = 55/93 (59%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            + +   K++ P +Y+V++ ND+YT MEFV+ VL   F K    A  IM  VH +GIG  
Sbjct: 7   LKQKPQLKIKPPSMYKVIIHNDDYTTMEFVVEVLIKIFEKSAVEATKIMYDVHRRGIGVA 66

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           GVY Y+IA  K+ Q +  +    +PL+  ME++
Sbjct: 67  GVYVYDIAATKIMQAVKMAESSGFPLKFSMEEE 99


>gi|86748339|ref|YP_484835.1| ATP-dependent Clp protease adaptor [Rhodopseudomonas palustris
           HaA2]
 gi|86571367|gb|ABD05924.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris HaA2]
          Length = 101

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 52/99 (52%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            +       +   K+  PKLY+V+LVND++TP +FV+ +L++ F    E A  +ML  H 
Sbjct: 2   SNVVTKPTAKAKPKLERPKLYKVILVNDDFTPRDFVVMILKSEFRMTEEQAYKVMLTAHQ 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +G+    V+  +IAE K  +  +  R   YPL    E +
Sbjct: 62  RGVCVVAVFTKDIAETKATRATDAGRAKGYPLLFTTEPE 100


>gi|57237989|ref|YP_179238.1| hypothetical protein CJE1250 [Campylobacter jejuni RM1221]
 gi|86150412|ref|ZP_01068638.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88596781|ref|ZP_01100018.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|218562721|ref|YP_002344500.1| ATP-dependent Clp protease adaptor protein [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|12230833|sp|Q9PNI7|CLPS_CAMJE RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|67460170|sp|Q5HTZ7|CLPS_CAMJR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|57166793|gb|AAW35572.1| conserved hypothetical protein [Campylobacter jejuni RM1221]
 gi|85839237|gb|EAQ56500.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88191622|gb|EAQ95594.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|112360427|emb|CAL35224.1| ATP-dependent Clp protease adaptor protein [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|284926336|gb|ADC28688.1| ATP-dependent Clp protease adaptor protein [Campylobacter jejuni
           subsp. jejuni IA3902]
 gi|315058548|gb|ADT72877.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           jejuni subsp. jejuni S3]
          Length = 96

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 62/94 (65%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
            ++    +K+  PK+Y+V+L+ND+ T M+FVI +L N F+++ E A   ML++HH G G 
Sbjct: 3   KTQTLEQTKLSEPKMYKVILLNDDVTTMDFVIEILMNIFHQNLEKASQTMLEIHHNGSGI 62

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CG+Y  EIA  K  +VM+ ++   +PLQ  +E++
Sbjct: 63  CGIYTQEIALSKQKKVMDAAKLANFPLQAKVEEE 96


>gi|225075508|ref|ZP_03718707.1| hypothetical protein NEIFLAOT_00521 [Neisseria flavescens
           NRL30031/H210]
 gi|241758489|ref|ZP_04756608.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           flavescens SK114]
 gi|319637941|ref|ZP_07992707.1| ATP-dependent Clp protease adapter protein ClpS [Neisseria mucosa
           C102]
 gi|224953143|gb|EEG34352.1| hypothetical protein NEIFLAOT_00521 [Neisseria flavescens
           NRL30031/H210]
 gi|241321324|gb|EER57472.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           flavescens SK114]
 gi|317401096|gb|EFV81751.1| ATP-dependent Clp protease adapter protein ClpS [Neisseria mucosa
           C102]
          Length = 103

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 59/102 (57%), Gaps = 1/102 (0%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                D+  D+ +      + PK Y V L+ND+YT MEFV+ +L   F    E A  +ML
Sbjct: 2   NHPNTDHQSDTLL-SDINTQPPKRYGVFLLNDDYTTMEFVVEILTEVFMLAQEQAVAVML 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            VHH+G G CG Y  +IA+ K +QVM  ++   +PL+CI+E+
Sbjct: 61  LVHHEGKGLCGTYTRDIAQTKQHQVMERAKAEGHPLKCIVEE 102


>gi|86152758|ref|ZP_01070963.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           jejuni subsp. jejuni HB93-13]
 gi|121612672|ref|YP_001000785.1| hypothetical protein CJJ81176_1125 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|157415368|ref|YP_001482624.1| hypothetical protein C8J_1048 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|167005700|ref|ZP_02271458.1| hypothetical protein Cjejjejuni_05870 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|283956504|ref|ZP_06373984.1| hypothetical protein C1336_000250281 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|166214732|sp|A1W094|CLPS_CAMJJ RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|172047149|sp|A8FMG0|CLPS_CAMJ8 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|85843643|gb|EAQ60853.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           jejuni subsp. jejuni HB93-13]
 gi|87249258|gb|EAQ72219.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|157386332|gb|ABV52647.1| hypothetical protein C8J_1048 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|283792224|gb|EFC31013.1| hypothetical protein C1336_000250281 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|307748009|gb|ADN91279.1| ATP-dependent Clp protease adapter protein clpS [Campylobacter
           jejuni subsp. jejuni M1]
 gi|315932245|gb|EFV11188.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Campylobacter jejuni subsp. jejuni 327]
          Length = 96

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 62/94 (65%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
            ++    +K+  PK+Y+V+L+ND+ T M+FVI +L N F+++ E A   ML++HH G G 
Sbjct: 3   KTQTLEQTKLSEPKMYKVILLNDDVTTMDFVIEILMNIFHQNLEKASQTMLEIHHNGSGI 62

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CG+Y  EIA  K  +V++ ++   +PLQ  +E++
Sbjct: 63  CGIYTQEIALSKQKKVIDAAKLANFPLQAKVEEE 96


>gi|108758335|ref|YP_634160.1| ATP-dependent Clp protease adaptor protein ClpS [Myxococcus xanthus
           DK 1622]
 gi|122387659|sp|Q1CZL3|CLPS_MYXXD RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|108462215|gb|ABF87400.1| ATP-dependent Clp protease adaptor protein ClpS [Myxococcus xanthus
           DK 1622]
          Length = 107

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D  + +E     K++ P LY+VLL NDNYT  EFV+ VL+  F+K    A  IML VH+ 
Sbjct: 8   DTSVITESAPKQKLKKPPLYKVLLHNDNYTTREFVVAVLKEVFHKSETDAVQIMLHVHYN 67

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G+G  GVY Y++AE K+  V   ++++  PL+  ME +
Sbjct: 68  GVGVAGVYTYDVAETKIQTVEAAAQENDMPLRLSMEPE 105


>gi|86150870|ref|ZP_01069086.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|85842040|gb|EAQ59286.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           260.94]
          Length = 96

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 62/94 (65%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
            ++    +K+  PK+Y+V+L+ND+ T M+FVI +L N F+++ E A   MLK+HH G G 
Sbjct: 3   KTQTLEQTKLSEPKMYKVILLNDDVTTMDFVIEILMNIFHQNLEKASQTMLKIHHNGSGI 62

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CG+Y  EIA  K  +V++ ++   +PLQ  +E++
Sbjct: 63  CGIYTQEIALSKQKKVIDAAKLANFPLQVKVEEE 96


>gi|42527626|ref|NP_972724.1| hypothetical protein TDE2123 [Treponema denticola ATCC 35405]
 gi|67460342|sp|Q73KU4|CLPS_TREDE RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|41818454|gb|AAS12643.1| conserved hypothetical protein [Treponema denticola ATCC 35405]
 gi|325474421|gb|EGC77608.1| ATP-dependent Clp protease adaptor protein ClpS [Treponema
           denticola F0402]
          Length = 101

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 57/88 (64%)

Query: 50  FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYA 109
            S K   P+ YRV+L+ND++TPM+FV+ VL + F K  E A+ +M KVH  G    G+Y 
Sbjct: 13  ISEKFIEPENYRVILLNDDFTPMDFVVAVLISIFNKSQEEAETLMFKVHKTGQASVGIYV 72

Query: 110 YEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           Y+IA  K  QV+  ++ + +PLQC +E+
Sbjct: 73  YDIATTKCFQVLTAAKNNNFPLQCKVEK 100


>gi|59800852|ref|YP_207564.1| hypothetical protein NGO0409 [Neisseria gonorrhoeae FA 1090]
 gi|67460149|sp|Q5F9I5|CLPS_NEIG1 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|59717747|gb|AAW89152.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
          Length = 100

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/82 (47%), Positives = 52/82 (63%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
            PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y  +IA+ 
Sbjct: 18  PPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLSVHHEGKGLCGTYTRDIAQT 77

Query: 116 KVNQVMNYSRQHQYPLQCIMEQ 137
           K  QVM  ++   +PLQCI+E+
Sbjct: 78  KQQQVMQRAKAEGHPLQCIVEE 99


>gi|149195297|ref|ZP_01872385.1| hypothetical protein CMTB2_00354 [Caminibacter mediatlanticus TB-2]
 gi|149134561|gb|EDM23049.1| hypothetical protein CMTB2_00354 [Caminibacter mediatlanticus TB-2]
          Length = 83

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 53/82 (64%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
           PKLY+V+L+ND+YT  +FVI +L+  F K  E A  + LKV  +G    G+Y YEIA MK
Sbjct: 2   PKLYKVILLNDDYTTFDFVIEILKTVFGKSEEDAINLTLKVDREGSAVVGLYPYEIALMK 61

Query: 117 VNQVMNYSRQHQYPLQCIMEQK 138
           V++V   +R   YPL+  +E+ 
Sbjct: 62  VDKVHQLARSAGYPLRARIEED 83


>gi|260462566|ref|ZP_05810773.1| ATP-dependent Clp protease adaptor protein ClpS [Mesorhizobium
           opportunistum WSM2075]
 gi|259031762|gb|EEW33031.1| ATP-dependent Clp protease adaptor protein ClpS [Mesorhizobium
           opportunistum WSM2075]
          Length = 101

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 50/99 (50%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            +       +   +   PKLY+V+L+ND++TP EFV+ VL+  F    + A  IM+  H 
Sbjct: 2   PEITTKPRTKVKPQTERPKLYKVILINDDFTPREFVVTVLKGEFKLSEDQAHRIMITAHQ 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +G+    V+  ++AE K  +  +  +   YPL    E +
Sbjct: 62  RGVCVVAVFTRDVAETKATRATDAGKAKGYPLLFTTEPE 100


>gi|205355853|ref|ZP_03222622.1| hypothetical protein Cj8421_1136 [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|205346287|gb|EDZ32921.1| hypothetical protein Cj8421_1136 [Campylobacter jejuni subsp.
           jejuni CG8421]
          Length = 96

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 62/94 (65%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
            ++    +K+  PK+Y+V+L+ND+ T M+FVI +L N F+++ E A   ML++HH G G 
Sbjct: 3   KTQTLEQTKLSEPKMYKVILLNDDVTTMDFVIEILMNIFHQNLEKASQTMLEIHHNGSGI 62

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CG+Y  EIA  K  +V++ ++   +PLQ  +E++
Sbjct: 63  CGIYTQEIALSKQKKVIDSAKLANFPLQAKVEEE 96


>gi|239998603|ref|ZP_04718527.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae 35/02]
 gi|240013726|ref|ZP_04720639.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae DGI18]
 gi|240016164|ref|ZP_04722704.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae FA6140]
 gi|240080308|ref|ZP_04724851.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae FA19]
 gi|240112519|ref|ZP_04727009.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae MS11]
 gi|240115259|ref|ZP_04729321.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae PID18]
 gi|240117546|ref|ZP_04731608.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae PID1]
 gi|240120796|ref|ZP_04733758.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae PID24-1]
 gi|240123101|ref|ZP_04736057.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae PID332]
 gi|240125352|ref|ZP_04738238.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae SK-92-679]
 gi|240127805|ref|ZP_04740466.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae SK-93-1035]
 gi|254493323|ref|ZP_05106494.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae 1291]
 gi|260440923|ref|ZP_05794739.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           gonorrhoeae DGI2]
 gi|268594461|ref|ZP_06128628.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae 35/02]
 gi|268596457|ref|ZP_06130624.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae FA19]
 gi|268598589|ref|ZP_06132756.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae MS11]
 gi|268600942|ref|ZP_06135109.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae PID18]
 gi|268603249|ref|ZP_06137416.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268681729|ref|ZP_06148591.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae PID332]
 gi|268683956|ref|ZP_06150818.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae SK-92-679]
 gi|268686201|ref|ZP_06153063.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae SK-93-1035]
 gi|226512363|gb|EEH61708.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae 1291]
 gi|268547850|gb|EEZ43268.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae 35/02]
 gi|268550245|gb|EEZ45264.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae FA19]
 gi|268582720|gb|EEZ47396.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae MS11]
 gi|268585073|gb|EEZ49749.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae PID18]
 gi|268587380|gb|EEZ52056.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268622013|gb|EEZ54413.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae PID332]
 gi|268624240|gb|EEZ56640.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae SK-92-679]
 gi|268626485|gb|EEZ58885.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           gonorrhoeae SK-93-1035]
          Length = 112

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/82 (47%), Positives = 52/82 (63%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
            PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y  +IA+ 
Sbjct: 30  PPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLSVHHEGKGLCGTYTRDIAQT 89

Query: 116 KVNQVMNYSRQHQYPLQCIMEQ 137
           K  QVM  ++   +PLQCI+E+
Sbjct: 90  KQQQVMQRAKAEGHPLQCIVEE 111


>gi|218767947|ref|YP_002342459.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis Z2491]
 gi|12230806|sp|Q9JV14|CLPS_NEIMA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|121051955|emb|CAM08263.1| hypothetical protein NMA1046 [Neisseria meningitidis Z2491]
          Length = 103

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 59/102 (57%), Gaps = 1/102 (0%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                D+  D+ +      + PK Y V L+ND+YT MEFV+ +L   F    E A  +ML
Sbjct: 2   NHPNTDHQSDTLL-SDINTQPPKRYGVFLLNDDYTTMEFVVEILTEVFMLAQEQAVAVML 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            VHH+G G CG Y  +IA+ K +QVM  ++   +PL+CI+E+
Sbjct: 61  LVHHEGKGLCGTYTRDIAQTKQHQVMERAKTEGHPLKCIVEE 102


>gi|297180171|gb|ADI16393.1| uncharacterized conserved protein [uncultured bacterium
           HF130_12L15]
          Length = 101

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 53/98 (54%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D    S  +   K+  P+L++V+L ND++TP EFV+ VL+  F  + + A+ +M+  H +
Sbjct: 3   DVDTKSRTKVKPKIERPRLHKVILFNDDFTPREFVVMVLKAEFGMNADQAQQVMITAHRR 62

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G     V+  ++AE K  +  +  R+  +PL    E +
Sbjct: 63  GACVVAVFTKDVAETKATRATDAGRKMGFPLLFGTEPE 100


>gi|15676733|ref|NP_273878.1| hypothetical protein NMB0837 [Neisseria meningitidis MC58]
 gi|121634615|ref|YP_974860.1| hypothetical protein NMC0775 [Neisseria meningitidis FAM18]
 gi|12230808|sp|Q9JZZ5|CLPS_NEIMB RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|7226071|gb|AAF41248.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|120866321|emb|CAM10062.1| putative ATP-dependent Clp protease adaptor protein clpS [Neisseria
           meningitidis FAM18]
 gi|254670466|emb|CBA06136.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|254672383|emb|CBA05650.1| conserved hypothetical protein [Neisseria meningitidis alpha275]
 gi|261392811|emb|CAX50392.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis 8013]
 gi|319410196|emb|CBY90534.1| ATP-dependent Clp protease adapter protein clpS [Neisseria
           meningitidis WUE 2594]
 gi|325132022|gb|EGC54720.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis M6190]
 gi|325134027|gb|EGC56682.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis M13399]
 gi|325135948|gb|EGC58558.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis M0579]
 gi|325137776|gb|EGC60351.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis ES14902]
 gi|325140015|gb|EGC62544.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis CU385]
 gi|325144133|gb|EGC66440.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis M01-240013]
 gi|325198040|gb|ADY93496.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis G2136]
 gi|325200483|gb|ADY95938.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis H44/76]
 gi|325202375|gb|ADY97829.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis M01-240149]
 gi|325203908|gb|ADY99361.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis M01-240355]
 gi|325206329|gb|ADZ01782.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis M04-240196]
 gi|325207873|gb|ADZ03325.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria
           meningitidis NZ-05/33]
          Length = 100

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/82 (47%), Positives = 52/82 (63%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
            PK Y V L+ND+YT MEFV+ +L   F    E A  +ML VHH+G G CG Y  +IA+ 
Sbjct: 18  PPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLLVHHEGKGLCGTYTRDIAQT 77

Query: 116 KVNQVMNYSRQHQYPLQCIMEQ 137
           K  QVM  ++   +PLQCI+E+
Sbjct: 78  KQQQVMQRAKAEGHPLQCIVEE 99


>gi|110634479|ref|YP_674687.1| ATP-dependent Clp protease adaptor [Mesorhizobium sp. BNC1]
 gi|110285463|gb|ABG63522.1| ATP-dependent Clp protease adaptor protein ClpS [Chelativorans sp.
           BNC1]
          Length = 101

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 53/99 (53%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            D  L    +   KV  PKL++V+LVND++TP EFV+ VL+  F  + + A  +M+  H 
Sbjct: 2   SDIVLKPRTKTKPKVDKPKLHKVILVNDDFTPREFVVRVLKAEFRLNQDQAYRVMITAHR 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +G     V+  +IAE K  +  +  R+  YPL    E +
Sbjct: 62  RGTCVVAVFPKDIAETKATRATDAGRKAGYPLLFTTEPE 100


>gi|283954672|ref|ZP_06372190.1| hypothetical protein C414_000240081 [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283793864|gb|EFC32615.1| hypothetical protein C414_000240081 [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 96

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 60/94 (63%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
             +     K+  PK+Y+V+L+ND+ T M+FVI +L N F+++ E A   ML++HH G G 
Sbjct: 3   KIQTLEQIKLSEPKMYKVILLNDDVTTMDFVIEILINIFHQNLEKANQTMLEIHHNGSGI 62

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CG+Y  EIA  K  +V++ ++   +PLQ  +E++
Sbjct: 63  CGIYTQEIALSKQKKVIDAAKLANFPLQVKVEEE 96


>gi|51244739|ref|YP_064623.1| hypothetical protein DP0887 [Desulfotalea psychrophila LSv54]
 gi|67460264|sp|Q6APV7|CLPS_DESPS RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|50875776|emb|CAG35616.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 102

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 60/102 (58%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           + E     DS      + R P +YRVL+ ND+YT M+FV+ +L   F K    A+ IML 
Sbjct: 1   MTEDKQQSDSATIDDIETREPPMYRVLIHNDDYTSMDFVVAILMQIFSKTEAVAEEIMLT 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           VH   +G  G+Y +EIAE KV  V   + Q+++PL+C +E++
Sbjct: 61  VHSSEVGVAGLYTHEIAETKVAIVHQLAEQNEFPLRCSLEKE 102


>gi|218891218|ref|YP_002440084.1| hypothetical protein PLES_24841 [Pseudomonas aeruginosa LESB58]
 gi|254235607|ref|ZP_04928930.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254241054|ref|ZP_04934376.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|308154504|ref|NP_251311.3| hypothetical protein PA2621 [Pseudomonas aeruginosa PAO1]
 gi|313107658|ref|ZP_07793841.1| ATP-dependent Clp protease adaptor protein clpS [Pseudomonas
           aeruginosa 39016]
 gi|9948687|gb|AAG06009.1|AE004690_9 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126167538|gb|EAZ53049.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126194432|gb|EAZ58495.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218771443|emb|CAW27210.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
 gi|310880343|gb|EFQ38937.1| ATP-dependent Clp protease adaptor protein clpS [Pseudomonas
           aeruginosa 39016]
          Length = 78

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/76 (48%), Positives = 51/76 (67%)

Query: 63  LLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           +L ND+YTPM+FV+ VL+ FF  D E A  IML VH QG   CG++  ++AE K  QV  
Sbjct: 2   VLFNDDYTPMDFVVEVLEVFFNMDREKATKIMLTVHTQGKAVCGLFTRDVAETKAMQVNQ 61

Query: 123 YSRQHQYPLQCIMEQK 138
           Y+R+ Q+PL C +E+ 
Sbjct: 62  YARESQHPLLCEIEKD 77


>gi|315638592|ref|ZP_07893766.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           upsaliensis JV21]
 gi|315481216|gb|EFU71846.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           upsaliensis JV21]
          Length = 96

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 59/94 (62%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
             E      ++ PK+Y+V+L+ND+ T M+FVI VL   F+   E A  IMLK+H +G G 
Sbjct: 3   KLESLQKEHLQEPKMYKVVLLNDDVTTMDFVIEVLMYVFFHSFEKANEIMLKIHCEGSGV 62

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CG+Y  EIA  K  +V N +++ Q+PLQ  +E++
Sbjct: 63  CGIYTQEIALSKQKKVQNMAKEAQFPLQSRVEEE 96


>gi|218193695|gb|EEC76122.1| hypothetical protein OsI_13390 [Oryza sativa Indica Group]
          Length = 3986

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 40/95 (42%), Positives = 59/95 (62%), Gaps = 1/95 (1%)

Query: 36   GIAEFDNCLDSEVRFSS-KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
            G+   D+     +   + + + P++Y+V+++ND+YTPMEFVI VLQ FF KD E A  IM
Sbjct: 3583 GVPSRDDGGSVVLERRTQRTQPPQMYQVVMLNDDYTPMEFVIVVLQEFFGKDREAATQIM 3642

Query: 95   LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQY 129
            LK+H  G G CGVY+ ++A  KV Q +  S    +
Sbjct: 3643 LKIHLDGKGVCGVYSRDVAATKVEQELEVSLHMAF 3677


>gi|294668967|ref|ZP_06734054.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria elongata
           subsp. glycolytica ATCC 29315]
 gi|291309140|gb|EFE50383.1| ATP-dependent Clp protease adaptor protein ClpS [Neisseria elongata
           subsp. glycolytica ATCC 29315]
          Length = 101

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/85 (43%), Positives = 55/85 (64%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           ++R P+ Y V L+ND+YT M+FV+ VL   F    + A  +ML VHH+G G CGVY  +I
Sbjct: 15  QLRPPRKYGVFLLNDDYTTMDFVVEVLTEVFRLPEDRAVAVMLLVHHEGKGLCGVYTRDI 74

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A+ K  QV + +    +PL+CI+E+
Sbjct: 75  AQTKQMQVHHRAEDAGFPLKCILEE 99


>gi|254491965|ref|ZP_05105143.1| ATP-dependent Clp protease adaptor protein ClpS [Methylophaga
           thiooxidans DMS010]
 gi|224462780|gb|EEF79051.1| ATP-dependent Clp protease adaptor protein ClpS [Methylophaga
           thiooxydans DMS010]
          Length = 75

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 55/75 (73%)

Query: 64  LVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123
           ++ND+YTPM+FV+ VL+N F    E A   ML+VH +G   CG++ YEIAE KV QV +Y
Sbjct: 1   MLNDDYTPMDFVVEVLENLFGMGREKATQTMLQVHTEGSALCGIFTYEIAEAKVEQVNSY 60

Query: 124 SRQHQYPLQCIMEQK 138
           S++H +PLQC ME++
Sbjct: 61  SQRHGHPLQCTMEEE 75


>gi|75674828|ref|YP_317249.1| ATP-dependent Clp protease adaptor [Nitrobacter winogradskyi
           Nb-255]
 gi|74419698|gb|ABA03897.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrobacter
           winogradskyi Nb-255]
          Length = 101

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 50/99 (50%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            D  +   ++  +K+  P+LY+V+L ND++TP EFV+ VL   F      A  +M+    
Sbjct: 2   SDIAIKPRIKAETKIERPRLYKVILHNDDFTPREFVVAVLMAEFNMTDGQAHKVMITADR 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            G    GV+A +IAE K  +  +  R   +PL    E +
Sbjct: 62  LGSCVVGVFARDIAETKATRATDAGRSMGFPLLFTTEPE 100


>gi|92116383|ref|YP_576112.1| ATP-dependent Clp protease adaptor [Nitrobacter hamburgensis X14]
 gi|91799277|gb|ABE61652.1| ATP-dependent Clp protease adaptor protein ClpS [Nitrobacter
           hamburgensis X14]
          Length = 101

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 46/99 (46%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            D  +        +   P+L++V+L ND+YTP EFV+ VL   F    + A  +M+  H 
Sbjct: 2   SDTAIKPRTNVEPRTERPRLHKVILHNDDYTPREFVVTVLMAEFGLTEDQAHKVMITAHR 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            G     V+  ++AE K  +  +  R   +PL    E +
Sbjct: 62  LGCCVVAVFTRDVAETKATRATDAGRAMGFPLLFTTEPE 100


>gi|13472441|ref|NP_104008.1| ATP-dependent Clp protease adaptor [Mesorhizobium loti MAFF303099]
 gi|21542322|sp|Q98HS2|CLPS2_RHILO RecName: Full=ATP-dependent Clp protease adapter protein ClpS 2
 gi|14023187|dbj|BAB49794.1| mll2736 [Mesorhizobium loti MAFF303099]
          Length = 101

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 50/99 (50%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            +       +   +   PKLY+V+L+ND++TP EFV+ VL+  F    + A  IM+  H 
Sbjct: 2   PEITTKPRTKVKPQTERPKLYKVILINDDFTPREFVVTVLKGEFKLSEDQAHRIMITAHR 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +G+    V+  ++AE K  +  +  +   YPL    E +
Sbjct: 62  RGVCVVAVFTKDVAETKATRATDAGKAKGYPLLFTTEPE 100


>gi|57242270|ref|ZP_00370209.1| Uncharacterized ACR, COG2127 [Campylobacter upsaliensis RM3195]
 gi|57016950|gb|EAL53732.1| Uncharacterized ACR, COG2127 [Campylobacter upsaliensis RM3195]
          Length = 96

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 60/94 (63%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
             E      ++ PK+Y+V+L+ND+ T M+FVI VL + F+   E A  IMLK+H +G G 
Sbjct: 3   KLESLQKEHLQEPKMYKVVLLNDDVTTMDFVIEVLMHVFFHSFEKANEIMLKIHCEGSGV 62

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           CG+Y  EIA  K  +V N +++ Q+PLQ  +E++
Sbjct: 63  CGIYTQEIALSKQKKVQNMAKEAQFPLQSRVEEE 96


>gi|264678276|ref|YP_003278183.1| ATP-dependent Clp protease adaptor protein ClpS [Comamonas
           testosteroni CNB-2]
 gi|299533529|ref|ZP_07046906.1| ATP-dependent Clp protease adaptor protein ClpS [Comamonas
           testosteroni S44]
 gi|262208789|gb|ACY32887.1| ATP-dependent Clp protease adaptor protein ClpS [Comamonas
           testosteroni CNB-2]
 gi|298718487|gb|EFI59467.1| ATP-dependent Clp protease adaptor protein ClpS [Comamonas
           testosteroni S44]
          Length = 95

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 56/79 (70%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
           +Y+V+++ND++TPMEFVI VLQ  F KD E+A  IMLK+H  G G CGVY+ ++A  KV 
Sbjct: 15  MYQVVMLNDDFTPMEFVIAVLQELFGKDRESATQIMLKIHLDGRGVCGVYSQDVAATKVE 74

Query: 119 QVMNYSRQHQYPLQCIMEQ 137
           QV+  +++  +PLQ   E 
Sbjct: 75  QVLQAAQKAGHPLQATFEP 93


>gi|125973731|ref|YP_001037641.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           thermocellum ATCC 27405]
 gi|256005533|ref|ZP_05430494.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           thermocellum DSM 2360]
 gi|281417888|ref|ZP_06248908.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           thermocellum JW20]
 gi|229889819|sp|A3DER9|CLPS_CLOTH RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|125713956|gb|ABN52448.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           thermocellum ATCC 27405]
 gi|255990513|gb|EEU00634.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           thermocellum DSM 2360]
 gi|281409290|gb|EFB39548.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           thermocellum JW20]
 gi|316940075|gb|ADU74109.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           thermocellum DSM 1313]
          Length = 99

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 35/93 (37%), Positives = 56/93 (60%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            +   +   + PK+Y+V+L+ND+YT M+FV+ +L   F+K    A  IML VH +G G  
Sbjct: 7   VKKETNVDFKKPKMYKVILLNDDYTTMDFVVEILITVFHKTAADATRIMLDVHRKGKGVV 66

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           GVY Y+IA  K+  V   + + ++PL  +ME +
Sbjct: 67  GVYTYDIARSKIALVEKMAAEREFPLAAVMEPE 99


>gi|315186429|gb|EFU20189.1| ATP-dependent Clp protease adaptor protein ClpS [Spirochaeta
           thermophila DSM 6578]
          Length = 115

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 53/79 (67%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
           +Y V+L+ND++TPMEFV+ +L + F+KD   A  IML VH  G G+   Y Y+IA  KV 
Sbjct: 36  MYWVVLLNDDFTPMEFVVDILVDIFHKDRVEATKIMLTVHRTGKGKVATYPYDIAVTKVA 95

Query: 119 QVMNYSRQHQYPLQCIMEQ 137
           QV   +R+  +PL+C +E+
Sbjct: 96  QVHRRAREAGHPLRCTVEK 114


>gi|148253958|ref|YP_001238543.1| ATP-dependent Clp protease adaptor [Bradyrhizobium sp. BTAi1]
 gi|146406131|gb|ABQ34637.1| ATP-dependent Clp protease adaptor protein clpS 2 [Bradyrhizobium
           sp. BTAi1]
          Length = 115

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 53/98 (54%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D     + +  +KV  P+LY+V+LVND++TP +FV+ +L++ F    + A  +M+  H  
Sbjct: 17  DAVTKPKTKVRTKVERPRLYKVILVNDDFTPRDFVVMILKSEFRMTEDQAYKVMITAHKL 76

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G+    V+  ++AE K  +  +  R   YPL    E +
Sbjct: 77  GVCVVAVFTKDVAETKATRATDAGRAKGYPLLFTTEPE 114


>gi|303242598|ref|ZP_07329074.1| ATP-dependent Clp protease adaptor protein ClpS [Acetivibrio
           cellulolyticus CD2]
 gi|302589855|gb|EFL59627.1| ATP-dependent Clp protease adaptor protein ClpS [Acetivibrio
           cellulolyticus CD2]
          Length = 99

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 54/86 (62%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           + + PK+Y+V+L+ND+YT MEFVI VL   F+K+   A  IML VH +G G  G Y Y+I
Sbjct: 14  EFKKPKMYKVILLNDDYTTMEFVIEVLIAVFHKNPTDATQIMLDVHEKGKGIVGAYTYDI 73

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQK 138
           A  K+ QV   + +  +PL  +ME  
Sbjct: 74  ACTKIAQVEEMAIKRDFPLVTVMEPD 99


>gi|90422655|ref|YP_531025.1| ATP-dependent Clp protease adaptor [Rhodopseudomonas palustris
           BisB18]
 gi|90104669|gb|ABD86706.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris BisB18]
          Length = 105

 Score =  116 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 50/96 (52%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
            +    +   K   PKL++V+LVND+YTP EFV+ VLQ  F    + A  +M+  H +G+
Sbjct: 9   DVAPRTKVKPKTERPKLHKVILVNDDYTPREFVVRVLQAEFRMTEDQAHKVMITAHQRGV 68

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               V+  ++AE K  +  +  R   YPL    E +
Sbjct: 69  CVVAVFTKDVAETKATRATDAGRAKGYPLLFTTEPE 104


>gi|313143016|ref|ZP_07805209.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           cinaedi CCUG 18818]
 gi|313128047|gb|EFR45664.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           cinaedi CCUG 18818]
          Length = 87

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 40/84 (47%), Positives = 57/84 (67%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +  PKLYRVLL+ND++T M FV H+L   F K  + A+ I LKVH++G G CG+Y Y+IA
Sbjct: 2   LEEPKLYRVLLLNDDWTAMNFVTHILMEVFDKTSQEARAITLKVHNEGKGVCGIYPYDIA 61

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQ 137
           E+K   V   +++  YPL+ I E+
Sbjct: 62  ELKTQLVSQKAKEQGYPLRVITEE 85


>gi|84501067|ref|ZP_00999302.1| ATP-dependent Clp protease adaptor protein ClpS [Oceanicola
           batsensis HTCC2597]
 gi|84391134|gb|EAQ03552.1| ATP-dependent Clp protease adaptor protein ClpS [Oceanicola
           batsensis HTCC2597]
          Length = 101

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 32/98 (32%), Positives = 51/98 (52%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D   +  V  +++   PKLY+V+L+ND++TP  FV+ VLQ  F      A+ +M+  H +
Sbjct: 3   DRAPEGTVETATRSERPKLYKVILLNDDFTPRRFVVKVLQGVFRMTEGEAEAVMMTAHRR 62

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G     V+  EIAE K  +     R   +PL    E++
Sbjct: 63  GACVVAVFTREIAEQKAREATELGRHAGFPLTFTTERE 100


>gi|300726156|ref|ZP_07059613.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella
           bryantii B14]
 gi|299776626|gb|EFI73179.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella
           bryantii B14]
          Length = 98

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 56/96 (58%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             +S ++   K++ P+ Y+V+  ND+ T M+FVI VL   F+K ++ A+ +M+KVH  G 
Sbjct: 3   QTNSNIKERIKLKEPRRYQVIFFNDDVTTMDFVIEVLTTVFHKAYQEAEELMMKVHLNGS 62

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              GVY+Y+IA  K       + +  +PL+  M+ +
Sbjct: 63  AVVGVYSYDIALTKTTNASEMAHKAGFPLRIEMQAE 98


>gi|311694972|gb|ADP97845.1| ATP-dependent Clp protease adaptor protein ClpS [marine bacterium
           HP15]
          Length = 78

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 50/75 (66%)

Query: 63  LLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           +L+ND+YTPM+FV+ VL  FF  + E A  +ML VH QG   CGVY  +IAE K  QV  
Sbjct: 2   VLLNDDYTPMDFVVDVLMKFFGMNEEKATQVMLLVHTQGKAVCGVYTRDIAETKAAQVNQ 61

Query: 123 YSRQHQYPLQCIMEQ 137
           YS + ++PL C +E+
Sbjct: 62  YSSECEHPLLCEIER 76


>gi|222824061|ref|YP_002575635.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter lari
           RM2100]
 gi|222539283|gb|ACM64384.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter lari
           RM2100]
          Length = 97

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/92 (45%), Positives = 61/92 (66%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E+    K+  PK+++VLL+ND+ T MEFVI VL N F+ D E A  IML++H+QG G CG
Sbjct: 6   EILEQQKLTEPKMFKVLLLNDDITTMEFVIEVLMNIFHHDFEKASAIMLEIHNQGSGICG 65

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +Y  EIA  K  QV   ++ + +PLQ  +E++
Sbjct: 66  IYTEEIALSKKQQVDLAAKSNNFPLQTRIEEQ 97


>gi|288929195|ref|ZP_06423040.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella sp.
           oral taxon 317 str. F0108]
 gi|288329297|gb|EFC67883.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella sp.
           oral taxon 317 str. F0108]
          Length = 109

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 54/95 (56%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R  + +R P+ Y+VL+ ND++T M+FV+ +L+  F+K    A+ +ML VH    
Sbjct: 14  QEAIRERIRTNLREPRKYKVLIHNDDFTTMDFVVMILKVVFFKSETEAEALMLAVHRSDK 73

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
              GVY+Y++A  KV++  + +R   YPL+   + 
Sbjct: 74  AVVGVYSYDVAMSKVSKATDMARHAGYPLRLTCQP 108


>gi|316932749|ref|YP_004107731.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris DX-1]
 gi|315600463|gb|ADU42998.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris DX-1]
          Length = 101

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 53/99 (53%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            +  L  + +   KV  PKL++V+LVND+YTP EFV+ VL+       + A  +ML  H 
Sbjct: 2   SNIDLKPKTKAKIKVERPKLHKVILVNDDYTPREFVVSVLKAELRMTEDQAYKVMLTAHQ 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +G+   GV+  ++AE K  +  +  R   YPL    E +
Sbjct: 62  RGVCVVGVFTKDVAETKATRATDAGRAKGYPLLFTTEPE 100


>gi|49082482|gb|AAT50641.1| PA2621 [synthetic construct]
          Length = 79

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 50/76 (65%)

Query: 63  LLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           +L ND+YTPM+FV+ VL+ FF  D E A   ML VH QG   CG++  ++AE K  QV  
Sbjct: 2   VLFNDDYTPMDFVVEVLEVFFNMDREKATKTMLTVHTQGKAVCGLFTRDVAETKAMQVNQ 61

Query: 123 YSRQHQYPLQCIMEQK 138
           Y+R+ Q+PL C +E+ 
Sbjct: 62  YARESQHPLLCEIEKD 77


>gi|115523083|ref|YP_779994.1| ATP-dependent Clp protease adaptor [Rhodopseudomonas palustris
           BisA53]
 gi|115517030|gb|ABJ05014.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris BisA53]
          Length = 101

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 51/91 (56%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
            +  +KV  PKL++V+LVND+YTP EFV+ VL+  F    + A  +M+  H +G+    V
Sbjct: 10  TKTRTKVERPKLHKVILVNDDYTPREFVVRVLKAEFRMTEDQAHKVMITAHQRGVCVVAV 69

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +  +IAE K  +  +  R   YPL    E +
Sbjct: 70  FTRDIAETKATRATDAGRAKGYPLLFTTEPE 100


>gi|326793263|ref|YP_004311084.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           lentocellum DSM 5427]
 gi|326544027|gb|ADZ85886.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           lentocellum DSM 5427]
          Length = 99

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 58/96 (60%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              D   +  +KV++PK Y+V++ ND+YT MEFV+ VL   F K    A+ IM+ VH  G
Sbjct: 3   PNHDLNQKIKAKVKLPKQYQVIMFNDDYTTMEFVVEVLTQIFNKSAAEAEKIMMDVHKAG 62

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            G  G+Y+Y+IA  K    M+++++  +P +  +E+
Sbjct: 63  HGVAGIYSYDIAMTKAGTAMSWAKEEGFPFKLSVEE 98


>gi|239907009|ref|YP_002953750.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           magneticus RS-1]
 gi|239796875|dbj|BAH75864.1| ATP-dependent Clp protease adaptor protein ClpS [Desulfovibrio
           magneticus RS-1]
          Length = 119

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 63/100 (63%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
              D      +    +VR P+ ++V+L ND+YT MEFV+ VL + F K+   A  IML V
Sbjct: 19  PMEDEQSGVGLSVEDEVREPRQFKVMLHNDDYTTMEFVVLVLVSVFRKNENEATQIMLNV 78

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H+ G+G CG+Y  E+AE+KV+ V   ++++ YPL+C ME+
Sbjct: 79  HNTGVGVCGIYTAEVAELKVSLVHRLAKENGYPLRCSMEE 118


>gi|209550349|ref|YP_002282266.1| ATP-dependent Clp protease adaptor [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536105|gb|ACI56040.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 103

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 57/102 (55%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++ D  L  + +   K+  PKLY+V+LVND+YTP EFVI +L+  F    ET   +M+ 
Sbjct: 1   MSDNDVALKPKTKVKPKLDKPKLYKVILVNDDYTPREFVIVILKAVFRMSEETGYRVMMT 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H  G     V A +IAE K  + ++ +++  +PL    E +
Sbjct: 61  AHKLGSCVVVVCARDIAETKAKEGIDLAKEMGFPLMFTTEPE 102


>gi|218681500|ref|ZP_03529387.1| ATP-dependent Clp protease adaptor [Rhizobium etli CIAT 894]
          Length = 112

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/101 (34%), Positives = 58/101 (57%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++ D  L  +++   K+  PKLY+V+LVND+YTP EFVI +L++ F    ET   +M+ 
Sbjct: 1   MSDNDVALKPKIKVKPKLDKPKLYKVILVNDDYTPREFVIVILKSVFRMSEETGYKVMMT 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            H  G     V A +IAE K  + ++ +++  +PL    E 
Sbjct: 61  AHKLGSCVVVVCARDIAETKAKEGIDLAKEMGFPLMFTTEP 101


>gi|91975795|ref|YP_568454.1| ATP-dependent Clp protease adaptor [Rhodopseudomonas palustris
           BisB5]
 gi|91682251|gb|ABE38553.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopseudomonas
           palustris BisB5]
          Length = 101

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 50/96 (52%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 +   K+  PKL++V+LVND++TP EFV+ +L+  F    E A  +ML  H +G+
Sbjct: 5   VTKPSTKAKPKLERPKLHKVILVNDDFTPREFVVMILKAEFRMTEEQAYKVMLTAHQRGV 64

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               V+  ++AE K  +  +  R   YPL    E +
Sbjct: 65  CVVAVFTKDVAETKATRATDAGRVKGYPLLFTTEPE 100


>gi|118591833|ref|ZP_01549228.1| ATP-dependent Clp protease adaptor protein ClpS [Stappia aggregata
           IAM 12614]
 gi|118435476|gb|EAV42122.1| ATP-dependent Clp protease adaptor protein ClpS [Stappia aggregata
           IAM 12614]
          Length = 100

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 59/96 (61%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               +++  +KV+ PKLY+V+L+ND+YTP EFV+ +L+  F  D   A+ +M+  H +G+
Sbjct: 5   DFKPKLKQKTKVQRPKLYKVMLLNDDYTPREFVVLILKAEFRLDESQAEVVMMTAHQKGV 64

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               VY  ++AE K  + ++ + +  YPLQ  +E +
Sbjct: 65  CVVSVYPRDVAETKATRAIDAAVRLGYPLQFTVEPE 100


>gi|319781851|ref|YP_004141327.1| ATP-dependent Clp protease adaptor protein ClpS [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317167739|gb|ADV11277.1| ATP-dependent Clp protease adaptor protein ClpS [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 101

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 51/99 (51%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            +       +   +V  PKLY+V+L+ND++TP EFV+ VL+  F    + A  +M+  H 
Sbjct: 2   PEITTKPRTQIKPQVERPKLYKVILINDDFTPREFVVTVLKGEFKLSEDQAHRVMITAHR 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +G+    V+  ++AE K  +  +  +   YPL    E +
Sbjct: 62  RGVCVVAVFTKDVAETKATRATDAGKAKGYPLMFTTEPE 100


>gi|190892773|ref|YP_001979315.1| putative ATP-dependent Clp protease adaptor protein [Rhizobium etli
           CIAT 652]
 gi|190698052|gb|ACE92137.1| putative ATP-dependent Clp protease adaptor protein [Rhizobium etli
           CIAT 652]
          Length = 103

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 57/102 (55%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++ D  L  + +   K+  PKLY+V+LVND+YTP EFVI +L+  F    ET   +M+ 
Sbjct: 1   MSDNDVALKPKTKVEPKLDKPKLYKVILVNDDYTPREFVIAILKIVFRMSEETGYRVMMT 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H  G     V A +IAE K  + ++ +++  +PL    E +
Sbjct: 61  AHKLGSCVVVVCAKDIAETKAKEGIDLAKEMGFPLMFTTEPE 102


>gi|326562900|gb|EGE13187.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis 46P47B1]
 gi|326565261|gb|EGE15446.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis 12P80B1]
 gi|326570971|gb|EGE20995.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis BC7]
 gi|326575834|gb|EGE25757.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis CO72]
 gi|326576916|gb|EGE26822.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis O35E]
          Length = 121

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 54/95 (56%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             D       +V+ PKLY V++ NDNYT M+FV++VL   F  + + A  +M+++H  G 
Sbjct: 26  DTDVITETKIQVKQPKLYTVIMYNDNYTTMDFVVYVLVEIFQHNIDKAYQLMMQIHELGQ 85

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
               +  Y++AEMKV++V   + Q  YPL   +E 
Sbjct: 86  AAVALLPYDLAEMKVDEVTALAEQESYPLLTTIEP 120


>gi|218674100|ref|ZP_03523769.1| ATP-dependent Clp protease adaptor [Rhizobium etli GR56]
 gi|327188355|gb|EGE55572.1| ATP-dependent Clp protease adaptor [Rhizobium etli CNPAF512]
          Length = 103

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 57/102 (55%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++ D  L  + +   K+  PKLY+V+LVND+YTP EFVI +L+  F    ET   +M+ 
Sbjct: 1   MSDNDVALKPKTKVKPKLDKPKLYKVILVNDDYTPREFVIVILKVVFRMSEETGYRVMMT 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H  G     V A +IAE K  + ++ +++  +PL    E +
Sbjct: 61  AHKLGSCVVVVCAKDIAETKAKEGIDLAKEMGFPLMFTTEPE 102


>gi|242309928|ref|ZP_04809083.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pullorum MIT 98-5489]
 gi|239523225|gb|EEQ63091.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pullorum MIT 98-5489]
          Length = 101

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
           P  Y+V+L+ND+YT  +FVI VLQ  F+KD E +  +ML++HH G G CG+Y Y+IAE K
Sbjct: 20  PIRYKVILLNDDYTTQDFVIEVLQKVFHKDFEASLNLMLQIHHNGRGMCGIYPYDIAETK 79

Query: 117 VNQVMNYSRQHQYPLQCIMEQ 137
             +V   ++  Q+PL+ I+E+
Sbjct: 80  ALEVRKMAKAKQFPLRAILEK 100


>gi|254519310|ref|ZP_05131366.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium sp.
           7_2_43FAA]
 gi|226913059|gb|EEH98260.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium sp.
           7_2_43FAA]
          Length = 99

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 57/98 (58%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           +   +   +   K++ PK + V++ ND++T MEFV+ +L + F +  E A  IM++VH  
Sbjct: 2   ETNANILEKIDLKIKKPKKFIVIMHNDDFTTMEFVVAILSDIFNRSIEEANKIMMEVHKN 61

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G G  G+Y Y+IA  K  + M  +++  +P +  +E++
Sbjct: 62  GKGVAGIYPYDIAISKATKAMTLAKEEGFPFKLTVEEE 99


>gi|218460642|ref|ZP_03500733.1| ATP-dependent Clp protease adaptor [Rhizobium etli Kim 5]
 gi|218506911|ref|ZP_03504789.1| ATP-dependent Clp protease adaptor [Rhizobium etli Brasil 5]
          Length = 107

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 57/102 (55%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++ D  L  + +   K+  PKLY+V+LVND+YTP EFVI +L+  F    ET   +M+ 
Sbjct: 5   MSDNDVALKPKTKVKPKLDKPKLYKVILVNDDYTPREFVIVILKVVFRMSEETGYRVMMT 64

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H  G     V A +IAE K  + ++ +++  +PL    E +
Sbjct: 65  AHKLGSCVVVVCAKDIAETKAKEGIDLAKEMGFPLMFTTEPE 106


>gi|183221238|ref|YP_001839234.1| ATP-dependent Clp protease adaptor protein Clp [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
 gi|189911329|ref|YP_001962884.1| hypothetical protein LBF_1799 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|238687770|sp|B0S9H9|CLPS_LEPBA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|238687849|sp|B0SS68|CLPS_LEPBP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|167776005|gb|ABZ94306.1| conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167779660|gb|ABZ97958.1| ATP-dependent Clp protease adaptor protein clp [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 113

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 65/110 (59%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
            S  N+K   +F+  L  + +   K++ P  Y+V+L+ND+YTP EFV++VL   F K  +
Sbjct: 1   MSESNRKSYTDFNVELLEKEKQKKKLKKPDRYKVILINDDYTPQEFVVYVLAVVFRKSMD 60

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            ++ IM + H +G   CGVY+ +IA  KV +V   +    +PLQC + ++
Sbjct: 61  ESRQIMWRAHTEGSAVCGVYSLDIARTKVAEVHKLADDAGHPLQCQLAKE 110


>gi|255321468|ref|ZP_05362626.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           showae RM3277]
 gi|255301324|gb|EET80583.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           showae RM3277]
          Length = 103

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 61/102 (59%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
            A+     + +V    K   P+ ++V+L+ND+ T M+FV+ VL   F+   ++A  +MLK
Sbjct: 2   PAKTATERERDVAIKEKPEFPRKFKVILLNDDVTSMDFVVGVLVEIFHHTAQSAVAVMLK 61

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +H++G G  G+Y  EIA+ K NQ +  +    YPL+ ++E++
Sbjct: 62  IHNEGSGVAGIYNKEIAQTKQNQTLKAAAAAGYPLKAVVEEE 103


>gi|218661878|ref|ZP_03517808.1| ATP-dependent Clp protease adaptor [Rhizobium etli IE4771]
          Length = 107

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 57/102 (55%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++ D  L  + +   K+  PKLY+V+LVND+YTP +FVI +L+  F    ET   +M+ 
Sbjct: 5   MSDNDVALKPKTKVKPKLDKPKLYKVILVNDDYTPRDFVIVILKVVFRMSEETGYRVMMT 64

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H  G     V A +IAE K  + ++ +++  +PL    E +
Sbjct: 65  AHKLGSCVVVVCAKDIAETKAKEGIDLAKEMGFPLMFTTEPE 106


>gi|294672831|ref|YP_003573447.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella
           ruminicola 23]
 gi|294472147|gb|ADE81536.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella
           ruminicola 23]
          Length = 101

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 58/97 (59%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
               ++ R  + +R P+ Y+V + ND++T MEFV+ +L   F+K    A+ +ML+VHH  
Sbjct: 4   EQSATKERQHTNLREPRRYKVTIYNDDFTTMEFVVKILTQVFFKSETEAEALMLQVHHSD 63

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               G+Y+Y++A  KV +  N +R+  +PL+  +E +
Sbjct: 64  KAVVGIYSYDVATSKVRKATNMAREEGFPLRLTVEPE 100


>gi|86358632|ref|YP_470524.1| ATP-dependent Clp protease adaptor [Rhizobium etli CFN 42]
 gi|86282734|gb|ABC91797.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 103

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 57/102 (55%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++ D  L  + +   K+  PKLY+V+LVND+YTP EFVI +L+  F    ET   +M+ 
Sbjct: 1   MSDNDVALKPKTKVRPKLDKPKLYKVILVNDDYTPREFVIVILKVVFRMSEETGYRVMMT 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H  G     V A +IAE K  + ++ +++  +PL    E +
Sbjct: 61  AHKLGSCVVVVCAKDIAETKAKEGIDLAKEMGFPLMFTTEPE 102


>gi|326794631|ref|YP_004312451.1| ATP-dependent Clp protease adapter protein clpS [Marinomonas
           mediterranea MMB-1]
 gi|326545395|gb|ADZ90615.1| ATP-dependent Clp protease adapter protein clpS [Marinomonas
           mediterranea MMB-1]
          Length = 117

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 41/85 (48%), Positives = 62/85 (72%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           ++  P +Y+V+L ND+YTPM+FV+ VLQ FF  D E A+ +ML+VH +G G CGVY + I
Sbjct: 30  ELSPPSMYQVVLFNDDYTPMDFVVFVLQRFFNMDGEKAEQVMLEVHMKGKGVCGVYPFGI 89

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           AE KV QV  + +Q+++PL C +++
Sbjct: 90  AETKVAQVQQFVQQNEHPLMCDLQK 114


>gi|294787951|ref|ZP_06753195.1| ATP-dependent Clp protease adaptor protein ClpS [Simonsiella
           muelleri ATCC 29453]
 gi|294484244|gb|EFG31927.1| ATP-dependent Clp protease adaptor protein ClpS [Simonsiella
           muelleri ATCC 29453]
          Length = 100

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 56/87 (64%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
            +++  PK Y V L+ND+YT MEFV+ +L + F +  E A  +ML++HH G G CGVY  
Sbjct: 12  QNQIAPPKQYGVYLLNDDYTTMEFVVQILMDVFRQPEERAISVMLEIHHHGKGLCGVYTR 71

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ++A+ K +QVM  +    +PL C +E+
Sbjct: 72  DMAQTKQHQVMILAADAGFPLLCTVEE 98


>gi|296113266|ref|YP_003627204.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis RH4]
 gi|295920961|gb|ADG61312.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis RH4]
 gi|326570234|gb|EGE20279.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis BC8]
          Length = 112

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 54/95 (56%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             D       +V+ PKLY V++ NDNYT M+FV++VL   F  + + A  +M+++H  G 
Sbjct: 17  DTDVITETKIQVKQPKLYTVIMYNDNYTTMDFVVYVLVEIFQHNIDKAYQLMMQIHELGQ 76

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
               +  Y++AEMKV++V   + Q  YPL   +E 
Sbjct: 77  AAVALLPYDLAEMKVDEVTALAEQESYPLLTTIEP 111


>gi|288870037|ref|ZP_06112699.2| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           hathewayi DSM 13479]
 gi|288868668|gb|EFD00967.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           hathewayi DSM 13479]
          Length = 111

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 60/110 (54%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M  S  +++G            +   +++ PK Y+V++ ND++TPM+ V+ +L + F K+
Sbjct: 1   MKFSDPDQEGRYSMPANTGLSEKTEIRLKQPKQYKVVMYNDDFTPMDVVVEILIDVFRKN 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME 136
           +E A  IM+ VH       GVY+Y+IA  K  + +  +R+  YP +  +E
Sbjct: 61  YEEAVAIMMTVHKGQRAVVGVYSYDIAMTKAARAVKIAREQGYPFRVEVE 110


>gi|225023808|ref|ZP_03713000.1| hypothetical protein EIKCOROL_00673 [Eikenella corrodens ATCC
           23834]
 gi|224943407|gb|EEG24616.1| hypothetical protein EIKCOROL_00673 [Eikenella corrodens ATCC
           23834]
          Length = 101

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 56/99 (56%), Gaps = 1/99 (1%)

Query: 40  FDNCLDSEVRFSSKVRVPKL-YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
            D           +   P   Y V L+ND+YTPM+FV+ +L + F      A+ +ML+VH
Sbjct: 2   SDTEQALRPEVVRENAPPPKRYGVFLLNDDYTPMDFVVGLLTDIFRLTENRAEAVMLQVH 61

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H+G G CG+Y  +IA+ K  QV N +RQ  +PL  ++E+
Sbjct: 62  HEGKGLCGIYQKDIADTKHQQVQNLARQAGHPLLSMVEE 100


>gi|150018965|ref|YP_001311219.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           beijerinckii NCIMB 8052]
 gi|149905430|gb|ABR36263.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           beijerinckii NCIMB 8052]
          Length = 99

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 61/97 (62%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           +  + ++ +    V+ PK Y+V++ ND+YT MEFVI++L   F K    A+ IML VH +
Sbjct: 2   ETNIVTKPKNKVDVKKPKNYKVVMYNDDYTTMEFVINILVVVFNKKLIDAEKIMLDVHER 61

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G G  G+Y+Y+IA  KV+  M+ +++  +P +  +E+
Sbjct: 62  GKGIAGIYSYDIAVTKVSTAMSMAKEKGFPFKLTVEE 98


>gi|326563659|gb|EGE13911.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis 103P14B1]
 gi|326573267|gb|EGE23235.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis 101P30B1]
          Length = 112

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 55/95 (57%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             D+      +V+ PKLY V++ NDNYT M+FV++VL   F  + + A  +M+++H  G 
Sbjct: 17  DTDAITETKIQVKQPKLYTVIMYNDNYTTMDFVVYVLVEIFQHNIDKAYQLMMQIHELGQ 76

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
               +  Y++AEMKV++V   + Q  YPL   +E 
Sbjct: 77  AAVALLPYDLAEMKVDEVTALAEQESYPLLTTIEP 111


>gi|326560256|gb|EGE10644.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis 7169]
 gi|326566426|gb|EGE16576.1| ATP-dependent Clp protease adaptor protein ClpS [Moraxella
           catarrhalis BC1]
          Length = 121

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 55/95 (57%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             D       +V+ PKLY V++ NDNYT M+FV++VL   F  + + A  +M+++H  G 
Sbjct: 26  DTDVITETKIQVKQPKLYTVIMYNDNYTTMDFVVYVLVEIFQHNIDKAYQLMMQIHELGQ 85

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
               +  Y++AEMKV++V   + Q  YPL  ++E 
Sbjct: 86  AAVALLPYDLAEMKVDEVTALAEQESYPLLTMIEP 120


>gi|291277520|ref|YP_003517292.1| putative ATP-dependent Clp protease adapter protein ClpS
           [Helicobacter mustelae 12198]
 gi|290964714|emb|CBG40569.1| putative ATP-dependent Clp protease adapter protein, ClpS
           [Helicobacter mustelae 12198]
          Length = 100

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 59/85 (69%)

Query: 52  SKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYE 111
           +K+  P +  V+++ND+YTPM+FVI++L + F K+ + A  IML+VHH+G G CG+Y Y+
Sbjct: 14  TKISEPIMASVIILNDDYTPMDFVINILMSVFEKNQDQATQIMLEVHHKGSGVCGIYPYD 73

Query: 112 IAEMKVNQVMNYSRQHQYPLQCIME 136
           IAE+K+      ++  Q PLQ  ++
Sbjct: 74  IAELKLQIAREKTKTAQLPLQLELQ 98


>gi|329961966|ref|ZP_08299977.1| ATP-dependent Clp protease adaptor protein ClpS [Bacteroides fluxus
           YIT 12057]
 gi|328530614|gb|EGF57472.1| ATP-dependent Clp protease adaptor protein ClpS [Bacteroides fluxus
           YIT 12057]
          Length = 102

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 53/96 (55%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               + R  + +R P+ ++V + ND++T MEFV+ +L   F+K    A+ +M+KVH    
Sbjct: 5   QSSYKERERTDLREPRRFKVTIYNDDFTTMEFVVKILTAVFFKSTAEAEALMMKVHESQS 64

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              G+Y Y+IA+ KV +    +R   +PL+  +  +
Sbjct: 65  AVVGIYPYDIAQSKVQKATRMARNEGFPLRLTVTPE 100


>gi|227822866|ref|YP_002826838.1| ATP-dependent Clp protease adaptor [Sinorhizobium fredii NGR234]
 gi|227341867|gb|ACP26085.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           fredii NGR234]
          Length = 103

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 53/102 (51%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++ +     + R   K+  P+LY+V+LVND+YTP +FV+ VL+  F    E    +M+ 
Sbjct: 1   MSDNEVAPKRKTRVKPKLERPRLYKVILVNDDYTPRDFVVMVLKAIFRMSEEAGYRVMMT 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H  G     V A +IAE K  +  +  ++  +PL    E +
Sbjct: 61  AHKLGTSVVVVCARDIAETKAKEATDLGKEAGFPLMFTTEPE 102


>gi|198275274|ref|ZP_03207805.1| hypothetical protein BACPLE_01433 [Bacteroides plebeius DSM 17135]
 gi|198271857|gb|EDY96127.1| hypothetical protein BACPLE_01433 [Bacteroides plebeius DSM 17135]
          Length = 102

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 33/92 (35%), Positives = 58/92 (63%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           + +   ++  PK Y+V+L ND++T M+FV+ VL+  F+K  E A+ +MLKVH Q     G
Sbjct: 9   KEKKRVELHEPKHYKVILHNDDFTTMDFVVKVLKIVFFKSQEEAEALMLKVHQQQSATAG 68

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           VY+Y++A+ K  +    +R+  +PL+  +E +
Sbjct: 69  VYSYDVAQSKAQKATQMAREEGFPLRLTVEPE 100


>gi|83633194|gb|ABC29161.1| uncharacterized conserved protein [Hahella chejuensis KCTC 2396]
          Length = 76

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/74 (45%), Positives = 47/74 (63%)

Query: 64  LVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123
           ++ND+YTPM+FV+ VL  FF      A  +ML VH QG   CGV+  +IAE K  QV  Y
Sbjct: 1   MLNDDYTPMDFVVEVLIRFFNMSEPKATQVMLAVHTQGRAVCGVFTRDIAESKAAQVNQY 60

Query: 124 SRQHQYPLQCIMEQ 137
           S + ++PL C +E+
Sbjct: 61  SSECEHPLLCEIER 74


>gi|294084618|ref|YP_003551376.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664191|gb|ADE39292.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 75

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 59/75 (78%)

Query: 64  LVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123
           ++ND+YTPMEFV+HVLQ+FF +  + A  IML VH +G+G CG+Y++EIAE K ++ M Y
Sbjct: 1   MMNDDYTPMEFVVHVLQHFFGRTADEATQIMLNVHQRGVGICGIYSFEIAETKASKTMEY 60

Query: 124 SRQHQYPLQCIMEQK 138
           +RQ ++PLQ  +E++
Sbjct: 61  ARQKEHPLQLQLEKE 75


>gi|302671436|ref|YP_003831396.1| ATP-dependent Clp protease adaptor protein ClpS [Butyrivibrio
           proteoclasticus B316]
 gi|302395909|gb|ADL34814.1| ATP-dependent Clp protease adaptor protein ClpS [Butyrivibrio
           proteoclasticus B316]
          Length = 99

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 59/96 (61%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
               ++ +  S+++ P+ Y V+++ND++T M+FV+ +L + F+KD  +A+ IML VH  G
Sbjct: 3   TGSQTKEKTGSRIKEPRQYNVIMLNDDFTTMDFVVSILVDIFHKDPVSAEAIMLGVHKSG 62

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
               G Y Y+IA  +VN  +  +++  +P +  +E+
Sbjct: 63  QAVVGKYPYDIAVTRVNNALARAKKEGFPFRMTVEE 98


>gi|241205734|ref|YP_002976830.1| ATP-dependent Clp protease adaptor [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859624|gb|ACS57291.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 103

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 55/102 (53%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++ D  L  + +   K+  PKLY+V+LVND+YTP E VI +L+  F    ET   +M+ 
Sbjct: 1   MSDNDIALKPKTKVKPKLDKPKLYKVILVNDDYTPRELVIMILKAVFRMSEETGYRVMMT 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H  G     V A +IAE K  + ++ ++   YPL    E +
Sbjct: 61  AHKLGSCVVVVCAKDIAETKAKEGIDLAKGMGYPLMFTAEPE 102


>gi|224372651|ref|YP_002607023.1| ATP-dependent Clp protease adaptor protein ClpS [Nautilia
           profundicola AmH]
 gi|254763821|sp|B9L8R5|CLPS_NAUPA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|223589176|gb|ACM92912.1| ATP-dependent Clp protease adaptor protein ClpS [Nautilia
           profundicola AmH]
          Length = 97

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 61/94 (64%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
             + V    ++ +PKLY+V+L+ND+YT  +FVI +L+  F+K+ E A  I LKV  +G  
Sbjct: 3   TKTVVENDVEIIMPKLYKVMLLNDDYTTFDFVIEILKTVFHKNEEEAINITLKVDREGSA 62

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             GVY YEIA++K+ +    +RQ  YPL+ +ME+
Sbjct: 63  AVGVYPYEIAQVKIEKTHTLARQAGYPLRAVMEE 96


>gi|268607890|ref|ZP_06141621.1| ATP-dependent Clp protease adaptor protein ClpS [Ruminococcus
           flavefaciens FD-1]
          Length = 99

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 57/94 (60%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
              + R  S V+ P+LY V+++ND++T MEFV+ VL   F+KD  TA+ IM+ VH  G  
Sbjct: 5   GAVKERSDSMVKEPRLYSVIMINDDFTTMEFVVGVLVEIFHKDEITAQAIMMHVHKNGQA 64

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             G Y Y+IA  +V + +  +++  +P +  +E+
Sbjct: 65  VVGKYPYDIASTRVKKALERAKEEGFPFRMTIEE 98


>gi|221067305|ref|ZP_03543410.1| ATP-dependent Clp protease adaptor protein ClpS [Comamonas
           testosteroni KF-1]
 gi|220712328|gb|EED67696.1| ATP-dependent Clp protease adaptor protein ClpS [Comamonas
           testosteroni KF-1]
          Length = 76

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 51/74 (68%)

Query: 64  LVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123
           ++ND++TPMEFVI VLQ  F KD E+A  IMLK+H  G G CGVY+ ++A  KV QV+  
Sbjct: 1   MLNDDFTPMEFVIAVLQELFGKDRESATQIMLKIHLDGRGVCGVYSQDVAATKVEQVLQA 60

Query: 124 SRQHQYPLQCIMEQ 137
           +++  +PLQ   E 
Sbjct: 61  AQKAGHPLQATFEP 74


>gi|260909905|ref|ZP_05916593.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella sp.
           oral taxon 472 str. F0295]
 gi|260635950|gb|EEX53952.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella sp.
           oral taxon 472 str. F0295]
          Length = 100

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 53/95 (55%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
                 R  + +R P+ Y+VL+ ND++T M+FV+ +L+  F+K    A+ +ML VH    
Sbjct: 5   QEAIRERVHTNIREPRKYKVLIHNDDFTTMDFVVMILKVVFFKTDTEAETLMLTVHRSSQ 64

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
              GVY+Y++A  KV +  + +R   +PL+   + 
Sbjct: 65  AVVGVYSYDVALSKVKKATDMARHAGFPLRLTCQP 99


>gi|307944237|ref|ZP_07659578.1| ATP-dependent Clp protease adaptor protein ClpS [Roseibium sp.
           TrichSKD4]
 gi|307772583|gb|EFO31803.1| ATP-dependent Clp protease adaptor protein ClpS [Roseibium sp.
           TrichSKD4]
          Length = 101

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 55/99 (55%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            D+ L +      K+  PK Y+V+L+ND++TP EFV+ VL+  F  D   A+ +M   H 
Sbjct: 2   SDSDLKTRKSIRQKLERPKRYQVILLNDDFTPAEFVVFVLKGEFRLDVLQAEHVMETAHK 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +G      Y  ++AE KV++    + +  YPL+ I+E +
Sbjct: 62  KGANVVSTYPRDVAETKVSRATETAVRMGYPLKFIVEPE 100


>gi|224535859|ref|ZP_03676398.1| hypothetical protein BACCELL_00723 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522582|gb|EEF91687.1| hypothetical protein BACCELL_00723 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 102

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 55/96 (57%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               + +  + +R P+ ++V++ ND++T MEFV+ +L   F+K    A+ +ML+VH    
Sbjct: 5   QSSFKEKERTDLREPQHFKVIIYNDDFTTMEFVVKILTTIFFKSAAEAETLMLQVHKSQS 64

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              G+Y Y+IA+ KV +    +R+  +PL+  +  +
Sbjct: 65  AVVGIYTYDIAQSKVQKATRMAREENFPLRLTIAPE 100


>gi|15966109|ref|NP_386462.1| ATP-dependent Clp protease adaptor [Sinorhizobium meliloti 1021]
 gi|21542319|sp|Q92N66|CLPS2_RHIME RecName: Full=ATP-dependent Clp protease adapter protein ClpS 2
 gi|15075379|emb|CAC46935.1| Putative ATP-dependent Clp protease adapter protein clpS 2
           [Sinorhizobium meliloti 1021]
          Length = 101

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 53/99 (53%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            DN + ++     K+  PKLY+VLLVND++TP EFV+ VL+  F    E    +M+  H 
Sbjct: 2   SDNDVAAKRLTKPKLERPKLYKVLLVNDDFTPREFVVMVLKAVFRMSEEAGYRVMMTAHK 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            GI    V A ++AE K  +  +  ++  +PL    E +
Sbjct: 62  MGISVVVVCAKDVAETKAKEATDLGKEAGFPLLFTAEPE 100


>gi|323693039|ref|ZP_08107259.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           symbiosum WAL-14673]
 gi|323502920|gb|EGB18762.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           symbiosum WAL-14673]
          Length = 100

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/98 (36%), Positives = 56/98 (57%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               +   +  S+VRVPK Y V++ ND+YTPM+FV+ VL   F K  E A  +M+ VH  
Sbjct: 2   STKGEIRQQTKSQVRVPKRYSVIMHNDDYTPMDFVVRVLMEIFNKRKEEAVMLMMMVHKG 61

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G    G+Y+Y+IA  K+  V   + +  YP +  +E++
Sbjct: 62  GKAVVGMYSYDIALTKIRLVTALAEEEGYPFRLTVEEQ 99


>gi|323485967|ref|ZP_08091299.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           symbiosum WAL-14163]
 gi|323400729|gb|EGA93095.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           symbiosum WAL-14163]
          Length = 100

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/98 (36%), Positives = 56/98 (57%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               +   +  S+VRVPK Y V++ ND+YTPM+FV+ VL   F K  E A  +M+ VH  
Sbjct: 2   STKGEIRQQTKSQVRVPKRYSVIMHNDDYTPMDFVVQVLMEIFNKRKEEAVMLMMMVHKG 61

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G    G+Y+Y+IA  K+  V   + +  YP +  +E++
Sbjct: 62  GKAVVGMYSYDIALTKIRLVTALAEEEGYPFRLTVEEQ 99


>gi|160888888|ref|ZP_02069891.1| hypothetical protein BACUNI_01308 [Bacteroides uniformis ATCC 8492]
 gi|156861787|gb|EDO55218.1| hypothetical protein BACUNI_01308 [Bacteroides uniformis ATCC 8492]
          Length = 103

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               + +   ++R P+ ++V + ND++T MEFV+ VL   FYK    A+ +ML+VH    
Sbjct: 5   QSSFKEKERIELREPRRFKVTIYNDDFTTMEFVVKVLTTVFYKSSAEAETLMLQVHKSNS 64

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              G+Y+Y+IA  KV +    +R   +PL+  +  +
Sbjct: 65  AVVGIYSYDIAHSKVQKATRMARNEGFPLRLTVTPE 100


>gi|223040454|ref|ZP_03610728.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           rectus RM3267]
 gi|222878304|gb|EEF13411.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           rectus RM3267]
          Length = 103

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/98 (35%), Positives = 60/98 (61%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               + +V    K   P+ ++V+L+ND+ T M+FV+ VL   F+   ++A  +MLK+H++
Sbjct: 6   STERERDVALKEKPEFPRKFKVVLLNDDVTSMDFVVSVLVEIFHHTTQSAVTVMLKIHNE 65

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G G  GVYA EIA+ K + V+  +    YPL+ I+E++
Sbjct: 66  GSGIAGVYAKEIAQTKQSDVLKAAAVAGYPLKAIIEEE 103


>gi|307305663|ref|ZP_07585410.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           meliloti BL225C]
 gi|307317666|ref|ZP_07597105.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           meliloti AK83]
 gi|306896824|gb|EFN27571.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           meliloti AK83]
 gi|306902366|gb|EFN32962.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           meliloti BL225C]
          Length = 101

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 52/99 (52%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            DN + ++     K+  PKLY+VLLVND++TP EFV+ VL+  F    E    +M+  H 
Sbjct: 2   SDNDVAAKRLTKPKLERPKLYKVLLVNDDFTPREFVVMVLKAVFRMSEEAGYRVMMTAHK 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            G     V A ++AE K  +  +  ++  +PL    E +
Sbjct: 62  MGTSVVVVCAKDVAETKAKEATDLGKEAGFPLLFTAEPE 100


>gi|116253218|ref|YP_769056.1| ATP-dependent Clp protease adaptor [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115257866|emb|CAK08964.1| putative ATP-dependent CLP protease adaptor protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 103

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/102 (32%), Positives = 55/102 (53%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++ D  L  + +   K+  PKLY+V+LVND+YTP E VI +L+  F+   ET   +M+ 
Sbjct: 1   MSDNDIALKPKAKVKLKLDKPKLYKVILVNDDYTPRELVIMILKAVFHMSEETGYRVMMT 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H  G     V   +IAE K  + ++ ++   +PL    E +
Sbjct: 61  AHKLGSCVVVVCVRDIAETKAKEGIDLAKGMGFPLMFTTEPE 102


>gi|189463818|ref|ZP_03012603.1| hypothetical protein BACINT_00151 [Bacteroides intestinalis DSM
           17393]
 gi|189438768|gb|EDV07753.1| hypothetical protein BACINT_00151 [Bacteroides intestinalis DSM
           17393]
          Length = 102

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 55/96 (57%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               + +  + +R P+ ++V++ ND++T MEFV+ +L   F+K    A+ +ML+VH    
Sbjct: 5   QSSFKEKERTDLREPQHFKVIIFNDDFTTMEFVVKILTTIFFKSAAEAETLMLQVHKSQS 64

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              G+Y Y+IA+ KV +    +R+  +PL+  +  +
Sbjct: 65  AVVGIYTYDIAQSKVQKATRMAREENFPLRLTVAPE 100


>gi|27377747|ref|NP_769276.1| ATP-dependent Clp protease adaptor [Bradyrhizobium japonicum USDA
           110]
 gi|37077101|sp|Q89RX6|CLPS1_BRAJA RecName: Full=ATP-dependent Clp protease adapter protein ClpS 1
 gi|27350892|dbj|BAC47901.1| bll2636 [Bradyrhizobium japonicum USDA 110]
          Length = 101

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/98 (32%), Positives = 50/98 (51%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           D     + R  +KV  PKL++V+L+ND+YTP EFV  +L+  F    + A  +M+  H  
Sbjct: 3   DAVTKPKTRTKTKVERPKLHKVILINDDYTPREFVTMILKAEFRMTEDQAYKVMITAHKL 62

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G     V+  ++AE K  +  +  R   YPL    E +
Sbjct: 63  GACVVAVFTRDVAETKATRATDAGRAKGYPLLFTTEPE 100


>gi|270293657|ref|ZP_06199859.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317479379|ref|ZP_07938513.1| ATP-dependent Clp protease adaptor protein ClpS [Bacteroides sp.
           4_1_36]
 gi|270275124|gb|EFA20984.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316904453|gb|EFV26273.1| ATP-dependent Clp protease adaptor protein ClpS [Bacteroides sp.
           4_1_36]
          Length = 103

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               + +   ++R P+ ++V + ND++T MEFV+ VL   FYK    A+ +ML+VH    
Sbjct: 5   QSSFKEKERIELREPRRFKVTIYNDDFTTMEFVVKVLTTVFYKSSVEAETLMLQVHKSNS 64

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              G+Y+Y+IA  KV +    +R   +PL+  +  +
Sbjct: 65  AVVGIYSYDIAHSKVQKATRMARNEGFPLRLTVTPE 100


>gi|182419260|ref|ZP_02950513.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           butyricum 5521]
 gi|237667653|ref|ZP_04527637.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           butyricum E4 str. BoNT E BL5262]
 gi|182376900|gb|EDT74471.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           butyricum 5521]
 gi|237656001|gb|EEP53557.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium
           butyricum E4 str. BoNT E BL5262]
          Length = 99

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 49/78 (62%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           Y+V++ ND+YT MEFVI +L N F K    A+ IML VH +G G  G+Y+Y+IA  KV  
Sbjct: 21  YKVIMHNDDYTTMEFVIKILVNIFNKSFIDAEKIMLDVHKKGRGVAGIYSYDIAITKVAT 80

Query: 120 VMNYSRQHQYPLQCIMEQ 137
            M+ ++   +P +   E+
Sbjct: 81  AMSMAKSEGFPFKLTTEE 98


>gi|281422658|ref|ZP_06253657.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella copri
           DSM 18205]
 gi|281403328|gb|EFB34008.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella copri
           DSM 18205]
          Length = 100

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 58/97 (59%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
                  R  ++++ P  Y V++ ND++TPM+FV+ +L++ F+K    A+ IMLKVHH+ 
Sbjct: 4   EQTAIRERQKTRLKEPGRYVVMMFNDDFTPMDFVVEILESIFFKSQAEAEAIMLKVHHEE 63

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               G Y+Y+IA+ KV + M  +R  ++PL+     +
Sbjct: 64  KAVVGTYSYDIAKSKVEKAMEKARTQKFPLKLTYMPE 100


>gi|118602881|ref|YP_904096.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|118567820|gb|ABL02625.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 99

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 58/77 (75%)

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
           +VLL+ND+YT MEFVI VL  FF K  E A+  MLK+H +G G CG+++Y+IA+ KV QV
Sbjct: 20  QVLLLNDDYTTMEFVIDVLVQFFSKSEEAAQATMLKIHIEGEGICGIFSYDIAQTKVTQV 79

Query: 121 MNYSRQHQYPLQCIMEQ 137
           + ++R+++ PL C++ +
Sbjct: 80  IEFARKNEQPLICVLRE 96


>gi|212691640|ref|ZP_03299768.1| hypothetical protein BACDOR_01135 [Bacteroides dorei DSM 17855]
 gi|212665829|gb|EEB26401.1| hypothetical protein BACDOR_01135 [Bacteroides dorei DSM 17855]
          Length = 107

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 52/103 (50%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                      + +    +  P+ ++V++ ND++T MEFV+ +L   F+K    A+ +M+
Sbjct: 3   NTNMEQQQSSYKEKERIDLHEPRRFKVIIFNDDFTTMEFVVKILTTVFFKSTMEAEALMI 62

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +VH       G+Y Y+IA  KV +    +R+  +PL+  +  +
Sbjct: 63  QVHKSESAVVGIYTYDIARSKVQKATRMAREEGFPLRLTVTPE 105


>gi|15889508|ref|NP_355189.1| ATP-dependent Clp protease adaptor [Agrobacterium tumefaciens str.
           C58]
 gi|24638422|sp|Q8UD95|CLPS2_AGRT5 RecName: Full=ATP-dependent Clp protease adapter protein ClpS 2
 gi|15157382|gb|AAK87974.1| ATP-dependent Clp protease adaptor protein ClpS [Agrobacterium
           tumefaciens str. C58]
          Length = 103

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 46/85 (54%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +  PKLY+V+L+ND+YTP EFV  VL+  F    +T + +M+  H  G     V   +IA
Sbjct: 18  LERPKLYKVMLLNDDYTPREFVTVVLKAVFRMSEDTGRRVMMTAHRFGSAVVVVCERDIA 77

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQK 138
           E K  +  +  ++  +PL    E +
Sbjct: 78  ETKAKEATDLGKEAGFPLMFTTEPE 102


>gi|325293590|ref|YP_004279454.1| ATP-dependent Clp protease adaptor [Agrobacterium sp. H13-3]
 gi|325061443|gb|ADY65134.1| ATP-dependent Clp protease adaptor [Agrobacterium sp. H13-3]
          Length = 104

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 46/85 (54%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +  PKLY+V+L+ND+YTP +FV  VL+  F+   +T   +M+  H  G     V   +IA
Sbjct: 19  LERPKLYKVILLNDDYTPRDFVTLVLKVVFHMGEDTGHRVMMTAHRFGSAVVVVCERDIA 78

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQK 138
           E K  +  +  ++  +PL    E +
Sbjct: 79  ETKAKEANDLGKEAGFPLMFTTEPE 103


>gi|237711936|ref|ZP_04542417.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237725805|ref|ZP_04556286.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|265753171|ref|ZP_06088740.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|229435613|gb|EEO45690.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229454631|gb|EEO60352.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263236357|gb|EEZ21852.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 102

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 52/96 (54%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               + +    +  P+ ++V++ ND++T MEFV+ +L   F+K    A+ +M++VH    
Sbjct: 5   QSSYKEKERIDLHEPRRFKVIIFNDDFTTMEFVVKILTTVFFKSTMEAEALMMQVHKSES 64

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              G+Y Y+IA  KV +    +R+  +PL+  +  +
Sbjct: 65  AVVGIYTYDIARSKVQKATRMAREEGFPLRLTVTPE 100


>gi|222086600|ref|YP_002545134.1| hypothetical protein Arad_3194 [Agrobacterium radiobacter K84]
 gi|221724048|gb|ACM27204.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 103

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 55/102 (53%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +++ D  L  + +   KV  PKLY+++LVND+YTP EFVI VLQ  F    E    +M+ 
Sbjct: 1   MSDNDVVLKPKTKTKPKVERPKLYKIILVNDDYTPREFVIMVLQAVFRMSEEAGYRVMMT 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H  G     V A +IAE K  + ++ ++   +PL    E +
Sbjct: 61  AHKLGSCVVMVCARDIAETKAQEAIDLAKSADFPLMFTTEPE 102


>gi|87311880|ref|ZP_01093992.1| hypothetical protein DSM3645_04770 [Blastopirellula marina DSM
           3645]
 gi|87285411|gb|EAQ77333.1| hypothetical protein DSM3645_04770 [Blastopirellula marina DSM
           3645]
          Length = 123

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 54/120 (45%), Gaps = 9/120 (7%)

Query: 27  MADSRMNKKGIAEFD---NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF 83
           M + +M K+  A  D      D++    ++ +    Y V+L ND+    +FVI  L+  F
Sbjct: 1   MGEIQMAKQDAAVADAPATQSDTKTDARNQTKRQPPYVVILHNDDINTFDFVIETLRKVF 60

Query: 84  YKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQY------PLQCIMEQ 137
             + E    + + VH QG       A E+AE+KV+Q+ +     Q       PL+  +E 
Sbjct: 61  GYELEKCLQLTINVHKQGRSAIWSGALEVAELKVDQIRSRGADPQMKSKGALPLRVTLEP 120


>gi|262394728|ref|YP_003286582.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sp. Ex25]
 gi|262338322|gb|ACY52117.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sp. Ex25]
          Length = 67

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 47/66 (71%)

Query: 72  MEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPL 131
           M+FVI VL+ FF  D + A  IMLK+H++G   CG Y+ EIAE KV QV  Y+R++++PL
Sbjct: 1   MDFVIEVLERFFSHDIDKATQIMLKIHYEGKAICGTYSAEIAETKVAQVTMYARENEHPL 60

Query: 132 QCIMEQ 137
            C MEQ
Sbjct: 61  LCTMEQ 66


>gi|226330747|ref|ZP_03806265.1| hypothetical protein PROPEN_04667 [Proteus penneri ATCC 35198]
 gi|225201542|gb|EEG83896.1| hypothetical protein PROPEN_04667 [Proteus penneri ATCC 35198]
          Length = 67

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 47/66 (71%)

Query: 72  MEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPL 131
           M+FV+ VL  +F+   E A  IML VHH+G G CGVY+ +IAE KV QV  Y+R+++YPL
Sbjct: 1   MDFVVEVLTMYFFLSEEKATQIMLDVHHKGKGVCGVYSADIAETKVAQVNLYARENEYPL 60

Query: 132 QCIMEQ 137
            C +EQ
Sbjct: 61  LCTLEQ 66


>gi|254884992|ref|ZP_05257702.1| ATP-dependent Clp protease adapter protein clpS [Bacteroides sp.
           4_3_47FAA]
 gi|294776011|ref|ZP_06741507.1| ATP-dependent Clp protease adaptor protein ClpS [Bacteroides
           vulgatus PC510]
 gi|254837785|gb|EET18094.1| ATP-dependent Clp protease adapter protein clpS [Bacteroides sp.
           4_3_47FAA]
 gi|294450149|gb|EFG18653.1| ATP-dependent Clp protease adaptor protein ClpS [Bacteroides
           vulgatus PC510]
          Length = 107

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 52/103 (50%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
                      + +    +R P+ ++V + ND++T MEFV+ +L   F+K    A+ +M+
Sbjct: 3   NTNMEQQQSSYKEKERIDLREPRRFKVTIFNDDFTTMEFVVKILTTVFFKSTMEAEALMM 62

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           +VH       G+Y Y+IA  KV +    +R+  +PL+  +  +
Sbjct: 63  QVHKSESAVIGIYTYDIARSKVQKATRMAREEGFPLRLTVTPE 105


>gi|150397465|ref|YP_001327932.1| ATP-dependent Clp protease adaptor [Sinorhizobium medicae WSM419]
 gi|150028980|gb|ABR61097.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium
           medicae WSM419]
          Length = 101

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 50/99 (50%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHH 99
            +N + ++     K   PKLY+VLLVND+YTP EFV+ VL+  F    E    +M+  H 
Sbjct: 2   SENDVAAKRLTRLKPERPKLYKVLLVNDDYTPREFVVMVLKAIFRMSEEAGYRVMMTAHK 61

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            G     V   ++AE K  +  +  ++  +PL    E +
Sbjct: 62  LGTSVVVVCEKDVAETKAKEATDLGKEAGFPLLFTAEPE 100


>gi|150003219|ref|YP_001297963.1| hypothetical protein BVU_0633 [Bacteroides vulgatus ATCC 8482]
 gi|319640394|ref|ZP_07995118.1| hypothetical protein HMPREF9011_00715 [Bacteroides sp. 3_1_40A]
 gi|149931643|gb|ABR38341.1| conserved hypothetical protein [Bacteroides vulgatus ATCC 8482]
 gi|317387997|gb|EFV68852.1| hypothetical protein HMPREF9011_00715 [Bacteroides sp. 3_1_40A]
          Length = 102

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 52/96 (54%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               + +    +R P+ ++V + ND++T MEFV+ +L   F+K    A+ +M++VH    
Sbjct: 5   QSSYKEKERIDLREPRRFKVTIFNDDFTTMEFVVKILTTVFFKSTMEAEALMMQVHKSES 64

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              G+Y Y+IA  KV +    +R+  +PL+  +  +
Sbjct: 65  AVIGIYTYDIARSKVQKATRMAREEGFPLRLTVTPE 100


>gi|283797982|ref|ZP_06347135.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium sp.
           M62/1]
 gi|291074282|gb|EFE11646.1| ATP-dependent Clp protease adaptor protein ClpS [Clostridium sp.
           M62/1]
 gi|295090086|emb|CBK76193.1| Uncharacterized conserved protein [Clostridium cf. saccharolyticum
           K10]
          Length = 99

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 53/95 (55%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               +     K++ P LY V++ ND++T M+FV+ +L   F+K+HE A  +M+ VH+   
Sbjct: 4   QTGVKEDTKIKLKKPSLYHVVMHNDDFTTMDFVVEILMTIFHKEHEEAVALMMLVHNIQR 63

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
              G Y+Y+IA  K  +    +R+  +P +  +E+
Sbjct: 64  AVVGTYSYDIARTKAEEAEERAREQGFPFRLSVEE 98


>gi|254462423|ref|ZP_05075839.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacterales
           bacterium HTCC2083]
 gi|206679012|gb|EDZ43499.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 67

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/67 (50%), Positives = 50/67 (74%)

Query: 72  MEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPL 131
           MEFV+ +L+ FF  +H  +  IML VH +G+   GV++ EIAE KV QVM+++R+HQ+PL
Sbjct: 1   MEFVVLILERFFGLNHAQSFEIMLTVHQKGVAVVGVFSQEIAETKVGQVMDFARRHQHPL 60

Query: 132 QCIMEQK 138
           QC ME++
Sbjct: 61  QCTMEKE 67


>gi|114214762|emb|CAK51544.1| ATP-dependent Clp protease adaptor protein ClpS [Celosia cristata]
          Length = 134

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 6/86 (6%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
              V   + + VL+ ND    M +V+ V Q  F    E A  +ML VHH+G         
Sbjct: 52  EEVVEPDRPWIVLVWNDPINLMSYVVFVFQKLFGYSREKATSLMLDVHHKGRAVVSSGTR 111

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIME 136
           E AE+ V       R H++ L   ++
Sbjct: 112 EKAELDVF------RLHEHGLWATLQ 131


>gi|39648126|emb|CAE26646.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 78

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 42/76 (55%)

Query: 63  LLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           +LVND+YTP EFV+ VL+  F    + A  +ML  H +G+   GV+  ++AE K  +  +
Sbjct: 2   ILVNDDYTPREFVVSVLKGEFRMTEDQATKVMLTAHQRGVCVVGVFTKDVAETKATRATD 61

Query: 123 YSRQHQYPLQCIMEQK 138
             R   YPL    E +
Sbjct: 62  AGRAKGYPLLFTTEPE 77


>gi|237750929|ref|ZP_04581409.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter bilis
           ATCC 43879]
 gi|229373374|gb|EEO23765.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter bilis
           ATCC 43879]
          Length = 107

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M D++      A F+   + E      +  P++  ++L+ND+YT ++FVI +L   F K 
Sbjct: 1   MPDNKYEYSDSAHFETLHEVE------IAQPRMQEIILLNDDYTSVDFVITLLMRVFNKS 54

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
              A+ I   VH+ G G CGVY Y+IAE+K +   N+ R    PL+ ++
Sbjct: 55  MLDAQTITQFVHNTGEGSCGVYPYDIAELKFSMATNFIRDSGMPLRLVL 103


>gi|262277126|ref|ZP_06054919.1| ATP-dependent Clp protease adaptor protein ClpS [alpha
           proteobacterium HIMB114]
 gi|262224229|gb|EEY74688.1| ATP-dependent Clp protease adaptor protein ClpS [alpha
           proteobacterium HIMB114]
          Length = 100

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/92 (33%), Positives = 63/92 (68%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
           S++ F  + + PK ++++L+ND++T M+FV+ +L  F  K +  A  +MLK+H++G   C
Sbjct: 9   SQLEFREQTKKPKFFKLILLNDDFTTMDFVVKILVMFLNKSNHEANFLMLKIHNEGSAIC 68

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           GV+  ++A    N++ N+S+ ++ PL+CI+++
Sbjct: 69  GVFPKDVAVTIQNKIHNFSKINKQPLKCIVKE 100


>gi|289706343|ref|ZP_06502701.1| ATP-dependent Clp protease adaptor protein ClpS [Micrococcus luteus
           SK58]
 gi|289556838|gb|EFD50171.1| ATP-dependent Clp protease adaptor protein ClpS [Micrococcus luteus
           SK58]
          Length = 120

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 39/118 (33%), Gaps = 6/118 (5%)

Query: 20  ALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL 79
                   A      + +           R        + + V++ ND    M +V +V 
Sbjct: 6   RHDPSAPRAVRPAPGESVPAGATDTALLERPHEDTARDRPWNVVVWNDPVNLMSYVAYVF 65

Query: 80  QNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +  F      A+ +ML+VH +G         E AE+ V         H Y L   +EQ
Sbjct: 66  RTHFGYSAAKAQRLMLEVHERGRSVVATGTKEKAELHV------GAMHGYGLWATLEQ 117


>gi|239917357|ref|YP_002956915.1| hypothetical protein Mlut_08330 [Micrococcus luteus NCTC 2665]
 gi|281414160|ref|ZP_06245902.1| hypothetical protein MlutN2_02986 [Micrococcus luteus NCTC 2665]
 gi|239838564|gb|ACS30361.1| uncharacterized conserved protein [Micrococcus luteus NCTC 2665]
          Length = 120

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 38/118 (32%), Gaps = 6/118 (5%)

Query: 20  ALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL 79
                   A      +             R        + + V++ ND    M +V +V 
Sbjct: 6   RHDPSAPRAVRPAPGESAPAGATDTALLERPHEDTARDRPWNVVVWNDPVNLMSYVAYVF 65

Query: 80  QNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +  F      A+ +ML+VH +G         E AE+ V         H Y L   +EQ
Sbjct: 66  RTHFGYSAAKAQRLMLEVHERGRSVVATGTKEKAELHV------GAMHGYGLWATLEQ 117


>gi|288801352|ref|ZP_06406806.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella sp.
           oral taxon 299 str. F0039]
 gi|288331735|gb|EFC70219.1| ATP-dependent Clp protease adaptor protein ClpS [Prevotella sp.
           oral taxon 299 str. F0039]
          Length = 101

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 56/95 (58%), Gaps = 2/95 (2%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
             + + + K+  P+ Y++L+ ND  T M+FV+H+L + F K+   A  +M+ +H +G   
Sbjct: 7   KVKDKINQKISEPRKYKILMYNDEVTTMDFVVHLLMHVFNKNKAVAYELMMTIHQKGSAL 66

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPL--QCIMEQ 137
            GVY+Y++A+ K+ Q         +PL  +C++++
Sbjct: 67  VGVYSYDVAQTKMEQAKEIIAHSGFPLVIKCLIDK 101


>gi|261210696|ref|ZP_05924988.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sp. RC341]
 gi|260840181|gb|EEX66761.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio sp. RC341]
          Length = 67

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/66 (51%), Positives = 46/66 (69%)

Query: 72  MEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPL 131
           M+FVI +L+ FF  D E A  +MLKVH++G   CG +  E+AE KV QV  YSR++++PL
Sbjct: 1   MDFVIEILERFFSMDIERATQVMLKVHYEGKAICGTFTAEVAETKVAQVTMYSRENEHPL 60

Query: 132 QCIMEQ 137
            C MEQ
Sbjct: 61  LCTMEQ 66


>gi|148925993|ref|ZP_01809679.1| hypothetical protein Cj8486_0964c [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|145845472|gb|EDK22564.1| hypothetical protein Cj8486_0964c [Campylobacter jejuni subsp.
           jejuni CG8486]
          Length = 82

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 50/77 (64%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
            ++    +K+  PK+Y+V+L+ND+ T M+FVI +L N F+++ E A   ML++HH G G 
Sbjct: 3   KTQTLEQTKLSEPKMYKVILLNDDVTTMDFVIEILMNIFHQNLEKASQTMLEIHHNGSGI 62

Query: 105 CGVYAYEIAEMKVNQVM 121
           CG+Y  EIA  K  +V 
Sbjct: 63  CGIYTQEIALSKQKKVN 79


>gi|254456189|ref|ZP_05069618.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083191|gb|EDZ60617.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 95

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/92 (34%), Positives = 53/92 (57%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
           +++  RF +    P LY V+ +ND  T +EF+I VL++ F K+H+ A  +  K+H +G G
Sbjct: 1   MNNSFRFETNFNNPILYEVIFLNDQVTTIEFIIRVLKHIFNKEHKHALKLTRKIHEEGYG 60

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
             G Y YEIA  K  +    +R   +PL+ ++
Sbjct: 61  VVGSYIYEIAGQKELETSLMARDENFPLRVVI 92


>gi|109946679|ref|YP_663907.1| hypothetical protein Hac_0045 [Helicobacter acinonychis str.
           Sheeba]
 gi|109713900|emb|CAJ98908.1| conserved hypothetical protein [Helicobacter acinonychis str.
           Sheeba]
          Length = 91

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 54/85 (63%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           K+ +P +  V+++ND  T  EFVI  L++ F K  E A+ +ML +HH G G CGVY YEI
Sbjct: 5   KIPIPTMSGVIMLNDPVTKAEFVISTLRDVFDKSLEEAQDLMLSIHHNGDGVCGVYPYEI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  K   V + +R  ++PL+ ++++
Sbjct: 65  AIYKAVCVRDKARALKFPLRLMVQE 89


>gi|219848162|ref|YP_002462595.1| ATP-dependent Clp protease adaptor protein ClpS [Chloroflexus
           aggregans DSM 9485]
 gi|219542421|gb|ACL24159.1| ATP-dependent Clp protease adaptor protein ClpS [Chloroflexus
           aggregans DSM 9485]
          Length = 107

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 50/88 (56%), Gaps = 2/88 (2%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
             ++  P  YRV++ ND+ TPM+FV+ VL+ FF  D   A+ +ML  H++G     V  +
Sbjct: 21  DEELERP--YRVIVQNDDVTPMDFVVIVLRVFFGLDLARAEQVMLTAHYEGRALVTVLPF 78

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + A+ +V Q  + +R+  YPL   +E  
Sbjct: 79  QEAQERVYQAHHAAREAGYPLTFYLEPD 106


>gi|317010313|gb|ADU84060.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pylori SouthAfrica7]
          Length = 91

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 54/85 (63%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           K+  P + +V+++ND+ T  EFVI  L++FF K  + AK +ML +H  G G CGVY Y+I
Sbjct: 5   KIPTPTMSQVIMLNDSITTAEFVISALRDFFDKPLKEAKELMLSIHRDGEGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R   +PL+ ++E+
Sbjct: 65  ARYRAACVKDKARALNFPLRLLVEE 89


>gi|315926527|gb|EFV05908.1| ATP-dependent Clp protease adaptor protein ClpS family protein
           [Campylobacter jejuni subsp. jejuni DFVF1099]
          Length = 106

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 50/76 (65%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
            ++    +K+  PK+Y+V+L+ND+ T M+FVI +L N F+++ E A   ML++HH G G 
Sbjct: 3   KTQTLEQTKLSEPKMYKVILLNDDVTTMDFVIEILMNIFHQNLEKASQTMLEIHHNGSGI 62

Query: 105 CGVYAYEIAEMKVNQV 120
           CG+Y  EIA  K  ++
Sbjct: 63  CGIYTQEIALSKQKKL 78


>gi|163848160|ref|YP_001636204.1| ATP-dependent Clp protease adaptor protein ClpS [Chloroflexus
           aurantiacus J-10-fl]
 gi|222526063|ref|YP_002570534.1| ATP-dependent Clp protease adaptor protein ClpS [Chloroflexus sp.
           Y-400-fl]
 gi|163669449|gb|ABY35815.1| ATP-dependent Clp protease adaptor protein ClpS [Chloroflexus
           aurantiacus J-10-fl]
 gi|222449942|gb|ACM54208.1| ATP-dependent Clp protease adaptor protein ClpS [Chloroflexus sp.
           Y-400-fl]
          Length = 108

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 2/97 (2%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
             +   V    ++  P  YRV++ ND+ TPM+FV+ VL+ FF  D   A+ +ML  H++G
Sbjct: 12  PAVSFAVASDEELERP--YRVIVQNDDVTPMDFVVIVLRVFFGLDLARAEQVMLTAHYEG 69

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                V   + A+ +V Q  + +R+  YPL   +E  
Sbjct: 70  RALVTVLPLQEAQERVYQAHHAAREAGYPLTFYLEPD 106


>gi|170782479|ref|YP_001710812.1| atp-dependent Clp protease adaptor protein ClpS [Clavibacter
           michiganensis subsp. sepedonicus]
 gi|169157048|emb|CAQ02221.1| atp-dependent Clp protease adaptor protein ClpS [Clavibacter
           michiganensis subsp. sepedonicus]
          Length = 124

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 39/102 (38%), Gaps = 6/102 (5%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
           G         S+     +   P ++  ++ ND    M +V +V +++F    E A  +ML
Sbjct: 26  GDPGSGTSTGSDTSLLERASTPPVWSCVVWNDPVNLMTYVSYVFRSYFGFTRERADELML 85

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +VH  G         E  E  V  +      H + L   +E+
Sbjct: 86  RVHEDGRAVVATGIREEIERHVLAM------HGFGLWATLER 121


>gi|332180262|gb|AEE15950.1| ATP-dependent Clp protease adapter protein clpS [Treponema
           brennaborense DSM 12168]
          Length = 110

 Score = 97.6 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 59/109 (54%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHE 88
             + N   + E  N +++ V   +++  P+   V L+ND++T  EFV+ VL   F+K  E
Sbjct: 1   MEKQNGNEVRETGNGVEAVVDSYNEIMEPRDCTVFLLNDDFTTKEFVVEVLTAIFHKGTE 60

Query: 89  TAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            A  +M  VH QG    GVYA +IA       +  +R++ +PL+C +E+
Sbjct: 61  EATVLMETVHMQGKAAVGVYARDIAVTLAALTVKTARENGFPLRCELEE 109


>gi|257069152|ref|YP_003155407.1| hypothetical protein Bfae_20090 [Brachybacterium faecium DSM 4810]
 gi|256559970|gb|ACU85817.1| uncharacterized conserved protein [Brachybacterium faecium DSM
           4810]
          Length = 107

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 22/108 (20%), Positives = 41/108 (37%), Gaps = 10/108 (9%)

Query: 34  KKGIAEFDNCLDSEVR----FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET 89
              +   D    S           +     +  ++ ND    M +V+ V + +F   H  
Sbjct: 2   PVDLPRADPGTGSRTDLAGSVQGTLEADGPWCTVVWNDPVNLMSYVVFVFRRYFGYSHLV 61

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A+ +M++VH +G       + E AE  V  +      H + LQ  +E+
Sbjct: 62  AEQLMMQVHEEGRAIVSRGSRERAETDVQAM------HSFGLQATLER 103


>gi|121489819|emb|CAK19331.1| putative adaptor protein ClpS [Physcomitrella patens]
          Length = 155

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 51/129 (39%), Gaps = 7/129 (5%)

Query: 10  YHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNY 69
           ++RV     +   S        +++  I +     +SE     K ++   YRV+L NDN+
Sbjct: 30  HNRVNGRYKINAASGPSQGGGVLDRPTIDKPTPGRESEFDLKKKKKISPPYRVMLHNDNF 89

Query: 70  TPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQ 128
              E+V+ VL         + A  +M + H  G+    V   E AE    Q+    R + 
Sbjct: 90  NKREYVVQVLMKAIPGMTVDIAVNVMNEAHINGLAVVIVCPQEDAEDYCMQL----RTNG 145

Query: 129 YPLQCIMEQ 137
             L   +E 
Sbjct: 146 --LLSSIEP 152


>gi|168702735|ref|ZP_02735012.1| ATP-dependent Clp protease adaptor protein ClpS [Gemmata
           obscuriglobus UQM 2246]
          Length = 110

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 13/116 (11%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           MA++      + E +    +  +          Y V+L ND+   M+FV+ VL+  F   
Sbjct: 1   MANATPTPDVVPEEETETRTRRQ--------PPYAVVLHNDDTNTMDFVVTVLRKVFGYT 52

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYS-----RQHQYPLQCIMEQ 137
            E    +ML+ H QG     + A E+AE+K +Q+ ++       ++ +PL   +E 
Sbjct: 53  VEKCVELMLEAHTQGKVAVWIGALEVAELKADQIKSFGPDPHVTKNGHPLGVTVEP 108


>gi|209523998|ref|ZP_03272550.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira maxima
           CS-328]
 gi|209495670|gb|EDZ95973.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira maxima
           CS-328]
          Length = 117

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 42/104 (40%), Gaps = 7/104 (6%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIM 94
              +      +  + S+  ++   YRVLL ND+Y PME+V+ VL           A  IM
Sbjct: 19  NGGDGSVSTQTVEKTSTNRKLAPRYRVLLHNDDYNPMEYVVQVLMSTVPGLTQPQAVSIM 78

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           ++ H  G+      A E AE     + N      + L   +E  
Sbjct: 79  MEAHTNGLALVITCALEHAEFYCETLKN------HGLTSTIEPD 116


>gi|295115732|emb|CBL36579.1| Uncharacterized conserved protein [butyrate-producing bacterium
           SM4/1]
          Length = 99

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 53/95 (55%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               +     K++ P LY V++ ND++T M+FV+ +L   F+K+HE A  +M+ VH+   
Sbjct: 4   QTGVKEDTKIKLKKPSLYHVVMHNDDFTTMDFVVEILMTIFHKEHEEAVALMMLVHNIQR 63

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
              G Y+Y+IA  +  +    +R+  +P +  +E+
Sbjct: 64  AVVGTYSYDIARTRAEEAEERAREQGFPFRLSVEE 98


>gi|300789536|ref|YP_003769827.1| ATP-dependent Clp protease adaptor protein ClpS [Amycolatopsis
           mediterranei U32]
 gi|299799050|gb|ADJ49425.1| ATP-dependent Clp protease adaptor protein ClpS [Amycolatopsis
           mediterranei U32]
          Length = 99

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 35/100 (35%), Gaps = 6/100 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
                    E   +        +R ++ ND    M +V +V Q  F    + A  +ML V
Sbjct: 4   PVASEQTQVEPAGAEVAESDTPWRTVVWNDPVNLMSYVTYVFQKLFGYSRDHATKLMLDV 63

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H +G       + E  E  V      ++ H   L   MEQ
Sbjct: 64  HQKGKAIVSSGSKEKVETDV------AKLHAAGLWATMEQ 97


>gi|325963805|ref|YP_004241711.1| hypothetical protein Asphe3_24470 [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469892|gb|ADX73577.1| uncharacterized conserved protein [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 127

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 39/111 (35%), Gaps = 7/111 (6%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M  S        E       E    S       + +++ ND    M +V +V Q++F   
Sbjct: 1   MTLSVALGPDTQEGTRTGTVE-STDSLTAPDIPWNLVIWNDPVNLMSYVSYVFQSYFGYS 59

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
              A  +M++VH +G       + E  E     +      H + L   +E+
Sbjct: 60  ESKANKLMMEVHKKGRSIVASGSKEQVERHAVAM------HGFGLWATVEK 104


>gi|307636717|gb|ADN79167.1| ATP-dependent Clp protease adaptor protein [Helicobacter pylori
           908]
 gi|325995303|gb|ADZ50708.1| ATP-dependent Clp protease adaptor protein [Helicobacter pylori
           2018]
 gi|325996901|gb|ADZ49109.1| ATP-dependent Clp protease adaptor protein [Helicobacter pylori
           2017]
          Length = 89

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 55/85 (64%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           ++  P + +V+++ND+ T  EF++  L++FF K  E A+ +ML +H  G G CGVY YEI
Sbjct: 3   QIPTPTMSQVIMLNDSITTAEFMVSALRDFFDKPLEEAQELMLSIHRDGDGVCGVYPYEI 62

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  K   V + +R  ++PL+ ++++
Sbjct: 63  AIYKAVCVRDKARALRFPLRLMVQE 87


>gi|116671131|ref|YP_832064.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrobacter sp.
           FB24]
 gi|116611240|gb|ABK03964.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrobacter sp.
           FB24]
          Length = 122

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 36/97 (37%), Gaps = 6/97 (6%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
                +     +       + +++ ND    M +V +V Q++F      A  +M++VH +
Sbjct: 14  STQTGTVTSTDALTAPDIPWNLVIWNDPVNLMSYVSYVFQSYFGYSEPKANKLMMEVHKK 73

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G       + E  E     +      H + L   +E+
Sbjct: 74  GRSIVAHGSKEQVEQHAVAM------HGFGLWATVEK 104


>gi|255326292|ref|ZP_05367378.1| ATP-dependent Clp protease adaptor protein ClpS [Rothia
           mucilaginosa ATCC 25296]
 gi|255296746|gb|EET76077.1| ATP-dependent Clp protease adaptor protein ClpS [Rothia
           mucilaginosa ATCC 25296]
          Length = 106

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 41/96 (42%), Gaps = 6/96 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              D +    + +     ++V++ ND    M +V +V ++ F      A+ +ML+VH+ G
Sbjct: 14  EDTDLDTALENILATDTPWKVIVWNDPVNLMTYVSYVFRSHFGYSRARAEELMLQVHNNG 73

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
                  + E AE K  Q M     H + L    E+
Sbjct: 74  KAIVFTGSREDAE-KHTQAM-----HAWGLLATFEK 103


>gi|207092784|ref|ZP_03240571.1| hypothetical protein HpylHP_08043 [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 91

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 51/85 (60%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E AK +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAKALTSSIHRDGCGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R  ++PL+ ++E+
Sbjct: 65  ARHRAAWVKDKARALEFPLKLLVEE 89


>gi|308183832|ref|YP_003927965.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pylori SJM180]
 gi|308059752|gb|ADO01648.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pylori SJM180]
 gi|317013455|gb|ADU80891.1| ATP-dependent Clp protease adapter protein ClpS [Helicobacter
           pylori Gambia94/24]
          Length = 91

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 55/85 (64%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           ++  P + +V+++ND+ T  EF++  L++FF K  E A+ +ML +H  G G CGVY YEI
Sbjct: 5   QIPTPTMSQVIMLNDSITTAEFMVSALRDFFDKPLEEAQKLMLSIHRDGDGVCGVYPYEI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  K   V + +R  ++PL+ ++++
Sbjct: 65  AIYKAVCVRDKARALRFPLRLMVQE 89


>gi|269955856|ref|YP_003325645.1| ATP-dependent Clp protease adaptor protein ClpS [Xylanimonas
           cellulosilytica DSM 15894]
 gi|269304537|gb|ACZ30087.1| ATP-dependent Clp protease adaptor protein ClpS [Xylanimonas
           cellulosilytica DSM 15894]
          Length = 106

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 42/100 (42%), Gaps = 6/100 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
           A  D   + E   ++   +   +  ++ ND    M +V +V +++F      A+ +ML+V
Sbjct: 6   AGPDLRTEHETDTAASTSLADPWVTIVWNDPVNLMTYVTYVFESYFGYPPARARTLMLQV 65

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H +G         E  E+ V  +      H + L   M++
Sbjct: 66  HREGRAVVSTGPRERMEVDVQAM------HGFGLWATMQR 99


>gi|208434005|ref|YP_002265671.1| hypothetical protein HPG27_29 [Helicobacter pylori G27]
 gi|208431934|gb|ACI26805.1| hypothetical protein HPG27_29 [Helicobacter pylori G27]
          Length = 91

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 51/85 (60%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E AK +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAKALTSSIHRDGEGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R  ++PL+ ++E+
Sbjct: 65  ARHRAAWVRDKARALEFPLKLLVEE 89


>gi|326538898|gb|ADZ87113.1| ATP-dependent Clp protease adaptor protein ClpS [Brucella
           melitensis M5-90]
          Length = 63

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 53/63 (84%)

Query: 76  IHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
           +HVLQ FF K+ + A  IML VH+ G+GECGV+ YE+AE KV+QVM+++RQ+Q+PLQC+M
Sbjct: 1   MHVLQRFFQKNLDDATRIMLHVHNHGVGECGVFTYEVAETKVSQVMDFARQNQHPLQCVM 60

Query: 136 EQK 138
           E+K
Sbjct: 61  EKK 63


>gi|254503767|ref|ZP_05115918.1| ATP-dependent Clp protease adaptor protein ClpS [Labrenzia
           alexandrii DFL-11]
 gi|222439838|gb|EEE46517.1| ATP-dependent Clp protease adaptor protein ClpS [Labrenzia
           alexandrii DFL-11]
          Length = 77

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 44/76 (57%)

Query: 63  LLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           +L+ND+YTP EFV+ +L+  F  D   A  +ML  H +G     VY  ++AE K  + ++
Sbjct: 2   VLLNDDYTPREFVVLILKGEFRLDSAQADVVMLTAHQKGACVVSVYPKDVAETKATRAID 61

Query: 123 YSRQHQYPLQCIMEQK 138
            + +  YPLQ  +E +
Sbjct: 62  AAGRLGYPLQFSVEPE 77


>gi|302529732|ref|ZP_07282074.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           AA4]
 gi|302438627|gb|EFL10443.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           AA4]
          Length = 102

 Score = 94.9 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 37/100 (37%), Gaps = 6/100 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
                    +   +      + +R ++ ND    M +V +V Q  F    + A  +ML V
Sbjct: 7   PVASEQTQVDPLGAELAESDQPWRTIVWNDPVNLMSYVTYVFQKLFGYSRDHATKLMLDV 66

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H++G       + E  E  V      ++ H   L   MEQ
Sbjct: 67  HNKGRAIVSSGSKEKVETDV------AKLHAAGLWATMEQ 100


>gi|283458302|ref|YP_003362921.1| hypothetical protein RMDY18_12690 [Rothia mucilaginosa DY-18]
 gi|283134336|dbj|BAI65101.1| uncharacterized conserved protein [Rothia mucilaginosa DY-18]
          Length = 106

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 6/96 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              D +    + +     ++V++ ND    M +V ++ ++ F      A+ +ML+VH+ G
Sbjct: 14  EDTDLDTTLENILATDTPWKVIVWNDPVNLMTYVSYIFRSHFGYSRARAEELMLQVHNNG 73

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
                  + E AE K  Q M     H + L    E+
Sbjct: 74  KAIVFTGSREDAE-KHTQAM-----HAWGLLATFEK 103


>gi|271963261|ref|YP_003337457.1| hypothetical protein Sros_1723 [Streptosporangium roseum DSM 43021]
 gi|270506436|gb|ACZ84714.1| conserved hypothetical protein [Streptosporangium roseum DSM 43021]
          Length = 95

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 6/91 (6%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
            R S  VR    +  ++ ND    M +V +V Q+ F    E A+ +ML VH +G      
Sbjct: 10  ERPSIDVRPDLPWLTIVWNDPVNLMSYVTYVFQSVFGYSKEKAEKLMLDVHQKGRAVVSS 69

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              E  E  V  +      H Y L   +++ 
Sbjct: 70  GTREEMERDVQIM------HSYGLWATVQRD 94


>gi|295836847|ref|ZP_06823780.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           SPB74]
 gi|197699546|gb|EDY46479.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           SPB74]
          Length = 102

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 6/94 (6%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           D+E   S       L+  L+ ND    M +V +V Q++F    + A  +ML VH++G   
Sbjct: 13  DAEAESSVVTEPDLLWITLVHNDPVNLMSYVTYVFQSYFGYSKDKATKLMLDVHNKGRAV 72

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               + E  E  V  +      H Y L   ++Q 
Sbjct: 73  VSSGSREEMERDVQAM------HGYGLWATLQQD 100


>gi|296268919|ref|YP_003651551.1| ATP-dependent Clp protease adaptor protein ClpS [Thermobispora
           bispora DSM 43833]
 gi|296091706|gb|ADG87658.1| ATP-dependent Clp protease adaptor protein ClpS [Thermobispora
           bispora DSM 43833]
          Length = 95

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 6/91 (6%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
           +R SS VR  + +  ++ ND    M +V +V Q  F      A+ +M+ VH  G      
Sbjct: 10  IRESSDVRSDRPWLTIVWNDPVNLMSYVTYVFQKVFGYPRPKAEKLMMDVHCNGKAVVAS 69

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              E  E  V  +      H Y L   ++Q 
Sbjct: 70  GTREEMERNVQIL------HSYGLWATVQQD 94


>gi|291571937|dbj|BAI94209.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira
           platensis NIES-39]
          Length = 117

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 42/104 (40%), Gaps = 7/104 (6%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIM 94
              +      +  + S+  ++   YRVLL ND++ PME+V+ VL           A  IM
Sbjct: 19  NGGDGSVSTQTVEKTSTNRKLAPRYRVLLHNDDHNPMEYVVQVLMSTVPGLTQPQAVSIM 78

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           ++ H  G+      A E AE     + N      + L   +E  
Sbjct: 79  MEAHTNGLALVITCALEHAEFYCETLKN------HGLTSTIEPD 116


>gi|117928898|ref|YP_873449.1| ATP-dependent Clp protease adaptor protein ClpS [Acidothermus
           cellulolyticus 11B]
 gi|117649361|gb|ABK53463.1| ATP-dependent Clp protease adaptor protein ClpS [Acidothermus
           cellulolyticus 11B]
          Length = 96

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 41/101 (40%), Gaps = 6/101 (5%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +A+         R  S VR    +  ++ ND    M +V +V Q  F    E A+ +ML+
Sbjct: 1   MADMSTAPVEVERPESDVRPDTPWVTIVWNDPVNLMSYVTYVFQKLFGYPKEKAEKLMLQ 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VH++G         E  E       + +R H + L   + +
Sbjct: 61  VHYEGKAVVSTGRREQME------NDAARLHAHGLWATVRR 95


>gi|33633458|emb|CAE08663.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 154

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 46/133 (34%), Gaps = 9/133 (6%)

Query: 9   MYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKV--RVPKLYRVLLVN 66
              R     +      + + ++               + +  + +   +    Y+VLL N
Sbjct: 27  PESRPSEQVVQRFPLDLNLPNTMAMAVDTPTRSPGGAAVMEKAPERVRKQSPRYKVLLHN 86

Query: 67  DNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSR 125
           D    ME+V+  L Q       + A  +M++ H+ G+G   V   E AE         ++
Sbjct: 87  DPVNTMEYVVTTLRQVVPQLSEQDAMAVMIEAHNTGVGLVIVCDLEPAEFYCE--TLKAK 144

Query: 126 QHQYPLQCIMEQK 138
                L   +E +
Sbjct: 145 ----GLTSTIEPE 153


>gi|220913062|ref|YP_002488371.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrobacter
           chlorophenolicus A6]
 gi|219859940|gb|ACL40282.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrobacter
           chlorophenolicus A6]
          Length = 120

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 38/110 (34%), Gaps = 10/110 (9%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVR----VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
           M        D    +    +            + +++ ND    M +V +V Q++F    
Sbjct: 1   MTISVAPGPDTQEGTRTGTAESTDTLAAPDIPWNLVIWNDPVNLMSYVSYVFQSYFGYSE 60

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             A  +M++VH +G       + E  E     +      H + L   +E+
Sbjct: 61  AKANKLMMEVHKKGRSIVTHGSKEQVERHAVAM------HGFGLWATVEK 104


>gi|119960571|ref|YP_948295.1| ATP-dependent Clp protease adaptor protein clpS [Arthrobacter
           aurescens TC1]
 gi|119947430|gb|ABM06341.1| ATP-dependent Clp protease adaptor protein clpS [Arthrobacter
           aurescens TC1]
          Length = 120

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 41/101 (40%), Gaps = 8/101 (7%)

Query: 39  EFDNCLDSEVRFSSKVRVPK--LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           + D    +  + S+ V       + +++ ND    M +V +V Q++F      A  +M++
Sbjct: 10  DIDERTKAAEQSSTDVLTAPDIPWNLVIWNDPVNLMSYVSYVFQSYFGYSESKAHKLMME 69

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VH +G       + E  E     +      H + L   +E+
Sbjct: 70  VHKKGRSIVAHGSKEQVEQHAVAM------HGFGLWATVEK 104


>gi|254778767|ref|YP_003056872.1| ATP-dependent Clp protease adaptor protein ClpS [Helicobacter
           pylori B38]
 gi|254000678|emb|CAX28587.1| ATP-dependent Clp protease adaptor protein ClpS [Helicobacter
           pylori B38]
          Length = 91

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 51/85 (60%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E AK +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTTEFVISALRDFFDKSLEEAKDLTSSIHRDGEGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R  ++PL+ ++E+
Sbjct: 65  ARHRAAWVKDKARALEFPLKLLVEE 89


>gi|171910264|ref|ZP_02925734.1| ATP-dependent Clp protease adaptor protein ClpS [Verrucomicrobium
           spinosum DSM 4136]
          Length = 98

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 8/103 (7%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
             IA  D     E   S  +  P  + V++ ND    M +V HV++  F    + A+ +M
Sbjct: 2   PSIATPDKQTLVETDPSVALDSP--WHVIIHNDPVNLMSYVAHVIRKIFGYPDKEAQRLM 59

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L+VH +G  +      E AE  V ++      H + L   +E+
Sbjct: 60  LQVHQEGRSQVWTGRREKAEHYVREL------HGHQLLATLEK 96


>gi|306819047|ref|ZP_07452764.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           mulieris ATCC 35239]
 gi|304648240|gb|EFM45548.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           mulieris ATCC 35239]
          Length = 99

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 40/104 (38%), Gaps = 8/104 (7%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
             I   +    S       +  P  +  ++ ND    M +V  V + +F   H+ A+ +M
Sbjct: 2   NSIPGTEYTPSSVAELDRVL--PGQWNTVVWNDAVNLMSYVTWVFKTYFGYSHDRAQTLM 59

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +VH+QG       + E  E  V  +        Y L   +EQ+
Sbjct: 60  KEVHYQGRAVVSAGSREQMEADVLAM------SGYGLWATLEQE 97


>gi|329936567|ref|ZP_08286303.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           griseoaurantiacus M045]
 gi|329304082|gb|EGG47964.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           griseoaurantiacus M045]
          Length = 105

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 38/97 (39%), Gaps = 6/97 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              +S     +       +  ++ ND    M +V +V Q++F    + A  +ML VHH+G
Sbjct: 13  EKTESAEETFAVPEPDLPWVTIVHNDPVNLMSYVTYVFQSYFGYSKDKATKLMLDVHHKG 72

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  + E  E  V  +      H Y L   ++Q 
Sbjct: 73  RAVVSSGSREEMERDVQAM------HGYGLWATLQQD 103


>gi|302761288|ref|XP_002964066.1| hypothetical protein SELMODRAFT_142341 [Selaginella moellendorffii]
 gi|302787370|ref|XP_002975455.1| hypothetical protein SELMODRAFT_150531 [Selaginella moellendorffii]
 gi|300157029|gb|EFJ23656.1| hypothetical protein SELMODRAFT_150531 [Selaginella moellendorffii]
 gi|300167795|gb|EFJ34399.1| hypothetical protein SELMODRAFT_142341 [Selaginella moellendorffii]
          Length = 164

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 51/130 (39%), Gaps = 8/130 (6%)

Query: 10  YHRVKRDGILALMSFIFMADSRMNKKGIAE-FDNCLDSEVRFSSKVRVPKLYRVLLVNDN 68
           + R+     +       +    ++K  I        +SE     K ++   YRV+L NDN
Sbjct: 35  FTRIIASHAVRAALPGGLGGGVLDKPAIETAPTPGRESEFDLRKKKKMAPPYRVILHNDN 94

Query: 69  YTPMEFVIHVLQNF-FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQH 127
           +   E+V+ VL         + A  IM + HH G+    V + E AE    Q+    R +
Sbjct: 95  FNRREYVVQVLMKVIPGMTLDNAVNIMQEAHHNGLSVVIVCSQEDAEEHCTQL----RAN 150

Query: 128 QYPLQCIMEQ 137
              L   +E 
Sbjct: 151 G--LLSSIEP 158


>gi|156743978|ref|YP_001434107.1| ATP-dependent Clp protease adaptor protein ClpS [Roseiflexus
           castenholzii DSM 13941]
 gi|156235306|gb|ABU60089.1| ATP-dependent Clp protease adaptor protein ClpS [Roseiflexus
           castenholzii DSM 13941]
          Length = 109

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              +  V    ++  P  YRV++ ND+ TPM+FV+ VL   F    E +  IML+ HH G
Sbjct: 14  PTTEYVVVTEEELERP--YRVIIENDDVTPMDFVVLVLLTIFELGFEQSVAIMLEAHHNG 71

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                   YE A+ +V +  + +R+  YPL   +E  
Sbjct: 72  RAHVVTLPYEEAQRRVYEAHHAAREAGYPLSFYLEPD 108


>gi|15644665|ref|NP_206834.1| hypothetical protein HP0032 [Helicobacter pylori 26695]
 gi|2495581|sp|P56066|CLPS_HELPY RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|2313107|gb|AAD07101.1| conserved hypothetical protein [Helicobacter pylori 26695]
          Length = 91

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 51/85 (60%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E AK +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTTEFVISALRDFFDKSLEEAKALTSSIHRDGEGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + ++  ++PL+ ++E+
Sbjct: 65  ARHRAAWVRDKAKALEFPLKLLVEE 89


>gi|227875774|ref|ZP_03993902.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           mulieris ATCC 35243]
 gi|269977419|ref|ZP_06184391.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           mulieris 28-1]
 gi|307700310|ref|ZP_07637350.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           mulieris FB024-16]
 gi|227843716|gb|EEJ53897.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           mulieris ATCC 35243]
 gi|269934335|gb|EEZ90897.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           mulieris 28-1]
 gi|307614521|gb|EFN93750.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           mulieris FB024-16]
          Length = 99

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 6/82 (7%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
           P  +  ++ ND    M +V  V + +F   H+ A+ +M +VH+QG       + E  E  
Sbjct: 22  PGQWNTVVWNDAVNLMSYVTWVFKTYFGYSHDRAQTLMKEVHYQGRAVVSAGSREQMEAD 81

Query: 117 VNQVMNYSRQHQYPLQCIMEQK 138
           V  +        Y L   +EQ+
Sbjct: 82  VLAM------SGYGLWATLEQE 97


>gi|86739577|ref|YP_479977.1| ATP-dependent Clp protease adaptor protein ClpS [Frankia sp. CcI3]
 gi|86566439|gb|ABD10248.1| ATP-dependent Clp protease adaptor protein ClpS [Frankia sp. CcI3]
          Length = 119

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 32/91 (35%), Gaps = 6/91 (6%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
                 +   + +  ++ ND    M +V +V Q  F      A  +ML VHH+G     V
Sbjct: 35  EEVDETLDDDRPWVTIVWNDPINLMSYVTYVFQKLFGYSKPKATKLMLDVHHKGRASVAV 94

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              E  E          R H Y L   + Q 
Sbjct: 95  GTREEMEADAE------RLHAYGLWATIAQD 119


>gi|302551734|ref|ZP_07304076.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           viridochromogenes DSM 40736]
 gi|302469352|gb|EFL32445.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           viridochromogenes DSM 40736]
          Length = 105

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 37/95 (38%), Gaps = 6/95 (6%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
            +S     +       +  ++ ND    M +V +V Q +F    + A  +ML VHH+G  
Sbjct: 15  TESAEEVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQTYFGYSKDKATKLMLDVHHKGRA 74

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                + E  E  V  +      H Y L   ++Q 
Sbjct: 75  VVSSGSREEMERDVQAM------HGYGLWATLQQD 103


>gi|297841589|ref|XP_002888676.1| hypothetical protein ARALYDRAFT_894639 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297334517|gb|EFH64935.1| hypothetical protein ARALYDRAFT_894639 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 159

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 41/107 (38%), Gaps = 7/107 (6%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAK 91
           +K  I +     +SE       ++   YRV+L NDN+   E+V+ VL         + A 
Sbjct: 55  DKPIIEKTTPGRESEFDLRKSKKMAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAV 114

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IM + H  G+    V A   AE    Q+          L   +E  
Sbjct: 115 NIMQEAHINGLAVVIVCAQADAEQHCMQLR------GNGLLSSVEPD 155


>gi|168014848|ref|XP_001759963.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162688713|gb|EDQ75088.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 112

 Score = 92.6 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 7/108 (6%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV-LQNFFYKDHETA 90
           M++  I +     +SE     K ++   YRV+L NDN+   E+V+ V L+       + A
Sbjct: 11  MDRPTIDKPTPGRESEFDLKKKKKMSPPYRVMLHNDNFNKREYVVQVLLKAIPGMTVDIA 70

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             +M + H  GI    V   E AE    Q+    R +   L   +E  
Sbjct: 71  VNVMNEAHINGIAVVIVCPQEDAEDYCMQL----RTNG--LLSSIEPD 112


>gi|294629594|ref|ZP_06708154.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           e14]
 gi|292832927|gb|EFF91276.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           e14]
          Length = 105

 Score = 92.6 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 37/97 (38%), Gaps = 6/97 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              +S     +       +  ++ ND    M +V +V Q +F    + A  +ML VHH+G
Sbjct: 13  EKTESAEEVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQTYFGYSKDKATKLMLDVHHKG 72

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  + E  E  V  +      H Y L   ++Q 
Sbjct: 73  RAVVSSGSREEMERDVQAM------HGYGLWATLQQD 103


>gi|29831702|ref|NP_826336.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           avermitilis MA-4680]
 gi|37076982|sp|Q82D28|CLPS_STRAW RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|29608818|dbj|BAC72871.1| putative ATP-dependent Clp protease adaptor protein [Streptomyces
           avermitilis MA-4680]
          Length = 105

 Score = 92.6 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 36/97 (37%), Gaps = 6/97 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              +S     +       +  ++ ND    M +V +V Q +F    + A  +ML VHH+G
Sbjct: 13  EKTESAEEVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQTYFGYSKDKATKLMLDVHHKG 72

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                    E  E  V  +      H Y L   ++Q 
Sbjct: 73  RAVVSSGTREEMERDVQAM------HGYGLWATLQQD 103


>gi|309791687|ref|ZP_07686179.1| ATP-dependent Clp protease adaptor protein ClpS [Oscillochloris
           trichoides DG6]
 gi|308226309|gb|EFO80045.1| ATP-dependent Clp protease adaptor protein ClpS [Oscillochloris
           trichoides DG6]
          Length = 107

 Score = 92.6 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 2/97 (2%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
             L   V     +  P  YRV++ ND+ TPM+FV+ VL+ FF      A  +ML  HHQG
Sbjct: 12  PDLTFIVANREDLEKP--YRVIVENDDVTPMDFVVMVLRLFFGLALNDAMQVMLTAHHQG 69

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                   +E A+ +V      +R+  YPL   +E  
Sbjct: 70  RALVTTMPFEEAKERVYSAHTVAREEGYPLTFYLEPD 106


>gi|18409086|ref|NP_564937.1| unknown protein [Arabidopsis thaliana]
 gi|5734712|gb|AAD49977.1|AC008075_10 ESTs gb|T41781 and gb|AA586096 come from this gene [Arabidopsis
           thaliana]
 gi|12484207|gb|AAG54002.1|AF336921_1 unknown protein [Arabidopsis thaliana]
 gi|15010628|gb|AAK73973.1| At1g68660/F24J5_4 [Arabidopsis thaliana]
 gi|21464569|gb|AAM52239.1| At1g68660/F24J5_4 [Arabidopsis thaliana]
 gi|21553930|gb|AAM63011.1| unknown [Arabidopsis thaliana]
 gi|332196703|gb|AEE34824.1| ATP-dependent Clp protease adaptor protein ClpS [Arabidopsis
           thaliana]
          Length = 159

 Score = 92.6 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 46/121 (38%), Gaps = 7/121 (5%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           L+  + +      ++K  I +     +SE       ++   YRV+L NDN+   E+V+ V
Sbjct: 41  LSTSAALGKGGGVLDKPIIEKTTPGRESEFDLRKSKKIAPPYRVILHNDNFNKREYVVQV 100

Query: 79  LQNF-FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L         + A  IM + H  G+    V A   AE    Q+          L   +E 
Sbjct: 101 LMKVIPGMTVDNAVNIMQEAHINGLAVVIVCAQADAEQHCMQLR------GNGLLSSVEP 154

Query: 138 K 138
            
Sbjct: 155 D 155


>gi|317011887|gb|ADU82495.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pylori Lithuania75]
          Length = 91

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E AK +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTTEFVISALRDFFDKSLEEAKALTSSIHRDGCGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +V  V + +R+   PL+ ++E+
Sbjct: 65  ARHRVAWVRDKARELDLPLKLLVEE 89


>gi|291439367|ref|ZP_06578757.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           ghanaensis ATCC 14672]
 gi|291342262|gb|EFE69218.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           ghanaensis ATCC 14672]
          Length = 105

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 36/95 (37%), Gaps = 6/95 (6%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
            +S     +       +  ++ ND    M +V +V Q +F    + A  +ML VHH+G  
Sbjct: 15  TESAEEVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQTYFGYSKDKATKLMLDVHHKGRA 74

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  E  E  V  +      H Y L   ++Q 
Sbjct: 75  IVSSGTREEMERDVQAM------HGYGLWATLQQD 103


>gi|317008709|gb|ADU79289.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pylori India7]
          Length = 91

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E AK +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMVQVIMVDDPITTAEFVISALRDFFDKSLEEAKDLTSSIHRDGCGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +V  V + +R+   PL+ ++E+
Sbjct: 65  ARHRVAWVRDKARELDLPLKLLVEE 89


>gi|297379256|gb|ADI34143.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pylori v225d]
          Length = 91

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 51/85 (60%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E A+ +   +H  G G CGVY Y+I
Sbjct: 5   DIPTPTMVQVIMVDDPITTAEFVISALRDFFDKSLEEAQALTSSIHRDGEGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +V  V + +R+   PL+ ++E+
Sbjct: 65  ARHRVAWVRDKARELDLPLKLLVEE 89


>gi|317124454|ref|YP_004098566.1| ATP-dependent Clp protease adaptor protein ClpS [Intrasporangium
           calvum DSM 43043]
 gi|315588542|gb|ADU47839.1| ATP-dependent Clp protease adaptor protein ClpS [Intrasporangium
           calvum DSM 43043]
          Length = 107

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 19/112 (16%), Positives = 33/112 (29%), Gaps = 6/112 (5%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M+ S              +        V     +  ++ ND    M +V  V + +F   
Sbjct: 1   MSTSLSLAPPAPVRSPETEEVTGTDDLVAPDVPWVTIVWNDPVNLMSYVTWVFETYFGYP 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              A+ +M+ VH +G         E  E     +        Y L    E+ 
Sbjct: 61  RPKAEKLMMDVHTKGRAVVSHGPRESMERDAESLQ------GYGLWATFEKD 106


>gi|225423913|ref|XP_002281884.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|147853628|emb|CAN80233.1| hypothetical protein VITISV_037190 [Vitis vinifera]
          Length = 157

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 48/124 (38%), Gaps = 7/124 (5%)

Query: 15  RDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEF 74
           R  ++A+ +        + +  I +     +SE       ++   YRV+L NDNY   E+
Sbjct: 35  RSFLMAISASGPGKGGLLERPVIEKVTPGRESEFDLRKSRKIAPPYRVILHNDNYNKREY 94

Query: 75  VIHVLQNF-FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQC 133
           V+ VL         + A  IM + H+ G+    + A   AE    Q+          L  
Sbjct: 95  VVQVLMKVIPGMTLDNAVNIMQEAHYNGLSVVIICAQADAEDHCMQLR------GNGLLS 148

Query: 134 IMEQ 137
            +E 
Sbjct: 149 SIEP 152


>gi|188526842|ref|YP_001909529.1| hypothetical protein HPSH_00160 [Helicobacter pylori Shi470]
 gi|188143082|gb|ACD47499.1| hypothetical protein HPSH_00160 [Helicobacter pylori Shi470]
 gi|308062902|gb|ADO04789.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pylori Sat464]
          Length = 91

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 50/85 (58%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E A+ +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAQALTSNIHRDGEGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R+   PL+ ++E+
Sbjct: 65  ARHRAAWVRDKARELDLPLKLLVEE 89


>gi|261838675|gb|ACX98441.1| hypothetical protein KHP_1249 [Helicobacter pylori 51]
 gi|317179574|dbj|BAJ57362.1| hypothetical protein HPF30_1265 [Helicobacter pylori F30]
          Length = 91

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 50/85 (58%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E A+ +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAQALTSSIHRDGEGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R+   PL+ ++E+
Sbjct: 65  ARHRAAWVRDKARELDLPLKLLVEE 89


>gi|238063125|ref|ZP_04607834.1| ATP-dependent Clp protease adaptor protein clpS [Micromonospora sp.
           ATCC 39149]
 gi|237884936|gb|EEP73764.1| ATP-dependent Clp protease adaptor protein clpS [Micromonospora sp.
           ATCC 39149]
          Length = 96

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 37/100 (37%), Gaps = 8/100 (8%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
            +       +         P  +  ++ +D    M +V  V Q  F    E A+ +ML V
Sbjct: 4   PQVAPVETPDTEEVPVSDRP--WVTIVWDDPVNLMSYVTWVFQKLFGYSRERAEKLMLDV 61

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           HH+G       A E  E       + ++ H Y L   +E+
Sbjct: 62  HHKGRAVVSTGARERME------HDAAQLHAYGLWATVER 95


>gi|207110450|ref|ZP_03244612.1| hypothetical protein HpylH_15368 [Helicobacter pylori
           HPKX_438_CA4C1]
          Length = 82

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 47/80 (58%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E AK +   +H  G G CGVY Y+I
Sbjct: 3   NIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAKALTSSIHRDGCGVCGVYPYDI 62

Query: 113 AEMKVNQVMNYSRQHQYPLQ 132
           A  +   V + +R  ++PL+
Sbjct: 63  ARHRAAWVKDKARALEFPLK 82


>gi|72162771|ref|YP_290428.1| ATP-dependent Clp protease adaptor protein ClpS [Thermobifida fusca
           YX]
 gi|71916503|gb|AAZ56405.1| conserved hypothetical protein [Thermobifida fusca YX]
          Length = 96

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 36/92 (39%), Gaps = 6/92 (6%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E R    +R    +  ++ ND    M +V +V Q  F      A+ +M  VH++G     
Sbjct: 10  EPRIGEDIRPDLPWVTIVWNDPVNLMSYVTYVFQKVFGYPKAKAQKLMEDVHYKGKAVVS 69

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               E  E  V  +      HQY L   ++Q 
Sbjct: 70  SGTREEMERYVTIL------HQYGLWATLQQD 95


>gi|159899721|ref|YP_001545968.1| ATP-dependent Clp protease adaptor protein ClpS [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159892760|gb|ABX05840.1| ATP-dependent Clp protease adaptor protein ClpS [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 113

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 2/100 (2%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
             D  LD       ++  P  YRV+L ND+ TPME V+ VL+  F +  E AK IM++ H
Sbjct: 15  TTDVELDFITLSDEELEKP--YRVILQNDDITPMEVVVWVLEKVFEQSFEQAKRIMIEAH 72

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +G     +  ++ A  +V    + +R   +PL   +E  
Sbjct: 73  VKGHALVTILPFKEASARVYSAQSRARDMGFPLVLFLEPD 112


>gi|108562455|ref|YP_626771.1| hypothetical protein HPAG1_0030 [Helicobacter pylori HPAG1]
 gi|107836228|gb|ABF84097.1| hypothetical protein HPAG1_0030 [Helicobacter pylori HPAG1]
          Length = 91

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 50/85 (58%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E AK +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTAEFVISALKDFFDKSLEEAKALTSSIHRDGCGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R+   PL+ ++E+
Sbjct: 65  ARHRAAWVRDKARELDLPLKLLVEE 89


>gi|148272450|ref|YP_001222011.1| putative ATP-dependent Clp protease adaptor protein [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
 gi|147830380|emb|CAN01315.1| putative ATP-dependent Clp protease adaptor protein [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
          Length = 124

 Score = 91.8 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 39/102 (38%), Gaps = 6/102 (5%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
           G         S+     +   P ++  ++ ND    M +V +V +++F    E A  +ML
Sbjct: 26  GDPGSGTRTGSDTSLLERASTPPVWSCVVWNDPVNLMTYVSYVFRSYFGFPRERADELML 85

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +VH  G         E  E  V  +      H Y L   +E+
Sbjct: 86  RVHEDGRAVVATGIREEIERHVLAM------HVYGLWATLER 121


>gi|298345219|ref|YP_003717906.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           curtisii ATCC 43063]
 gi|304390779|ref|ZP_07372731.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           curtisii subsp. curtisii ATCC 35241]
 gi|315655641|ref|ZP_07908539.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           curtisii ATCC 51333]
 gi|315656444|ref|ZP_07909333.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           curtisii subsp. holmesii ATCC 35242]
 gi|298235280|gb|ADI66412.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           curtisii ATCC 43063]
 gi|304325662|gb|EFL92908.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           curtisii subsp. curtisii ATCC 35241]
 gi|315489705|gb|EFU79332.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           curtisii ATCC 51333]
 gi|315493003|gb|EFU82605.1| ATP-dependent Clp protease adaptor protein ClpS [Mobiluncus
           curtisii subsp. holmesii ATCC 35242]
          Length = 100

 Score = 91.8 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 35/82 (42%), Gaps = 6/82 (7%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
           P  +  ++ ND    M +V  V + +F   HE A+ +M +VH +G         E  E  
Sbjct: 23  PGQWNTVVWNDAVNLMSYVTWVFKTYFGYSHERAEHLMKEVHFKGRAVVSAGTREQMEAD 82

Query: 117 VNQVMNYSRQHQYPLQCIMEQK 138
           V  +       +Y L   +EQ+
Sbjct: 83  VLAM------SEYGLWATLEQE 98


>gi|297200007|ref|ZP_06917404.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           sviceus ATCC 29083]
 gi|197710480|gb|EDY54514.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           sviceus ATCC 29083]
          Length = 105

 Score = 91.8 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 37/95 (38%), Gaps = 6/95 (6%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
            +S     +       +  ++ ND    M +V +V Q +F    + A  +ML VHH+G  
Sbjct: 15  TESAEEVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQTYFGYSKDKATKLMLDVHHKGRA 74

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                + E  E  V  +      H Y L   ++Q 
Sbjct: 75  VVSSGSREEMERDVQAM------HGYGLWATLQQD 103


>gi|21221363|ref|NP_627142.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           coelicolor A3(2)]
 gi|289771355|ref|ZP_06530733.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           lividans TK24]
 gi|5531365|emb|CAB50997.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)]
 gi|289701554|gb|EFD68983.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           lividans TK24]
          Length = 105

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 38/97 (39%), Gaps = 6/97 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              +S     +       +  ++ ND    M +V +V Q++F    + A  +M+ VHH+G
Sbjct: 13  EKTESAEEVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQSYFGYSKDKATKLMMDVHHKG 72

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  + E  E  V  +      H Y L   ++Q 
Sbjct: 73  RAVVSSGSREEMERDVQAM------HGYGLWATLQQD 103


>gi|210134229|ref|YP_002300668.1| ATP-dependent clp protease adapter protein ClpS [Helicobacter
           pylori P12]
 gi|210132197|gb|ACJ07188.1| ATP-dependent clp protease adapter protein ClpS [Helicobacter
           pylori P12]
          Length = 91

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 49/81 (60%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
           P + +V++V+D  T  EFVI  L++FF K  E AK +   +H  G G CGVY Y+IA  +
Sbjct: 9   PTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAKALTSSIHRDGCGVCGVYPYDIARHR 68

Query: 117 VNQVMNYSRQHQYPLQCIMEQ 137
              V + +R+   PL+ ++E+
Sbjct: 69  AAWVRDKARELDLPLKLLVEE 89


>gi|317182602|dbj|BAJ60386.1| hypothetical protein HPF57_1312 [Helicobacter pylori F57]
          Length = 91

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 50/85 (58%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E A+ +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMVQVIMVDDPITTAEFVISALRDFFDKSLEEAQALTSSIHRDGEGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R+   PL+ ++E+
Sbjct: 65  ARHRAAWVRDKARELDLPLKLLVEE 89


>gi|15611099|ref|NP_222750.1| hypothetical protein jhp0028 [Helicobacter pylori J99]
 gi|12230796|sp|Q9ZN32|CLPS_HELPJ RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|4154533|gb|AAD05612.1| putative [Helicobacter pylori J99]
          Length = 90

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 54/85 (63%), Gaps = 1/85 (1%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           ++  P + +V+++ND+ T  EF++  L++FF K  E A+ +ML +H  G G CGVY YEI
Sbjct: 5   QIPTPTMSQVIMLNDSITTAEFMVSALRDFFDKPLEEAQKLMLSIHRDGDGVCGVYPYEI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  K   V + +R   +PL+ ++++
Sbjct: 65  AIYKAVCVRDKARAR-FPLRLMVQE 88


>gi|308182216|ref|YP_003926343.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pylori PeCan4]
 gi|308064401|gb|ADO06293.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pylori PeCan4]
          Length = 91

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 50/85 (58%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E AK +   +H  G G CGVY Y+I
Sbjct: 5   DIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAKALTSSIHRDGCGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R+   PL+ ++E+
Sbjct: 65  ARHRAAWVRDKARELDLPLKLLVEE 89


>gi|254774371|ref|ZP_05215887.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           avium subsp. avium ATCC 25291]
          Length = 102

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 40/107 (37%), Gaps = 6/107 (5%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+     +       +   + +      +  ++ +D    M +V +V Q  F      A 
Sbjct: 1   MSAPTEPKSRPGTTGQRESAPEEVTASPWVTIVWDDPVNLMTYVTYVFQKLFGYSEPHAT 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +ML+VH++G       + E  E+ V      S+ H   L   M+Q 
Sbjct: 61  KLMLQVHNEGKAVVSAGSREAMEVDV------SKLHAAGLWATMQQD 101


>gi|308061334|gb|ADO03222.1| ATP-dependent Clp protease adapter protein clpS [Helicobacter
           pylori Cuz20]
          Length = 91

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 50/85 (58%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E A+ +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAQALTSSIHRDGEGICGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R+   PL+ ++E+
Sbjct: 65  ARHRAAWVRDKARELDLPLKLLVEE 89


>gi|317178096|dbj|BAJ55885.1| hypothetical protein HPF16_1288 [Helicobacter pylori F16]
          Length = 93

 Score = 91.4 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 50/85 (58%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E A+ +   +H  G G CGVY Y+I
Sbjct: 7   NIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAQALTSSIHRDGEGVCGVYPYDI 66

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R+   PL+ ++E+
Sbjct: 67  ARHRAAWVRDKARELDLPLKLLVEE 91


>gi|224111728|ref|XP_002315955.1| predicted protein [Populus trichocarpa]
 gi|222864995|gb|EEF02126.1| predicted protein [Populus trichocarpa]
          Length = 162

 Score = 91.4 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 39/106 (36%), Gaps = 7/106 (6%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAK 91
            K  I       +SE       ++   YRV+L NDNY   E+V+ VL         + A 
Sbjct: 58  EKPVIERTTPGRESEFDLRKSKKMAPPYRVILHNDNYNKREYVVQVLMKVIPGMTLDNAV 117

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IM + H+ G+    +     AE    Q+          L   +E 
Sbjct: 118 NIMQEAHYNGLSVVIICTQADAEEHCMQLR------GNGLLSSIEP 157


>gi|239930995|ref|ZP_04687948.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           ghanaensis ATCC 14672]
          Length = 102

 Score = 91.4 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 36/95 (37%), Gaps = 6/95 (6%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
            +S     +       +  ++ ND    M +V +V Q +F    + A  +ML VHH+G  
Sbjct: 12  TESAEEVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQTYFGYSKDKATKLMLDVHHKGRA 71

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  E  E  V  +      H Y L   ++Q 
Sbjct: 72  IVSSGTREEMERDVQAM------HGYGLWATLQQD 100


>gi|257056896|ref|YP_003134728.1| hypothetical protein Svir_29230 [Saccharomonospora viridis DSM
           43017]
 gi|256586768|gb|ACU97901.1| uncharacterized conserved protein [Saccharomonospora viridis DSM
           43017]
          Length = 94

 Score = 91.4 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 6/82 (7%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
             + ++ ++ ND    M +V +V Q  F    E A  +ML VHH+G         E  E 
Sbjct: 18  EDRPWQTIVWNDPVNLMSYVTYVFQKIFGYSKEHATKLMLDVHHKGRAVVSSGTKEKVEG 77

Query: 116 KVNQVMNYSRQHQYPLQCIMEQ 137
            V      ++ H   L   MEQ
Sbjct: 78  DV------AKLHAAGLWATMEQ 93


>gi|261840072|gb|ACX99837.1| ATP-dependent Clp protease adaptor protein ClpS [Helicobacter
           pylori 52]
          Length = 91

 Score = 91.4 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 49/85 (57%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E A+ +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAQALTSSIHRDGEGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R+   PL+  +E+
Sbjct: 65  ARHRAAWVRDKARELDLPLKLWVEE 89


>gi|317181079|dbj|BAJ58865.1| hypothetical protein HPF32_1283 [Helicobacter pylori F32]
          Length = 91

 Score = 91.4 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 50/85 (58%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E AK +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAKALTSSIHRDGEGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R+   PL+ ++E+
Sbjct: 65  ARHRAAWVRDKARELDLPLKLLVEE 89


>gi|148656369|ref|YP_001276574.1| ATP-dependent Clp protease adaptor protein ClpS [Roseiflexus sp.
           RS-1]
 gi|148568479|gb|ABQ90624.1| ATP-dependent Clp protease adaptor protein ClpS [Roseiflexus sp.
           RS-1]
          Length = 113

 Score = 91.4 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/112 (27%), Positives = 53/112 (47%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           MA     +  +        +E    ++  + + YRV++ ND+ TPM+FV+ +L   F   
Sbjct: 1   MATHMPAEVSVPLTTTIPTTEYVVVTEDELERPYRVIIENDDVTPMDFVVLILLTIFELG 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            E +  IML+ HH G        YE A+ +V +  + +R+  YPL   +E  
Sbjct: 61  FEQSVAIMLEAHHNGRAHVVTLPYEEAQRRVYEAHHAAREAGYPLSFYLEPD 112


>gi|290960033|ref|YP_003491215.1| ATP-dependent Clp protease adaptor protein [Streptomyces scabiei
           87.22]
 gi|260649559|emb|CBG72674.1| putative ATP-dependent Clp protease adaptor protein [Streptomyces
           scabiei 87.22]
          Length = 105

 Score = 91.4 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 37/97 (38%), Gaps = 6/97 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              +S     +       +  ++ ND    M +V +V Q +F    E A  +ML VHH+G
Sbjct: 13  EKTESAEETFAVPEPDVPWLTIVHNDPVNLMSYVTYVFQAYFGYSKEKANKLMLDVHHKG 72

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  + E  E  V  +      H Y L   ++Q 
Sbjct: 73  RAVVSSGSREEMERDVQAM------HGYGLWATLQQD 103


>gi|294460817|gb|ADE75982.1| unknown [Picea sitchensis]
          Length = 158

 Score = 91.4 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 41/106 (38%), Gaps = 7/106 (6%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAK 91
            +  I +     +SE       +    YRVLL NDNY   E+V+ VL         +TA 
Sbjct: 54  ERPTIEKTTPGRESEFDLRKSRKTSPPYRVLLHNDNYNKREYVVQVLMKVIPGMTLDTAV 113

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IM + H+ G+    + A   AE    Q+          L   +E 
Sbjct: 114 NIMQEAHYNGLAVVIICAQVDAEEHCTQLR------GNGLLSSIEP 153


>gi|328882719|emb|CCA55958.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           venezuelae ATCC 10712]
          Length = 101

 Score = 91.0 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 38/95 (40%), Gaps = 6/95 (6%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
            +S    S+ V     +  L+ ND    M +V +V Q++F    + A  +ML VH++G  
Sbjct: 11  TESAEEVSAVVEPDVPWVTLVHNDPVNLMSYVTYVFQSYFGYSKDKAHKLMLDVHNKGRA 70

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  E  E  V  +      H Y L   + Q 
Sbjct: 71  VVSSGTREEMERDVQAM------HGYGLWATLSQD 99


>gi|315587247|gb|ADU41628.1| ATP-dependent Clp protease adaptor protein ClpS [Helicobacter
           pylori 35A]
          Length = 91

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 50/85 (58%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E A+ +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAQALTSSIHRDGEGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +++   PL+ ++E+
Sbjct: 65  ARHRAAWVRDKAKELDLPLRLLVEE 89


>gi|260906183|ref|ZP_05914505.1| ATP-dependent Clp protease adaptor protein ClpS [Brevibacterium
           linens BL2]
          Length = 101

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 37/98 (37%), Gaps = 6/98 (6%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
              L+ EV         K ++ ++ ND    M +V +V Q +F    E A  +ML+VH  
Sbjct: 6   TPVLEPEVDIRPVTEQAKPWKTVVFNDPVNLMSYVSYVFQAYFGYSTEKAHSLMLEVHEN 65

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G         E  E     +      H+Y L    + +
Sbjct: 66  GRSVVATGGREAMERDTQAM------HEYGLWAACQPE 97


>gi|302521553|ref|ZP_07273895.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           SPB78]
 gi|302430448|gb|EFL02264.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           SPB78]
          Length = 102

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 39/94 (41%), Gaps = 6/94 (6%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           D+E    +       +  L+ ND    M +V +V Q++F    + A  +ML VH++G   
Sbjct: 13  DAEAESFAVAEPDLPWITLVHNDPVNLMSYVTYVFQSYFGYSKDKATKLMLDVHNKGRAV 72

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               + E  E  V  +      H Y L   ++Q 
Sbjct: 73  VSSGSREEMERDVQAM------HGYGLWATLQQD 100


>gi|41408527|ref|NP_961363.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           avium subsp. paratuberculosis K-10]
 gi|118463948|ref|YP_880786.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           avium 104]
 gi|67460344|sp|Q73X80|CLPS_MYCPA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|158512435|sp|A0QCZ8|CLPS_MYCA1 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|41396883|gb|AAS04746.1| hypothetical protein MAP_2429c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118165235|gb|ABK66132.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           avium 104]
          Length = 105

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 40/107 (37%), Gaps = 6/107 (5%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+     +       +   + +      +  ++ +D    M +V +V Q  F      A 
Sbjct: 4   MSAPTEPKSRPGTTGQRESAPEDVTASPWVTIVWDDPVNLMTYVTYVFQKLFGYSEPHAT 63

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +ML+VH++G       + E  E+ V      S+ H   L   M+Q 
Sbjct: 64  KLMLQVHNEGKAVVSAGSREAMEVDV------SKLHAAGLWATMQQD 104


>gi|256390690|ref|YP_003112254.1| ATP-dependent Clp protease adaptor protein ClpS [Catenulispora
           acidiphila DSM 44928]
 gi|256356916|gb|ACU70413.1| ATP-dependent Clp protease adaptor protein ClpS [Catenulispora
           acidiphila DSM 44928]
          Length = 100

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 38/100 (38%), Gaps = 8/100 (8%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
           E D     E R +       ++  ++ ND    M +V +V   +F      A+ +M +VH
Sbjct: 7   EVDPEATEETRAAPV--QDPMWVTVVWNDPVNLMSYVTYVFMTYFGYSKGKAERMMHEVH 64

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + G         E  E       + +  H Y L   ++++
Sbjct: 65  NLGKAIVSSGGREQME------KDVAAMHGYGLWATLQRQ 98


>gi|318057187|ref|ZP_07975910.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           SA3_actG]
 gi|318079806|ref|ZP_07987138.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           SA3_actF]
          Length = 96

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 39/94 (41%), Gaps = 6/94 (6%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           D+E    +       +  L+ ND    M +V +V Q++F    + A  +ML VH++G   
Sbjct: 7   DAEAESFAVAEPDLPWITLVHNDPVNLMSYVTYVFQSYFGYSKDKATKLMLDVHNKGRAV 66

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               + E  E  V  +      H Y L   ++Q 
Sbjct: 67  VSSGSREEMERDVQAM------HGYGLWATLQQD 94


>gi|86607127|ref|YP_475890.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           JA-3-3Ab]
 gi|86555669|gb|ABD00627.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           JA-3-3Ab]
          Length = 93

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 7/96 (7%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGI 102
            ++ V+ S   +   +YRVLL ND+   ME+V+ VL +         A  IML+ H+ G+
Sbjct: 3   TETLVKPSVTPKHMPMYRVLLHNDDVNTMEYVVQVLVKVIPSMLPPQATEIMLEAHNNGV 62

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               V   E AE    Q+       Q+ L   +E +
Sbjct: 63  AVVIVVPREHAEFYCEQLR------QHGLTSSIEPE 92


>gi|255576515|ref|XP_002529149.1| ATP-dependent Clp protease adaptor protein clpS, putative [Ricinus
           communis]
 gi|223531428|gb|EEF33262.1| ATP-dependent Clp protease adaptor protein clpS, putative [Ricinus
           communis]
          Length = 120

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 40/106 (37%), Gaps = 7/106 (6%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAK 91
            K  I +     +SE       +    YRV+L NDNY   E+V+ VL         + A 
Sbjct: 16  EKPVIEKTTPGRESEFDLRKSRKTAPPYRVILHNDNYNKREYVVQVLMKVIPGMTLDNAV 75

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IM + H+ G+    + A   AE    Q+          L   +E 
Sbjct: 76  NIMQEAHYNGLSVVIICAQADAEDHCMQLR------GNGLLSSIEP 115


>gi|256787457|ref|ZP_05525888.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           lividans TK24]
 gi|12230769|sp|Q9S2G5|CLPS_STRCO RecName: Full=ATP-dependent Clp protease adapter protein ClpS
          Length = 96

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 38/97 (39%), Gaps = 6/97 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              +S     +       +  ++ ND    M +V +V Q++F    + A  +M+ VHH+G
Sbjct: 4   EKTESAEEVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQSYFGYSKDKATKLMMDVHHKG 63

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  + E  E  V  +      H Y L   ++Q 
Sbjct: 64  RAVVSSGSREEMERDVQAM------HGYGLWATLQQD 94


>gi|295396718|ref|ZP_06806864.1| ATP-dependent Clp protease adaptor protein ClpS [Brevibacterium
           mcbrellneri ATCC 49030]
 gi|294970464|gb|EFG46393.1| ATP-dependent Clp protease adaptor protein ClpS [Brevibacterium
           mcbrellneri ATCC 49030]
          Length = 97

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 34/91 (37%), Gaps = 6/91 (6%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E      V     +  ++ ND    M +V +V +++F      A  +M++VH+ G     
Sbjct: 10  EPEVDEVVATDSPWVTIVFNDPVNLMSYVTYVFRSYFGYSPAKANKLMMEVHNNGKSVVA 69

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
               E  E       + +  H + L    ++
Sbjct: 70  TGTREEME------RDTAAMHGFGLWATCKK 94


>gi|255630508|gb|ACU15612.1| unknown [Glycine max]
          Length = 155

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 39/106 (36%), Gaps = 7/106 (6%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAK 91
            K  I +     +SE       +    YRV+L NDN+   E+V+ VL         + A 
Sbjct: 51  EKPVIEKVTPGRESEFDLKKSRKSAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAV 110

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IM + H+ G+    +     AE    Q+          L   +E 
Sbjct: 111 NIMQEAHYNGLSVVIICDQADAEDHCMQLR------GNGLLSSIEP 150


>gi|294812860|ref|ZP_06771503.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces
           clavuligerus ATCC 27064]
 gi|294325459|gb|EFG07102.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces
           clavuligerus ATCC 27064]
          Length = 113

 Score = 90.7 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 41/119 (34%), Gaps = 10/119 (8%)

Query: 20  ALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL 79
              S   M    +    I       ++       V     +  L+ ND    M +V +V 
Sbjct: 3   RARSGGSMDQVSVAPTEIERPAPAEETFAVPEPDV----PWVTLVHNDPVNLMSYVTYVF 58

Query: 80  QNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           Q +F    + A+ +ML VH++G       + E  E  V  +      H Y L   + Q 
Sbjct: 59  QAYFGYSKDKARKLMLDVHNKGRAVVSSGSREEMERDVQAM------HGYGLWATLSQD 111


>gi|217034530|ref|ZP_03439940.1| hypothetical protein HP9810_897g15 [Helicobacter pylori 98-10]
 gi|216943011|gb|EEC22492.1| hypothetical protein HP9810_897g15 [Helicobacter pylori 98-10]
          Length = 97

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 50/84 (59%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +  P + +V++V+D  T  EFVI  L++FF K  E A+ +   +H  G G CGVY Y+IA
Sbjct: 12  IPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAQALTSSIHRDGEGVCGVYPYDIA 71

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQ 137
             +   V + +R+   PL+ ++E+
Sbjct: 72  RHRAAWVRDKARELDLPLKLLVEE 95


>gi|239981994|ref|ZP_04704518.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces albus
           J1074]
 gi|291453845|ref|ZP_06593235.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces albus
           J1074]
 gi|291356794|gb|EFE83696.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces albus
           J1074]
          Length = 99

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 36/101 (35%), Gaps = 6/101 (5%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
                   +     +       +  L+ ND    M +V +V Q +F    E A  +ML V
Sbjct: 3   PAETEQPAAAEETFAVPEPDLPWVTLVHNDPVNLMSYVAYVFQAYFGYSKEKANKLMLDV 62

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           HH+G       + E  E  V  +      H Y L   ++Q 
Sbjct: 63  HHKGRAVVSSGSREEMERDVQAM------HGYGLWATLQQD 97


>gi|311743607|ref|ZP_07717413.1| ATP-dependent Clp protease adaptor protein ClpS [Aeromicrobium
           marinum DSM 15272]
 gi|311312737|gb|EFQ82648.1| ATP-dependent Clp protease adaptor protein ClpS [Aeromicrobium
           marinum DSM 15272]
          Length = 101

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 41/103 (39%), Gaps = 6/103 (5%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
            G+         E      V +   +  ++ ND    M +V +V +N+F    E A  +M
Sbjct: 2   DGVTRTAPVEHREPEVDEAVELEAPWVTIVWNDPVNLMSYVSYVFRNYFGYTDEKATELM 61

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           L VHH+G       + E  E  V  +      H+Y L   +++
Sbjct: 62  LAVHHEGKAVVSTGSREQMERHVQAM------HEYGLWATLQR 98


>gi|255632171|gb|ACU16445.1| unknown [Glycine max]
          Length = 155

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 39/106 (36%), Gaps = 7/106 (6%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAK 91
            K  I +     +SE       +    YRV+L NDN+   E+V+ VL         + A 
Sbjct: 51  EKPVIEKVTPGRESEFDLKKSRKSAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAV 110

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IM + H+ G+    +     AE    Q+          L   +E 
Sbjct: 111 NIMQEAHYNGLSVVIICDQADAEDHCTQLR------GNGLLSSIEP 150


>gi|302560427|ref|ZP_07312769.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           griseoflavus Tu4000]
 gi|302478045|gb|EFL41138.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           griseoflavus Tu4000]
          Length = 105

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 36/95 (37%), Gaps = 6/95 (6%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
            +S     +       +  ++ ND    M +V +V Q++F    + A  +ML VHH+G  
Sbjct: 15  TESAEEVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQSYFGYSKDKATKLMLDVHHKGRA 74

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  E  E  V  +      H Y L   ++  
Sbjct: 75  VVSSGTREEMERDVQAM------HGYGLWATLQHD 103


>gi|309813284|ref|ZP_07707000.1| ATP-dependent Clp protease adaptor protein ClpS [Dermacoccus sp.
           Ellin185]
 gi|308432780|gb|EFP56696.1| ATP-dependent Clp protease adaptor protein ClpS [Dermacoccus sp.
           Ellin185]
          Length = 106

 Score = 90.3 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 43/112 (38%), Gaps = 7/112 (6%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           M D  +    I  F+           +    + +  L+ ND    M +V  V Q++F   
Sbjct: 1   MVDVSIAPPDID-FEQLAKQLADPDPQDVGERAWVTLVWNDPVNLMSYVSFVFQDYFGYS 59

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            E A+ +M++VH +G       + E AE     +      H Y L    EQ+
Sbjct: 60  REEAERLMMQVHTEGRAVVSKGSREKAEADTIAM------HGYSLWATYEQE 105


>gi|86608169|ref|YP_476931.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556711|gb|ABD01668.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 93

 Score = 89.9 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 7/96 (7%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGI 102
            ++ V+ S   +   +YRVLL ND+   ME+V+ VL +         A  IML+ HH G+
Sbjct: 3   TETLVKPSVTPKHMPMYRVLLHNDDVNTMEYVVQVLVKVIPAMMPPQATEIMLEAHHNGV 62

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               V   E AE    Q+       Q+ L   +E +
Sbjct: 63  AVVIVVPREHAEFYCEQLR------QHGLTSSIEPE 92


>gi|224099343|ref|XP_002311446.1| predicted protein [Populus trichocarpa]
 gi|118481362|gb|ABK92624.1| unknown [Populus trichocarpa]
 gi|222851266|gb|EEE88813.1| predicted protein [Populus trichocarpa]
          Length = 158

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 40/106 (37%), Gaps = 7/106 (6%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAK 91
            K  I       +SE       ++   YRV+L NDNY   E+V+ VL         + A 
Sbjct: 54  EKPVIERTTPGRESEFDLRKSKKMAPPYRVMLHNDNYNKREYVVQVLMKVIPGMTLDNAV 113

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IM + H+ G+    + A   AE    Q+          L   +E 
Sbjct: 114 NIMQEAHYNGLSVVIICAQADAEEHCMQLR------GNGLLSSIEP 153


>gi|217031776|ref|ZP_03437280.1| hypothetical protein HPB128_155g89 [Helicobacter pylori B128]
 gi|298737083|ref|YP_003729613.1| ATP-dependent Clp protease adaptor protein ClpS [Helicobacter
           pylori B8]
 gi|216946623|gb|EEC25223.1| hypothetical protein HPB128_155g89 [Helicobacter pylori B128]
 gi|298356277|emb|CBI67149.1| ATP-dependent Clp protease adaptor protein ClpS [Helicobacter
           pylori B8]
          Length = 91

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 50/85 (58%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            +  P + +V++V+D  T  EFVI  L++FF K  E  K +   +H  G G CGVY Y+I
Sbjct: 5   NIPTPTMAQVIMVDDPITTAEFVISALKDFFDKSLEEVKALTSSIHRDGCGVCGVYPYDI 64

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           A  +   V + +R+  +PL+ ++E+
Sbjct: 65  ARHRAAWVRDKARELDFPLKLLVEE 89


>gi|330466047|ref|YP_004403790.1| ATP-dependent clp protease adaptor protein clps [Verrucosispora
           maris AB-18-032]
 gi|328809018|gb|AEB43190.1| ATP-dependent clp protease adaptor protein clps [Verrucosispora
           maris AB-18-032]
          Length = 96

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 37/100 (37%), Gaps = 8/100 (8%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
            +            S    P  +  ++ +D    M +V  V Q  F    E A+ +ML V
Sbjct: 4   PQVAPVETPATDEVSASDRP--WVTIVWDDPVNLMSYVTWVFQKLFGYSREKAEQLMLDV 61

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           HH+G       A E  E       + ++ H Y L   +++
Sbjct: 62  HHKGKAVVSSGARERME------HDAAQLHAYGLWATVDR 95


>gi|269926486|ref|YP_003323109.1| ATP-dependent Clp protease adaptor protein ClpS [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269790146|gb|ACZ42287.1| ATP-dependent Clp protease adaptor protein ClpS [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 101

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           ++V+L ND+   M++V+ VL        E A  +ML+ HH G       A E AE+  ++
Sbjct: 30  WKVILWNDDVHSMDYVVLVLMRCLGMSLEKATQVMLEAHHNGQSVAWAGAKETAELYQDR 89

Query: 120 VMNYSRQHQYPLQCIMEQ 137
           +++      + L   +E+
Sbjct: 90  LLS------FGLTATIEK 101


>gi|229494029|ref|ZP_04387798.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodococcus
           erythropolis SK121]
 gi|229319098|gb|EEN84950.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodococcus
           erythropolis SK121]
          Length = 162

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/119 (18%), Positives = 43/119 (36%), Gaps = 6/119 (5%)

Query: 20  ALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL 79
           A +S  + A+  M     +      +     S+     + +  ++ +D    M +V +V 
Sbjct: 48  ATVSGTYSANVTMRGATASSPQATPEQSEAVSTIEAADRPWVTIVWDDPVNLMHYVTYVF 107

Query: 80  QNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           Q  F      A  +M++VH +G       + +  E  V       R H   L   M++ 
Sbjct: 108 QKLFGYSKAKATDLMMQVHSEGKAVVSSGSRDKMEADVR------RLHAAGLWATMQRD 160


>gi|298490087|ref|YP_003720264.1| ATP-dependent Clp protease adaptor protein ClpS ['Nostoc azollae'
           0708]
 gi|298232005|gb|ADI63141.1| ATP-dependent Clp protease adaptor protein ClpS ['Nostoc azollae'
           0708]
          Length = 92

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 7/95 (7%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIG 103
           ++  + S+  ++   YRVLL ND+Y  ME+V+ VL           A  IM++ H+ G+ 
Sbjct: 4   ETIEKRSTTRKLAPQYRVLLHNDDYNSMEYVVQVLMTSVPSITQPQAVNIMMEAHNSGLA 63

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                A E AE     +        + L   +E  
Sbjct: 64  LVITCAQEHAEFYCETLK------GHGLSSTIEPD 92


>gi|282865136|ref|ZP_06274189.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           ACTE]
 gi|282560059|gb|EFB65608.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces sp.
           ACTE]
          Length = 105

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 35/94 (37%), Gaps = 6/94 (6%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           +S     +       +  L+ ND    M +V +V Q +F    + A  +ML VH +G   
Sbjct: 16  ESAEETYTVPEPDVPWVTLVHNDPVNLMSYVTYVFQAYFGYSKDKAHKLMLDVHQKGRAV 75

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               + E  E  V  +      H Y L   + Q 
Sbjct: 76  VSSGSREEMERDVQAM------HGYGLWATLTQD 103


>gi|307150896|ref|YP_003886280.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           7822]
 gi|306981124|gb|ADN13005.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           7822]
          Length = 99

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 36/99 (36%), Gaps = 7/99 (7%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHH 99
              +  +   S+  +    YRVLL ND++  ME+V+  L           A  IM++ H 
Sbjct: 6   STQVIEKSSTSTVRKPAPRYRVLLHNDDFNSMEYVVQTLMKTVAGMTQPQAVNIMMEAHT 65

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            G+        E AE     +        + L   +E  
Sbjct: 66  NGMALVITCTLEHAEFYCETLKA------HGLTSTIEPD 98


>gi|168011584|ref|XP_001758483.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162690518|gb|EDQ76885.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 106

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 7/106 (6%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAK 91
           ++  I +     +SE     K ++   YRV+L NDN+   E+V+ VL         + A 
Sbjct: 7   DRPTIDKPTPGRESEFDLKKKKKMSPPYRVMLHNDNFNKREYVVQVLMKAIPGMTVDIAV 66

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +M + H  G+    V   E AE    Q+    R +   L   +E 
Sbjct: 67  NVMNEAHINGLAVVIVCPQEDAEDYCMQL----RTNG--LLSSIEP 106


>gi|311896234|dbj|BAJ28642.1| putative ATP-dependent Clp protease adaptor protein ClpS
           [Kitasatospora setae KM-6054]
          Length = 92

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 35/92 (38%), Gaps = 6/92 (6%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           EV           +  ++ ND    M +V HV Q++F    E A+ +M+ VH +G     
Sbjct: 7   EVEGVPVTEPDTPWVTIVHNDPVNLMSYVQHVFQSYFGYPKEKARRLMMDVHQKGRAVVS 66

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               E  E  V  +      H Y L   ++  
Sbjct: 67  SGTREEMERDVQAM------HGYGLWATLQHD 92


>gi|311113408|ref|YP_003984630.1| ATP-dependent Clp protease adaptor protein ClpS [Rothia
           dentocariosa ATCC 17931]
 gi|310944902|gb|ADP41196.1| ATP-dependent Clp protease adaptor protein ClpS [Rothia
           dentocariosa ATCC 17931]
          Length = 115

 Score = 89.1 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 40/96 (41%), Gaps = 6/96 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           +  + +      +     ++V++ ND    M +V +V +  F      A+ +ML+VH+ G
Sbjct: 23  DATELDATIDENLETQTPWQVIVWNDPVNLMTYVSYVFRAHFGFSRRRAEKLMLQVHNNG 82

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
                  + E AE K  Q M     H + L    E+
Sbjct: 83  KAVVFTGSREDAE-KHTQAM-----HAWGLMASFEK 112


>gi|196234336|ref|ZP_03133165.1| ATP-dependent Clp protease adaptor protein ClpS [Chthoniobacter
           flavus Ellin428]
 gi|196221603|gb|EDY16144.1| ATP-dependent Clp protease adaptor protein ClpS [Chthoniobacter
           flavus Ellin428]
          Length = 93

 Score = 89.1 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 8/97 (8%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
           +  ++ E + SS V VP  + V++ ND      +V  V Q  F      A+  ML+VH+ 
Sbjct: 3   ETVVEEETKTSSAVDVP--WNVVVHNDPVNLTAYVTRVFQKVFGYSKTRAEKHMLEVHNL 60

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G       A E AE  V Q+      H Y L   +E+
Sbjct: 61  GRSIVWTGARERAEAYVEQL------HGYLLLSTLEK 91


>gi|184200644|ref|YP_001854851.1| ATP-dependent Clp protease adaptor protein ClpS [Kocuria rhizophila
           DC2201]
 gi|183580874|dbj|BAG29345.1| putative ATP-dependent Clp protease adaptor protein ClpS [Kocuria
           rhizophila DC2201]
          Length = 116

 Score = 89.1 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
            + V++ +D    M +V++V +  F      A+ +ML+VHH G       + E AE  V+
Sbjct: 40  PWNVVVWDDPVNLMSYVVYVFRAHFGYSDAKARTLMLEVHHSGRSIVFTGSLEEAEAHVS 99

Query: 119 QVMNYSRQHQYPLQCIMEQ 137
            +      H Y L    E+
Sbjct: 100 SL------HGYGLWATYEK 112


>gi|218438615|ref|YP_002376944.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           7424]
 gi|218171343|gb|ACK70076.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           7424]
          Length = 97

 Score = 89.1 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 36/99 (36%), Gaps = 7/99 (7%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHH 99
              +  +   S+  +    YRVLL ND++  ME+V+  L           A  IM++ H 
Sbjct: 4   STQVIEKSTTSTVRKPAPRYRVLLHNDDFNSMEYVVQTLMKTVAGMTQPQAVNIMMEAHT 63

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            G         E AE     + N      + L   +E  
Sbjct: 64  NGTALVITCTLEHAEFYCETLKN------HGLTSTIEPD 96


>gi|289644636|ref|ZP_06476702.1| ATP-dependent Clp protease adaptor protein ClpS [Frankia symbiont
           of Datisca glomerata]
 gi|289505564|gb|EFD26597.1| ATP-dependent Clp protease adaptor protein ClpS [Frankia symbiont
           of Datisca glomerata]
          Length = 99

 Score = 89.1 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 37/104 (35%), Gaps = 6/104 (5%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
           + +       +  +         + +  ++ ND    M +V +V Q  F    E AK +M
Sbjct: 2   ESVPLATAAPEEVLESDEVAERDRPWVTIVWNDPVNLMSYVTYVFQKLFGFSREKAKALM 61

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L VH +G         E  E       + +R H Y L   + Q 
Sbjct: 62  LDVHRKGRATVSSGTREEME------RDATRLHAYGLWATIAQD 99


>gi|296139013|ref|YP_003646256.1| ATP-dependent Clp protease adaptor protein ClpS [Tsukamurella
           paurometabola DSM 20162]
 gi|296027147|gb|ADG77917.1| ATP-dependent Clp protease adaptor protein ClpS [Tsukamurella
           paurometabola DSM 20162]
          Length = 109

 Score = 89.1 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/114 (18%), Positives = 39/114 (34%), Gaps = 8/114 (7%)

Query: 27  MADSRMNKKGIAEFDNCLDSE--VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFY 84
           M DS     G         S   +   +   + K +  ++ +D    M +V  V +  F 
Sbjct: 1   MTDSSAAAPGSPGVSGQPGSAATLERETDRAIDKPWVTVVWDDPVNLMSYVTFVFRKVFG 60

Query: 85  KDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                AK +M++VH +G         +  E  V ++          L   M++ 
Sbjct: 61  YSTSKAKELMMQVHTEGKAVVSTGDRDKVEGDVRKLHAA------GLWATMQRD 108


>gi|300741328|ref|ZP_07071349.1| ATP-dependent Clp protease adaptor protein ClpS [Rothia
           dentocariosa M567]
 gi|300380513|gb|EFJ77075.1| ATP-dependent Clp protease adaptor protein ClpS [Rothia
           dentocariosa M567]
          Length = 115

 Score = 89.1 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 40/96 (41%), Gaps = 6/96 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           +  + +      +     ++V++ ND    M +V +V +  F      A+ +ML+VH+ G
Sbjct: 23  DATELDATVDENLETQTPWQVIVWNDPVNLMTYVSYVFRAHFGFSRRRAEKLMLQVHNNG 82

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
                  + E AE K  Q M     H + L    E+
Sbjct: 83  KAVVFTGSREDAE-KHTQAM-----HAWGLMASFEK 112


>gi|302865655|ref|YP_003834292.1| ATP-dependent Clp protease adaptor protein ClpS [Micromonospora
           aurantiaca ATCC 27029]
 gi|315502219|ref|YP_004081106.1| ATP-dependent clp protease adaptor protein clps [Micromonospora sp.
           L5]
 gi|302568514|gb|ADL44716.1| ATP-dependent Clp protease adaptor protein ClpS [Micromonospora
           aurantiaca ATCC 27029]
 gi|315408838|gb|ADU06955.1| ATP-dependent Clp protease adaptor protein ClpS [Micromonospora sp.
           L5]
          Length = 99

 Score = 89.1 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 37/100 (37%), Gaps = 8/100 (8%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
            +       +         P  +  ++ +D    M +V  V Q  F    E A+ +ML V
Sbjct: 7   PQVAPVETPDTEEVPVSDRP--WVTIVWDDPVNLMTYVTWVFQKLFGYSREKAERLMLDV 64

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           HH+G       A E  E       + ++ H Y L   +++
Sbjct: 65  HHKGKAVVSSGARERME------HDAAQLHAYGLWATVDR 98


>gi|189218668|ref|YP_001939309.1| ATP-dependent Clp protease adaptor protein clpS [Methylacidiphilum
           infernorum V4]
 gi|189185526|gb|ACD82711.1| ATP-dependent Clp protease adaptor protein clpS [Methylacidiphilum
           infernorum V4]
          Length = 108

 Score = 89.1 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 47/113 (41%), Gaps = 8/113 (7%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRV--PKLYRVLLVNDNYTPMEFVIHVLQNFFY 84
           M + R            +  E     KV+    +L+ V++ ND    M +V++V Q    
Sbjct: 1   MTEGRWLMAVAQLTSPEVVKEESVEDKVKEAFDQLWGVIVWNDPINLMSYVVYVFQRVLK 60

Query: 85  KDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
              + A   ML+VH++G         E AE+ V+Q+        + LQ  ME+
Sbjct: 61  MSKQDATRHMLEVHNKGKSMVAKETKEKAELLVHQLQ------GFGLQATMEK 107


>gi|75907498|ref|YP_321794.1| ATP-dependent Clp protease adaptor protein ClpS [Anabaena
           variabilis ATCC 29413]
 gi|75701223|gb|ABA20899.1| ATP-dependent Clp protease adaptor protein ClpS [Anabaena
           variabilis ATCC 29413]
          Length = 93

 Score = 88.7 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 7/95 (7%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIG 103
           ++  + S+  ++   YRVLL ND+Y  ME+V+ VL           A  IM++ H  G+ 
Sbjct: 4   ETIEKRSTSRKLAPRYRVLLHNDDYNSMEYVVQVLITTVPSLTQPQAVSIMMEAHTNGLA 63

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                A E AE     + +      + L   +E  
Sbjct: 64  LVITCAQEHAEFYCETLKD------HGLSSTIEPD 92


>gi|320103498|ref|YP_004179089.1| ATP-dependent Clp protease adaptor protein ClpS [Isosphaera pallida
           ATCC 43644]
 gi|319750780|gb|ADV62540.1| ATP-dependent Clp protease adaptor protein ClpS [Isosphaera pallida
           ATCC 43644]
          Length = 124

 Score = 88.7 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 6/104 (5%)

Query: 27  MADSRMNKKGI----AEFDNCLDSEVRFS--SKVRVPKLYRVLLVNDNYTPMEFVIHVLQ 80
           M+DS   +                +      +K R    Y V+++ND     E+VI +L 
Sbjct: 1   MSDSNDYEPDDLGAGTTVTTQSAPKTSTRGLTKTRQLPRYHVIILNDEEHTFEYVIDLLT 60

Query: 81  NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYS 124
             F     TA+ +  ++H +G+        E+AE+K +QV+++ 
Sbjct: 61  KVFRHSRPTAEALTWQIHTRGMAIVYTTHKELAELKRDQVLSWG 104


>gi|297160086|gb|ADI09798.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           bingchenggensis BCW-1]
          Length = 95

 Score = 88.7 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 6/85 (7%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
                 +  ++ ND    M +V +V Q +F    + A  +ML VHH+G       + E  
Sbjct: 16  PEPDVPWVTVVHNDPVNLMSYVTYVFQAYFGYSKDKAHRLMLDVHHKGRAVVSSGSREEM 75

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQK 138
           E  V  +      H Y L   ++Q 
Sbjct: 76  ERDVQAM------HGYGLWATLQQD 94


>gi|111220948|ref|YP_711742.1| ATP-dependent Clp protease adaptor protein ClpS [Frankia alni
           ACN14a]
 gi|111148480|emb|CAJ60151.1| ATP-dependent Clp protease adaptor protein clpS [Frankia alni
           ACN14a]
          Length = 91

 Score = 88.7 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 31/91 (34%), Gaps = 6/91 (6%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
                 +   + +  ++ ND    M +V +V Q  F      A  +ML VHH+G      
Sbjct: 7   EEADETLDDDRPWVTIVWNDPINLMSYVTYVFQKLFGYTKSKATELMLDVHHKGRASVAT 66

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              E  E          R H Y L   + Q 
Sbjct: 67  GTREEMEADAE------RLHAYGLWATIAQD 91


>gi|284052626|ref|ZP_06382836.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira
           platensis str. Paraca]
          Length = 93

 Score = 88.7 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 7/96 (7%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGI 102
             +  + S+  ++   YRVLL ND++ PME+V+ VL           A  IM++ H  G+
Sbjct: 3   TQTVEKTSTNRKLAPRYRVLLHNDDHNPMEYVVQVLMSTVPGLTQPQAVSIMMEAHTNGL 62

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                 A E AE     + N      + L   +E  
Sbjct: 63  ALVITCALEHAEFYCETLKN------HGLTSTIEPD 92


>gi|145222937|ref|YP_001133615.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           gilvum PYR-GCK]
 gi|315443400|ref|YP_004076279.1| hypothetical protein Mspyr1_17820 [Mycobacterium sp. Spyr1]
 gi|145215423|gb|ABP44827.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           gilvum PYR-GCK]
 gi|315261703|gb|ADT98444.1| uncharacterized conserved protein [Mycobacterium sp. Spyr1]
          Length = 100

 Score = 88.7 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 37/101 (36%), Gaps = 10/101 (9%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
                  D     ++       +  ++ +D    M +V +VLQ  F      A  +ML+V
Sbjct: 9   PGTREDRDVGEDAAADT----PWVTIVWDDPVNLMTYVTYVLQKLFGYTEPHATKLMLQV 64

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H++G       + E  E  V      SR H   L   ++Q 
Sbjct: 65  HNEGKAVVSAGSRESMETDV------SRLHAAGLWATLQQD 99


>gi|320010544|gb|ADW05394.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           flavogriseus ATCC 33331]
          Length = 105

 Score = 88.7 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 34/94 (36%), Gaps = 6/94 (6%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           +S             +  L+ ND    M +V +V Q +F    + A  +ML VH +G   
Sbjct: 16  ESAEETFVVPEPDVPWVTLVHNDPVNLMSYVTYVFQAYFGYSKDKAHKLMLDVHQKGRAV 75

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               + E  E  V  +      H Y L   + Q 
Sbjct: 76  VSSGSREEMERDVQAM------HGYGLWATLTQD 103


>gi|254385759|ref|ZP_05001080.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces sp.
           Mg1]
 gi|194344625|gb|EDX25591.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces sp.
           Mg1]
          Length = 104

 Score = 88.7 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 35/95 (36%), Gaps = 6/95 (6%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
            +S     +       +  L+ ND    M +V +V Q +F    + A  +ML VHH+G  
Sbjct: 14  TESAEETYAVPEPDVPWVTLVHNDPVNLMSYVTYVFQAYFGYSKDKAHKLMLDVHHKGRA 73

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  E  E  V  +      H Y L   + Q 
Sbjct: 74  VVSSGTREEMERDVQAM------HGYGLWATLSQD 102


>gi|282897015|ref|ZP_06305017.1| ATP-dependent Clp protease adaptor protein ClpS [Raphidiopsis
           brookii D9]
 gi|281197667|gb|EFA72561.1| ATP-dependent Clp protease adaptor protein ClpS [Raphidiopsis
           brookii D9]
          Length = 93

 Score = 88.7 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 7/95 (7%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIG 103
           ++  + S+  ++   YRVLL ND+Y  ME+V+ VL           A  IM++ H  G+ 
Sbjct: 4   ETIEKPSTTRKLAPRYRVLLHNDDYNSMEYVVQVLLSTIPSLTQPQAVTIMMEAHSNGLA 63

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                A E AE     +      + + L   +E  
Sbjct: 64  LVISCALEHAEFYCESL------NNHGLTSTIEPD 92


>gi|302534695|ref|ZP_07287037.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces sp.
           C]
 gi|302443590|gb|EFL15406.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces sp.
           C]
          Length = 104

 Score = 88.7 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 35/95 (36%), Gaps = 6/95 (6%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
            +S     +       +  L+ ND    M +V +V Q +F    + A  +M+ VH++G  
Sbjct: 14  TESAEETFAVPEPDVPWVTLVHNDPVNLMSYVTYVFQAYFGYPKDKATRLMMDVHNKGKA 73

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  E  E  V  +      H Y L   + Q 
Sbjct: 74  VVSSGTREEMERDVQAM------HGYGLWATLSQD 102


>gi|158317405|ref|YP_001509913.1| ATP-dependent Clp protease adaptor protein ClpS [Frankia sp.
           EAN1pec]
 gi|158112810|gb|ABW15007.1| ATP-dependent Clp protease adaptor protein ClpS [Frankia sp.
           EAN1pec]
          Length = 122

 Score = 88.7 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 31/91 (34%), Gaps = 6/91 (6%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
                     +L+  ++ ND    M +V +V +  F      A  +ML VHH+G      
Sbjct: 38  EDVEDSPEDDRLWVTIVWNDPINLMSYVTYVFRKLFGYSERKATKLMLDVHHKGRATVAS 97

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              E  E          R H Y L   + Q 
Sbjct: 98  GTREEMEAAAE------RLHTYGLWATIAQD 122


>gi|159036636|ref|YP_001535889.1| ATP-dependent Clp protease adaptor protein ClpS [Salinispora
           arenicola CNS-205]
 gi|157915471|gb|ABV96898.1| ATP-dependent Clp protease adaptor protein ClpS [Salinispora
           arenicola CNS-205]
          Length = 96

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 35/89 (39%), Gaps = 6/89 (6%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
                    + +  ++ +D    M +V  V Q  F    E A+ +ML VHH+G       
Sbjct: 13  DTDEVPAPDRPWVTIVWDDPVNLMTYVTWVFQKLFGYSRERAEQLMLDVHHKGRAVVTSG 72

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           + E  E   +Q+      H Y L   +++
Sbjct: 73  SRERMEHDASQL------HAYGLWATVDR 95


>gi|134097791|ref|YP_001103452.1| ATP-dependent Clp protease adaptor protein ClpS [Saccharopolyspora
           erythraea NRRL 2338]
 gi|291005573|ref|ZP_06563546.1| ATP-dependent Clp protease adaptor protein ClpS [Saccharopolyspora
           erythraea NRRL 2338]
 gi|133910414|emb|CAM00527.1| ATP-dependent Clp protease adaptor protein ClpS [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 97

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 6/83 (7%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
             K +  ++ ND    M +V +VLQ  F    + A  +ML VHH+G       + E  E 
Sbjct: 20  EDKPWVTVVWNDPVNLMSYVTYVLQKIFGYSKDHATKLMLDVHHKGRAAVSSGSKEKVEG 79

Query: 116 KVNQVMNYSRQHQYPLQCIMEQK 138
            V      ++ H   L   M++ 
Sbjct: 80  DV------AKLHAAGLWATMQKD 96


>gi|326441362|ref|ZP_08216096.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           clavuligerus ATCC 27064]
          Length = 82

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 6/85 (7%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
                 +  L+ ND    M +V +V Q +F    + A+ +ML VH++G       + E  
Sbjct: 2   PEPDVPWVTLVHNDPVNLMSYVTYVFQAYFGYSKDKARKLMLDVHNKGRAVVSSGSREEM 61

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQK 138
           E  V  +      H Y L   + Q 
Sbjct: 62  ERDVQAM------HGYGLWATLSQD 80


>gi|291299382|ref|YP_003510660.1| ATP-dependent Clp protease adaptor protein ClpS [Stackebrandtia
           nassauensis DSM 44728]
 gi|290568602|gb|ADD41567.1| ATP-dependent Clp protease adaptor protein ClpS [Stackebrandtia
           nassauensis DSM 44728]
          Length = 119

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 37/94 (39%), Gaps = 6/94 (6%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           ++    +        +  ++ ND    M +V +V Q++F      A+ +ML VH++G+  
Sbjct: 31  ETVTDAAETPEADAPWVTIVRNDPVNLMSYVSYVFQSYFGYTRPKAEELMLDVHNKGLAV 90

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                 E  E  V  +      H Y L   M Q 
Sbjct: 91  VSSGNREEMERDVQAM------HGYGLWASMRQD 118


>gi|296393925|ref|YP_003658809.1| ATP-dependent Clp protease adaptor protein ClpS [Segniliparus
           rotundus DSM 44985]
 gi|296181072|gb|ADG97978.1| ATP-dependent Clp protease adaptor protein ClpS [Segniliparus
           rotundus DSM 44985]
          Length = 104

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 32/83 (38%), Gaps = 6/83 (7%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAE 114
                +  ++ +D    M +V +V Q  F      A  +ML+VH+ G       + E  E
Sbjct: 26  EPDLPWVTIVWDDPVNLMRYVTYVFQTVFGYSEAKATELMLQVHNDGKAVVSSGSREKVE 85

Query: 115 MKVNQVMNYSRQHQYPLQCIMEQ 137
             V       + HQ  L   M+Q
Sbjct: 86  TDVV------KLHQAGLWATMQQ 102


>gi|172041152|ref|YP_001800866.1| hypothetical protein cur_1472 [Corynebacterium urealyticum DSM
           7109]
 gi|171852456|emb|CAQ05432.1| conserved hypothetical protein [Corynebacterium urealyticum DSM
           7109]
          Length = 138

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 39/137 (28%), Gaps = 13/137 (9%)

Query: 8   SMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDS-------EVRFSSKVRVPKLY 60
             Y         A      M        GI        +       E R  +       +
Sbjct: 5   GEYSHSSERCGQAKKYSTAMPSPPRRGDGILGGMTSPAAPSATPVAEKRPETLTDADLPW 64

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
           + +  +D    M +V +V +       + A  +M++VH +G         +  E  V ++
Sbjct: 65  QCICWDDPVNLMSYVTYVFETVLGYSRKKATELMMRVHTEGKAVVSSGERDKVEGDVKKL 124

Query: 121 MNYSRQHQYPLQCIMEQ 137
                     L   MEQ
Sbjct: 125 HTA------GLWATMEQ 135


>gi|145593650|ref|YP_001157947.1| ATP-dependent Clp protease adaptor protein ClpS [Salinispora
           tropica CNB-440]
 gi|145302987|gb|ABP53569.1| ATP-dependent Clp protease adaptor protein ClpS [Salinispora
           tropica CNB-440]
          Length = 96

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 35/100 (35%), Gaps = 8/100 (8%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
            +       +         P  +  ++ +D    M +V  V Q  F      A+ +ML V
Sbjct: 4   PQVAPAETPDTDEVPAPDRP--WVTIVWDDPVNLMAYVTWVFQKLFGYSRGRAEQLMLDV 61

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           HH+G         E  E   +Q+      H Y L   +++
Sbjct: 62  HHKGKAVVSSGTRERMEHDASQL------HAYGLWATVDR 95


>gi|312199648|ref|YP_004019709.1| ATP-dependent Clp protease adaptor protein ClpS [Frankia sp. EuI1c]
 gi|311230984|gb|ADP83839.1| ATP-dependent Clp protease adaptor protein ClpS [Frankia sp. EuI1c]
          Length = 96

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 35/91 (38%), Gaps = 6/91 (6%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
                 +   + +  ++ ND    M +V +V Q  F  D  TA+ +ML VH +G      
Sbjct: 12  EEIEEALSDDRPWVTIVWNDPINLMSYVTYVFQKLFGYDRPTARKLMLDVHEKGRASVSN 71

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              +  E       + +R H Y L   + Q 
Sbjct: 72  GTRDEME------RDAARLHTYGLWATVRQD 96


>gi|163840214|ref|YP_001624619.1| ATP-dependent Clp protease adaptor protein [Renibacterium
           salmoninarum ATCC 33209]
 gi|162953690|gb|ABY23205.1| ATP-dependent Clp protease adaptor protein [Renibacterium
           salmoninarum ATCC 33209]
          Length = 104

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 6/106 (5%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+   +AE       E   +        + V++ +D    M++V +V Q++F    E A+
Sbjct: 1   MSISTLAEPVEQSAVENSPAQDASGEHPWSVVVWDDPINTMDYVSYVFQSYFGYGKERAE 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +ML+VH+ G       A E AE       +    H + LQ  + +
Sbjct: 61  ALMLQVHNGGKAVVSRGAREKAET------DMMAMHSFGLQATVRK 100


>gi|113477268|ref|YP_723329.1| ATP-dependent Clp protease adaptor [Trichodesmium erythraeum
           IMS101]
 gi|110168316|gb|ABG52856.1| ATP-dependent Clp protease adaptor protein ClpS [Trichodesmium
           erythraeum IMS101]
          Length = 116

 Score = 88.0 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 30/67 (44%), Gaps = 1/67 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    Y+V+++ND+    + V   LQ        + A  +  +VH++G     V   E A
Sbjct: 37  KPYPNYKVIVLNDDVNTFKHVAECLQKYIPGMTSDRAWELTYQVHNEGQAIVWVGPLEQA 96

Query: 114 EMKVNQV 120
           E+   Q+
Sbjct: 97  ELYHQQL 103


>gi|307329937|ref|ZP_07609090.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           violaceusniger Tu 4113]
 gi|306884428|gb|EFN15461.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           violaceusniger Tu 4113]
          Length = 103

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 39/96 (40%), Gaps = 14/96 (14%)

Query: 51  SSKVRVPKL--------YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             + R   +        +  ++ ND    M +V +V Q++F    + A  +ML VHH+G 
Sbjct: 13  RPETREAPMSVPEPDVPWVTVVHNDPVNLMSYVTYVFQSYFGYPKDKAHRLMLDVHHKGR 72

Query: 103 GECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                 + E  E  V  +      H Y L   ++Q+
Sbjct: 73  AIVSSGSREEMERDVQAM------HGYGLWATLQQE 102


>gi|183984038|ref|YP_001852329.1| hypothetical protein MMAR_4067 [Mycobacterium marinum M]
 gi|238690951|sp|B2HQI2|CLPS_MYCMM RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|183177364|gb|ACC42474.1| conserved hypothetical protein [Mycobacterium marinum M]
          Length = 101

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 38/92 (41%), Gaps = 6/92 (6%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           +   +S+      +  ++ +D    M +V +V Q  F      A  +ML+VH++G     
Sbjct: 15  QQESASRDATASPWVTIVWDDPVNLMTYVTYVFQKLFGYSEPHATKLMLQVHNEGRAVVS 74

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             + E  E+ V      S+ H   L   M+Q 
Sbjct: 75  AGSREAMEVDV------SKLHAAGLWATMQQD 100


>gi|300868553|ref|ZP_07113170.1| ATP-dependent Clp protease adaptor protein ClpS [Oscillatoria sp.
           PCC 6506]
 gi|300333431|emb|CBN58362.1| ATP-dependent Clp protease adaptor protein ClpS [Oscillatoria sp.
           PCC 6506]
          Length = 93

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 7/95 (7%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIG 103
           ++  + S+  ++   YRVLL ND++  ME+V+  L +         A  IM++ H  G+ 
Sbjct: 4   ETIEKRSTVRKIAPRYRVLLHNDDFNSMEYVVQTLMHTVPSLTQPQAVNIMMEAHTNGLA 63

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              + A E AE     +      + + L   +E  
Sbjct: 64  VVIICAQEHAEFYSETL------NNHGLISTIEPD 92


>gi|284989906|ref|YP_003408460.1| ATP-dependent Clp protease adaptor protein ClpS [Geodermatophilus
           obscurus DSM 43160]
 gi|284063151|gb|ADB74089.1| ATP-dependent Clp protease adaptor protein ClpS [Geodermatophilus
           obscurus DSM 43160]
          Length = 98

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 6/82 (7%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
            + +  ++ ND    M +V +VLQ  F  D  TA  +ML+VH +G         E  E  
Sbjct: 22  DRPWVTIVWNDPVNLMTYVTYVLQELFGYDEPTATTLMLQVHEEGKAIVSSGPRERME-- 79

Query: 117 VNQVMNYSRQHQYPLQCIMEQK 138
                + SR H Y L    ++ 
Sbjct: 80  ----HDTSRLHAYGLWASYQRD 97


>gi|317508765|ref|ZP_07966415.1| ATP-dependent Clp protease adaptor protein ClpS [Segniliparus
           rugosus ATCC BAA-974]
 gi|316252928|gb|EFV12348.1| ATP-dependent Clp protease adaptor protein ClpS [Segniliparus
           rugosus ATCC BAA-974]
          Length = 112

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 33/91 (36%), Gaps = 6/91 (6%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E    S       +  ++ +D    M +V +V Q  F      A  +ML+VH+ G     
Sbjct: 26  EQAADSSAEPDLPWMTIVWDDPVNLMRYVTYVFQTVFGYSEAKATELMLRVHNDGKAVVS 85

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             + E  E  V ++          L   M+Q
Sbjct: 86  SGSREKVETDVVKLQQA------GLWATMQQ 110


>gi|255627599|gb|ACU14144.1| unknown [Glycine max]
          Length = 160

 Score = 87.6 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 39/106 (36%), Gaps = 7/106 (6%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAK 91
            +  I       +SE       +    YRVLL NDN+   E+V+ VL         + A 
Sbjct: 55  ERPTIETTSPGRESEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTIDNAV 114

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IM + H+ G+    V A   AE    Q+          L   +E 
Sbjct: 115 NIMQEAHYNGLAVVIVCAQVDAEDHCMQLR------GNGLLSSIEP 154


>gi|84494380|ref|ZP_00993499.1| hypothetical protein JNB_06279 [Janibacter sp. HTCC2649]
 gi|84383873|gb|EAP99753.1| hypothetical protein JNB_06279 [Janibacter sp. HTCC2649]
          Length = 96

 Score = 87.6 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 36/97 (37%), Gaps = 6/97 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              +     S+ V     +  L+ ND    M +V +V Q++F  D   A+ +M+ VH +G
Sbjct: 5   PVQEEITSSSTDVAPDLPWITLVWNDPVNLMSYVTYVFQSYFGYDRAKAEKLMMDVHVKG 64

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                    E  E+    +        Y L    ++ 
Sbjct: 65  RAVVSHGPREKMEIDTEALQ------GYGLWATFQKD 95


>gi|239941589|ref|ZP_04693526.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           roseosporus NRRL 15998]
 gi|239988054|ref|ZP_04708718.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           roseosporus NRRL 11379]
 gi|291445032|ref|ZP_06584422.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           roseosporus NRRL 15998]
 gi|291347979|gb|EFE74883.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           roseosporus NRRL 15998]
          Length = 105

 Score = 87.6 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 35/94 (37%), Gaps = 6/94 (6%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           DS     +       +  L+ ND    M +V +V Q +F    + A  +ML VH +G   
Sbjct: 16  DSAEEAFAVPEPDVPWVTLVHNDPVNLMSYVTYVFQAYFGYPKDKAHKLMLDVHQKGRAV 75

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               + E  E  V  +      H Y L   + Q 
Sbjct: 76  VSSGSREEMERDVQAM------HGYGLWATLTQD 103


>gi|284029798|ref|YP_003379729.1| ATP-dependent Clp protease adaptor protein ClpS [Kribbella flavida
           DSM 17836]
 gi|283809091|gb|ADB30930.1| ATP-dependent Clp protease adaptor protein ClpS [Kribbella flavida
           DSM 17836]
          Length = 95

 Score = 87.6 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 35/89 (39%), Gaps = 6/89 (6%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
                + +   +  ++ ND    M++V  V Q +F    + A+ +M++VH +G       
Sbjct: 12  EVDEAIELSPPWVTIVWNDPVNLMDYVTFVFQTYFGYSKQKAEKLMMQVHEEGKSAVSSG 71

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             E  E  V  +      H Y L    E+
Sbjct: 72  NREAMERDVEAM------HSYGLWATCEK 94


>gi|282899028|ref|ZP_06307010.1| ATP-dependent Clp protease adaptor protein ClpS [Cylindrospermopsis
           raciborskii CS-505]
 gi|281196168|gb|EFA71083.1| ATP-dependent Clp protease adaptor protein ClpS [Cylindrospermopsis
           raciborskii CS-505]
          Length = 93

 Score = 87.2 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 7/95 (7%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIG 103
           ++  + S+  ++   YRVLL ND+Y  ME+V+ VL           A  IM++ H  G+ 
Sbjct: 4   ETIEKPSTTRKLAPRYRVLLHNDDYNSMEYVVQVLLSTIPSLTQPQAVSIMMEAHSHGLA 63

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                A E AE     +      + Y L   +E  
Sbjct: 64  LVISCALEHAEFYCESL------NNYGLTSTIEPD 92


>gi|81299501|ref|YP_399709.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus
           elongatus PCC 7942]
 gi|123728228|sp|Q31QE7|CLPS_SYNE7 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|81168382|gb|ABB56722.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 95

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 7/93 (7%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIGEC 105
           +   ++K ++   YRVLL ND++ PME+V+ VL           A  IM++ H  G G  
Sbjct: 8   KPETTTKRKIAPRYRVLLHNDDFNPMEYVVMVLMQTVPSLTQPQAVDIMMEAHTNGTGLV 67

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                E AE    Q+ +      + L   +E  
Sbjct: 68  ITCDIEPAEFYCEQLKS------HGLSSSIEPD 94


>gi|296170273|ref|ZP_06851864.1| ATP-dependent Clp protease adapter protein ClpS [Mycobacterium
           parascrofulaceum ATCC BAA-614]
 gi|295894996|gb|EFG74715.1| ATP-dependent Clp protease adapter protein ClpS [Mycobacterium
           parascrofulaceum ATCC BAA-614]
          Length = 101

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 36/97 (37%), Gaps = 6/97 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
                +   +        +  ++ +D    M +V +V Q  F      A  +ML+VH++G
Sbjct: 10  PGTTGQRESAPVDATASPWVTIVWDDPVNLMTYVTYVFQKLFGYSEPHATKLMLQVHNEG 69

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  + E  E+ V      S+ H   L   M+Q 
Sbjct: 70  RAVVSAGSRESMEVDV------SKLHAAGLWATMQQD 100


>gi|169628566|ref|YP_001702215.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           abscessus ATCC 19977]
 gi|169240533|emb|CAM61561.1| Probable ATP-dependent Clp protease adaptor protein ClpS
           [Mycobacterium abscessus]
          Length = 100

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 36/97 (37%), Gaps = 6/97 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
               +E            +  ++ +D    M +V +V Q  F      A  +ML+VHH+G
Sbjct: 9   PGTTAERSVEHVDETQSPWVTIVWDDPVNLMNYVAYVFQQLFGYSETEATNLMLQVHHEG 68

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  A E  E      ++ S+ H   L   ++Q 
Sbjct: 69  KAVVSCGARESME------IDVSKLHAAGLWATLQQD 99


>gi|240169486|ref|ZP_04748145.1| hypothetical protein MkanA1_09246 [Mycobacterium kansasii ATCC
           12478]
          Length = 101

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 34/81 (41%), Gaps = 6/81 (7%)

Query: 58  KLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKV 117
             +  ++ +D    M +V +V Q  F      A  +ML+VH++G       + E  E+ V
Sbjct: 26  SPWVTVVWDDPVNLMSYVTYVFQKLFGYSEPHATKLMLQVHNEGKAVVSAGSREAMEVDV 85

Query: 118 NQVMNYSRQHQYPLQCIMEQK 138
                 S+ H   L   M+Q 
Sbjct: 86  ------SKLHAAGLWATMQQD 100


>gi|254389805|ref|ZP_05005029.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces
           clavuligerus ATCC 27064]
 gi|197703516|gb|EDY49328.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces
           clavuligerus ATCC 27064]
          Length = 104

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 6/85 (7%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
                 +  L+ ND    M +V +V Q +F    + A+ +ML VH++G       + E  
Sbjct: 24  PEPDVPWVTLVHNDPVNLMSYVTYVFQAYFGYSKDKARKLMLDVHNKGRAVVSSGSREEM 83

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQK 138
           E  V  +      H Y L   + Q 
Sbjct: 84  ERDVQAM------HGYGLWATLSQD 102


>gi|326779067|ref|ZP_08238332.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces cf.
           griseus XylebKG-1]
 gi|326659400|gb|EGE44246.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces cf.
           griseus XylebKG-1]
          Length = 105

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 35/94 (37%), Gaps = 6/94 (6%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           DS     +       +  L+ ND    M +V +V Q +F    + A  +M+ VH +G   
Sbjct: 16  DSAEEAFAVPEPDVPWVTLVHNDPVNLMSYVTYVFQAYFGYPKDKAHRLMMDVHQKGRAV 75

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               + E  E  V  +      H Y L   + Q 
Sbjct: 76  VSSGSREEMERDVQAM------HGYGLWATLTQD 103


>gi|223936983|ref|ZP_03628891.1| ATP-dependent Clp protease adaptor protein ClpS [bacterium
           Ellin514]
 gi|223894264|gb|EEF60717.1| ATP-dependent Clp protease adaptor protein ClpS [bacterium
           Ellin514]
          Length = 101

 Score = 86.8 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M +    E    ++ E + +SK  +   Y V+  ND    M++V HV Q  F  + + A+
Sbjct: 1   MAETATPEIMPDVEQEEQAASKSELEPGYLVVCWNDPVNLMDYVSHVFQKVFGWNRQKAE 60

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             ML+VH+QG       + E AE  V+Q+  YS      L   ME+ 
Sbjct: 61  QHMLEVHNQGKSVLVRESMEKAEHFVHQLQKYS------LHATMERD 101


>gi|87310728|ref|ZP_01092855.1| hypothetical protein DSM3645_06866 [Blastopirellula marina DSM
           3645]
 gi|87286485|gb|EAQ78392.1| hypothetical protein DSM3645_06866 [Blastopirellula marina DSM
           3645]
          Length = 117

 Score = 86.8 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 40/98 (40%)

Query: 30  SRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET 89
           +  +          + S+ +  +K +    Y V+L ND+    ++VI ++++ F    E 
Sbjct: 3   NNESAVAEPWEATTVKSKPKNDTKRKKQPRYNVILWNDDDHTYDYVILMMRDLFGHPVEA 62

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQH 127
              I   V   G   C     E AE+K +Q+  Y +  
Sbjct: 63  GFKIAETVDAAGRAICLTTTREHAELKRDQIHAYGKDE 100


>gi|269128072|ref|YP_003301442.1| ATP-dependent Clp protease adaptor protein ClpS [Thermomonospora
           curvata DSM 43183]
 gi|268313030|gb|ACY99404.1| ATP-dependent Clp protease adaptor protein ClpS [Thermomonospora
           curvata DSM 43183]
          Length = 97

 Score = 86.8 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 35/102 (34%), Gaps = 6/102 (5%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +           R     R    +  ++ ND    M +V +V Q  F      A+ +ML 
Sbjct: 1   MTAPAPVELDRPRSDEDHRPDLPWLTIVWNDPINLMSYVTYVFQTVFGYPKPKAEKLMLD 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           VHH+G         E  E  V  +      H Y L   +++ 
Sbjct: 61  VHHKGRAVVASGGREEMERYVEIL------HSYGLWATVKRD 96


>gi|297194131|ref|ZP_06911529.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197721956|gb|EDY65864.1| ATP-dependent Clp protease adapter protein clpS [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 100

 Score = 86.8 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 35/94 (37%), Gaps = 6/94 (6%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           +S     +       +  L+ ND    M +V +V Q +F    + A  +ML VHH+G   
Sbjct: 11  ESAEEAHAVPEPDVPWVTLVHNDPVNLMSYVTYVFQAYFGYSKDKAHKLMLDVHHKGRAV 70

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                 E  E  V  +      H Y L   + Q 
Sbjct: 71  VSSGTREEMERDVQAM------HGYGLWATLTQD 98


>gi|158338702|ref|YP_001519879.1| ATP-dependent Clp protease adaptor protein ClpS [Acaryochloris
           marina MBIC11017]
 gi|158308943|gb|ABW30560.1| ATP-dependent Clp protease adaptor protein ClpS [Acaryochloris
           marina MBIC11017]
          Length = 93

 Score = 86.8 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 7/95 (7%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIG 103
           ++  + S+  ++   YRVLL ND++  ME V+ VL Q         A  +M++ H  GI 
Sbjct: 4   ETLEKRSTSRKLAPKYRVLLHNDDFNSMEHVVQVLIQTVPNLTQPQAVSVMMEAHTNGIA 63

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                A+E AE     +        + L   +E  
Sbjct: 64  LVITCAFEHAEFYCETLKM------HGLTSTIEPD 92


>gi|15608471|ref|NP_215847.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis H37Rv]
 gi|15840786|ref|NP_335823.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis CDC1551]
 gi|31792527|ref|NP_855020.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           bovis AF2122/97]
 gi|121637262|ref|YP_977485.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           bovis BCG str. Pasteur 1173P2]
 gi|148661120|ref|YP_001282643.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis H37Ra]
 gi|148822554|ref|YP_001287308.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis F11]
 gi|167969078|ref|ZP_02551355.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis H37Ra]
 gi|215403178|ref|ZP_03415359.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis 02_1987]
 gi|215410976|ref|ZP_03419784.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis 94_M4241A]
 gi|215426660|ref|ZP_03424579.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis T92]
 gi|215430217|ref|ZP_03428136.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis EAS054]
 gi|215445513|ref|ZP_03432265.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis T85]
 gi|218753042|ref|ZP_03531838.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis GM 1503]
 gi|224989736|ref|YP_002644423.1| ATP-dependent Clp protease adaptor protein [Mycobacterium bovis BCG
           str. Tokyo 172]
 gi|253799621|ref|YP_003032622.1| hypothetical protein TBMG_02647 [Mycobacterium tuberculosis KZN
           1435]
 gi|254231583|ref|ZP_04924910.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|254364228|ref|ZP_04980274.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254550343|ref|ZP_05140790.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis '98-R604 INH-RIF-EM']
 gi|260186272|ref|ZP_05763746.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis CPHL_A]
 gi|260200388|ref|ZP_05767879.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis T46]
 gi|260204592|ref|ZP_05772083.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis K85]
 gi|289442773|ref|ZP_06432517.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289446929|ref|ZP_06436673.1| ATP-dependent Clp protease adaptor protein clpS [Mycobacterium
           tuberculosis CPHL_A]
 gi|289554877|ref|ZP_06444087.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289573997|ref|ZP_06454224.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis K85]
 gi|289745083|ref|ZP_06504461.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis 02_1987]
 gi|289749887|ref|ZP_06509265.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289753413|ref|ZP_06512791.1| ATP-dependent Clp protease adapter protein clpS [Mycobacterium
           tuberculosis EAS054]
 gi|289757436|ref|ZP_06516814.1| ATP-dependent Clp protease adapter protein clpS [Mycobacterium
           tuberculosis T85]
 gi|289761492|ref|ZP_06520870.1| ATP-dependent Clp protease adaptor protein clpS [Mycobacterium
           tuberculosis GM 1503]
 gi|294994889|ref|ZP_06800580.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis 210]
 gi|297633884|ref|ZP_06951664.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis KZN 4207]
 gi|297730872|ref|ZP_06959990.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis KZN R506]
 gi|298524838|ref|ZP_07012247.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis 94_M4241A]
 gi|306775510|ref|ZP_07413847.1| hypothetical protein TMAG_03478 [Mycobacterium tuberculosis
           SUMu001]
 gi|306780660|ref|ZP_07418997.1| hypothetical protein TMBG_01162 [Mycobacterium tuberculosis
           SUMu002]
 gi|306784061|ref|ZP_07422383.1| hypothetical protein TMCG_00966 [Mycobacterium tuberculosis
           SUMu003]
 gi|306788422|ref|ZP_07426744.1| hypothetical protein TMDG_01214 [Mycobacterium tuberculosis
           SUMu004]
 gi|306792751|ref|ZP_07431053.1| hypothetical protein TMEG_01233 [Mycobacterium tuberculosis
           SUMu005]
 gi|306797155|ref|ZP_07435457.1| hypothetical protein TMFG_02526 [Mycobacterium tuberculosis
           SUMu006]
 gi|306803034|ref|ZP_07439702.1| hypothetical protein TMHG_00518 [Mycobacterium tuberculosis
           SUMu008]
 gi|306807228|ref|ZP_07443896.1| hypothetical protein TMGG_01898 [Mycobacterium tuberculosis
           SUMu007]
 gi|306967425|ref|ZP_07480086.1| hypothetical protein TMIG_03011 [Mycobacterium tuberculosis
           SUMu009]
 gi|306971618|ref|ZP_07484279.1| hypothetical protein TMJG_03719 [Mycobacterium tuberculosis
           SUMu010]
 gi|307079330|ref|ZP_07488500.1| hypothetical protein TMKG_01834 [Mycobacterium tuberculosis
           SUMu011]
 gi|307083895|ref|ZP_07493008.1| hypothetical protein TMLG_03423 [Mycobacterium tuberculosis
           SUMu012]
 gi|313658205|ref|ZP_07815085.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis KZN V2475]
 gi|54036860|sp|P67648|CLPS_MYCBO RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|54041057|sp|P67647|CLPS_MYCTU RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|158512947|sp|A1KIC1|CLPS_MYCBP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|158513366|sp|A5U231|CLPS_MYCTA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|254763820|sp|C1AMX6|CLPS_MYCBT RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|1340097|emb|CAA98095.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|13880981|gb|AAK45637.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
 gi|31618116|emb|CAD94227.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97]
 gi|121492909|emb|CAL71380.1| Conserved hypothetical protein [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|124600642|gb|EAY59652.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|134149742|gb|EBA41787.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148505272|gb|ABQ73081.1| ATP-dependent Clp protease adaptor protein [Mycobacterium
           tuberculosis H37Ra]
 gi|148721081|gb|ABR05706.1| conserved hypothetical protein [Mycobacterium tuberculosis F11]
 gi|224772849|dbj|BAH25655.1| ATP-dependent Clp protease adaptor protein [Mycobacterium bovis BCG
           str. Tokyo 172]
 gi|253321124|gb|ACT25727.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           1435]
 gi|289415692|gb|EFD12932.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289419887|gb|EFD17088.1| ATP-dependent Clp protease adaptor protein clpS [Mycobacterium
           tuberculosis CPHL_A]
 gi|289439509|gb|EFD22002.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289538428|gb|EFD43006.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis K85]
 gi|289685611|gb|EFD53099.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis 02_1987]
 gi|289690474|gb|EFD57903.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289694000|gb|EFD61429.1| ATP-dependent Clp protease adapter protein clpS [Mycobacterium
           tuberculosis EAS054]
 gi|289708998|gb|EFD73014.1| ATP-dependent Clp protease adaptor protein clpS [Mycobacterium
           tuberculosis GM 1503]
 gi|289713000|gb|EFD77012.1| ATP-dependent Clp protease adapter protein clpS [Mycobacterium
           tuberculosis T85]
 gi|298494632|gb|EFI29926.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           tuberculosis 94_M4241A]
 gi|308215982|gb|EFO75381.1| hypothetical protein TMAG_03478 [Mycobacterium tuberculosis
           SUMu001]
 gi|308326489|gb|EFP15340.1| hypothetical protein TMBG_01162 [Mycobacterium tuberculosis
           SUMu002]
 gi|308331130|gb|EFP19981.1| hypothetical protein TMCG_00966 [Mycobacterium tuberculosis
           SUMu003]
 gi|308334971|gb|EFP23822.1| hypothetical protein TMDG_01214 [Mycobacterium tuberculosis
           SUMu004]
 gi|308338777|gb|EFP27628.1| hypothetical protein TMEG_01233 [Mycobacterium tuberculosis
           SUMu005]
 gi|308342418|gb|EFP31269.1| hypothetical protein TMFG_02526 [Mycobacterium tuberculosis
           SUMu006]
 gi|308346329|gb|EFP35180.1| hypothetical protein TMGG_01898 [Mycobacterium tuberculosis
           SUMu007]
 gi|308350252|gb|EFP39103.1| hypothetical protein TMHG_00518 [Mycobacterium tuberculosis
           SUMu008]
 gi|308354901|gb|EFP43752.1| hypothetical protein TMIG_03011 [Mycobacterium tuberculosis
           SUMu009]
 gi|308358845|gb|EFP47696.1| hypothetical protein TMJG_03719 [Mycobacterium tuberculosis
           SUMu010]
 gi|308362782|gb|EFP51633.1| hypothetical protein TMKG_01834 [Mycobacterium tuberculosis
           SUMu011]
 gi|308366429|gb|EFP55280.1| hypothetical protein TMLG_03423 [Mycobacterium tuberculosis
           SUMu012]
 gi|323720148|gb|EGB29251.1| hypothetical protein TMMG_02032 [Mycobacterium tuberculosis
           CDC1551A]
 gi|326902954|gb|EGE49887.1| hypothetical protein TBPG_00811 [Mycobacterium tuberculosis W-148]
 gi|328459367|gb|AEB04790.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           4207]
          Length = 101

 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 6/83 (7%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
             + +  ++ +D    M +V +V Q  F      A  +ML+VH++G       + E  E+
Sbjct: 24  TDRAWVTIVWDDPVNLMSYVTYVFQKLFGYSEPHATKLMLQVHNEGKAVVSAGSRESMEV 83

Query: 116 KVNQVMNYSRQHQYPLQCIMEQK 138
            V      S+ H   L   M+Q 
Sbjct: 84  DV------SKLHAAGLWATMQQD 100


>gi|282901708|ref|ZP_06309624.1| ATP-dependent Clp protease adaptor protein ClpS [Cylindrospermopsis
           raciborskii CS-505]
 gi|281193471|gb|EFA68452.1| ATP-dependent Clp protease adaptor protein ClpS [Cylindrospermopsis
           raciborskii CS-505]
          Length = 107

 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 1/71 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    Y+V+++ND++   E V   L         E A  +  +VH++G     V   E A
Sbjct: 28  KPYPNYKVIVLNDDFNTFEHVAKSLMKYIPGMTTEQAWELTNQVHYEGQAIVWVGPQEQA 87

Query: 114 EMKVNQVMNYS 124
           E+   Q+    
Sbjct: 88  ELYHQQLRRAG 98


>gi|17231817|ref|NP_488365.1| ATP-dependent Clp protease adaptor protein ClpS [Nostoc sp. PCC
           7120]
 gi|17133461|dbj|BAB76024.1| asl4325 [Nostoc sp. PCC 7120]
          Length = 93

 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 41/95 (43%), Gaps = 7/95 (7%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIG 103
           ++  + S+  ++   YRVLL ND++  ME+V+ VL           A  IM++ H  G+ 
Sbjct: 4   ETIEKRSTSRKLAPRYRVLLHNDDHNSMEYVVQVLITTVPSLTQPQAVSIMMEAHTNGLA 63

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                A E AE     + +      + L   +E  
Sbjct: 64  LVITCAQEHAEFYCETLKD------HGLSSTIEPD 92


>gi|182438416|ref|YP_001826135.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|178466932|dbj|BAG21452.1| putative ATP-dependent Clp protease adaptor protein ClpS
           [Streptomyces griseus subsp. griseus NBRC 13350]
          Length = 105

 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 35/94 (37%), Gaps = 6/94 (6%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           D+     +       +  L+ ND    M +V +V Q +F    + A  +M+ VH +G   
Sbjct: 16  DAAEEAFAVPEPDVPWVTLVHNDPVNLMSYVTYVFQAYFGYPKDKAHRLMMDVHQKGRAV 75

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               + E  E  V  +      H Y L   + Q 
Sbjct: 76  VSSGSREEMERDVQAM------HGYGLWATLTQD 103


>gi|323359749|ref|YP_004226145.1| hypothetical protein MTES_3301 [Microbacterium testaceum StLB037]
 gi|323276120|dbj|BAJ76265.1| uncharacterized conserved protein [Microbacterium testaceum
           StLB037]
          Length = 102

 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 6/83 (7%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
            P  ++ ++ ND    M +V HV + +F  D  TA+ +ML VHH G         E+ E 
Sbjct: 24  PPSSWQTVVWNDPVNLMSYVSHVFRTYFGFDSATAERLMLAVHHDGHAVVARGPREVMEA 83

Query: 116 KVNQVMNYSRQHQYPLQCIMEQK 138
             + + +      Y L   + ++
Sbjct: 84  HTHAMHD------YGLWATVRKE 100


>gi|326773727|ref|ZP_08233010.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces
           viscosus C505]
 gi|326636957|gb|EGE37860.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces
           viscosus C505]
          Length = 105

 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 41/96 (42%), Gaps = 6/96 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              + E+   S+VR  +L+  ++ +D    M +V  V  ++F      A+  M++VH  G
Sbjct: 2   PVAEPEILEESRVRAQRLWCTVVHDDPVNTMSYVTWVFHSYFGFSLPVAEARMMQVHTTG 61

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
                  A E  E+ V  +      H Y L+  +E 
Sbjct: 62  RAVVSQGARERMEVDVTAM------HGYGLRATIEP 91


>gi|283780183|ref|YP_003370938.1| ATP-dependent Clp protease adaptor protein ClpS [Pirellula staleyi
           DSM 6068]
 gi|283438636|gb|ADB17078.1| ATP-dependent Clp protease adaptor protein ClpS [Pirellula staleyi
           DSM 6068]
          Length = 118

 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 38/83 (45%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
             ++++     K +    Y V+L ND+    ++VI +++  F       K I  +V+ +G
Sbjct: 14  EVVEAKPVQKKKPKRQPRYHVILWNDDDHTFDYVIRMMKELFGHPEVKGKQIADEVNEKG 73

Query: 102 IGECGVYAYEIAEMKVNQVMNYS 124
              C     E AE+K +Q+  + 
Sbjct: 74  KAICLTTTLEHAELKRDQIHAFG 96


>gi|147805878|emb|CAN78258.1| hypothetical protein VITISV_026645 [Vitis vinifera]
          Length = 135

 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 40/106 (37%), Gaps = 7/106 (6%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAK 91
            +  I       +SE       ++   YRVLL NDNY   E+V+ VL         + A 
Sbjct: 31  ERPTIERIMPGRESEFDLRKSRKMSPPYRVLLHNDNYNKREYVVQVLMKVIPGMTLDNAV 90

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            IM + HH G+    + A   AE    Q+          L   +E 
Sbjct: 91  NIMQEAHHNGMSVVIICAQVDAEXHCMQLR------GNGLLSSIEP 130


>gi|126657545|ref|ZP_01728701.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp.
           CCY0110]
 gi|172037153|ref|YP_001803654.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp.
           ATCC 51142]
 gi|126621249|gb|EAZ91962.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp.
           CCY0110]
 gi|171698607|gb|ACB51588.1| putative ATP-dependent Clp protease, adaptor protein [Cyanothece
           sp. ATCC 51142]
          Length = 97

 Score = 86.0 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 35/90 (38%), Gaps = 7/90 (7%)

Query: 50  FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIGECGVY 108
            S+  +    YRVLL ND++  ME+V+  L           A  IM++ H  G       
Sbjct: 13  TSTVRKPAPRYRVLLHNDDFNSMEYVVQTLMQTVSGMTQPQAVDIMMEAHTNGTALVITC 72

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           A E AE     + N      + L   +E  
Sbjct: 73  ALEPAEFYCETLKN------HGLTSTIEPD 96


>gi|118472588|ref|YP_889165.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           smegmatis str. MC2 155]
 gi|118173875|gb|ABK74771.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           smegmatis str. MC2 155]
          Length = 100

 Score = 86.0 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 40/107 (37%), Gaps = 8/107 (7%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M     A      + +V        P  +  ++ +D    M +V +V Q  F      A 
Sbjct: 1   MVTPAKARPGTREEVDVASVESTEAP--WVTIVWDDPVNLMSYVTYVFQKLFGYSEPHAT 58

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +ML+VH++G       + E  E+ V      S+ H   L   M+Q 
Sbjct: 59  KLMLQVHNEGKAVVSAGSRESMEVDV------SKLHAAGLWATMQQD 99


>gi|54023053|ref|YP_117295.1| ATP-dependent Clp protease adaptor protein ClpS [Nocardia farcinica
           IFM 10152]
 gi|67460226|sp|Q5Z0W0|CLPS_NOCFA RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|54014561|dbj|BAD55931.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 106

 Score = 86.0 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 33/83 (39%), Gaps = 6/83 (7%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
             + +  ++ +D    M +V ++ Q  F      A  +ML+VH++G       + +  E 
Sbjct: 29  EDRPWVTVVWDDPVNLMHYVTYIFQKLFGYSKAKATELMLQVHNEGKAVVSSGSRDKMEH 88

Query: 116 KVNQVMNYSRQHQYPLQCIMEQK 138
            V       R H   L   M++ 
Sbjct: 89  DVR------RLHAAGLWATMQRD 105


>gi|260434316|ref|ZP_05788286.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 8109]
 gi|260412190|gb|EEX05486.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 8109]
          Length = 123

 Score = 86.0 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 43/121 (35%), Gaps = 9/121 (7%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           L L  F  M  +  +          LD       K      Y+VLL ND    ME+V+  
Sbjct: 10  LNLKVFGSMVMAVDSPSQKPGGAAVLDKAPERVRK--RSPRYKVLLHNDPVNSMEYVVAT 67

Query: 79  LQNFF-YKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           LQ        +    +ML+ H+ G+G   V   E AE     + +        L   +E 
Sbjct: 68  LQQVVPQLSEQDCMAVMLEAHNTGVGLVIVCDIEPAEFYCEMLKSK------GLTSSIEP 121

Query: 138 K 138
           +
Sbjct: 122 E 122


>gi|302545011|ref|ZP_07297353.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302462629|gb|EFL25722.1| ATP-dependent Clp protease adaptor protein ClpS [Streptomyces
           himastatinicus ATCC 53653]
          Length = 100

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 35/85 (41%), Gaps = 6/85 (7%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
                 +  ++ ND    M +V +V Q++F    + A  +ML VHH+G       + E  
Sbjct: 21  PEPDVPWVTVVHNDPVNLMSYVTYVFQSYFGYSKDKAHKLMLDVHHKGRAIVSSGSREEM 80

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQK 138
           E  V  +      H Y L   + Q+
Sbjct: 81  ERDVQAM------HGYGLWATLTQE 99


>gi|225455872|ref|XP_002274839.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297734178|emb|CBI15425.3| unnamed protein product [Vitis vinifera]
          Length = 157

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 45/128 (35%), Gaps = 9/128 (7%)

Query: 11  HRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYT 70
           HR     + A           + +  I       +SE       ++   YRVLL NDNY 
Sbjct: 33  HRTMLMTVSAAAPGK--GSGVLERPTIERIMPGRESEFDLRKSRKMSPPYRVLLHNDNYN 90

Query: 71  PMEFVIHVLQNF-FYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQY 129
             E+V+ VL         + A  IM + HH G+    + A   AE    Q+         
Sbjct: 91  KREYVVQVLMKVIPGMTLDNAVNIMQEAHHNGMSVVIICAQVDAEDHCMQLR------GN 144

Query: 130 PLQCIMEQ 137
            L   +E 
Sbjct: 145 GLLSSIEP 152


>gi|229821222|ref|YP_002882748.1| ATP-dependent Clp protease adaptor protein ClpS [Beutenbergia
           cavernae DSM 12333]
 gi|229567135|gb|ACQ80986.1| ATP-dependent Clp protease adaptor protein ClpS [Beutenbergia
           cavernae DSM 12333]
          Length = 113

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
            + VR  + +  ++ ND    M +V +V Q +F      A+ +M +VH +G       + 
Sbjct: 30  ETAVRHDRPWHTIVWNDPVNLMSYVTYVFQTYFGYSRAKAEKLMRQVHTEGKSIVSHGSR 89

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           E  E+ V  +      H Y L   + Q 
Sbjct: 90  ERMEVDVQAM------HSYGLWATLGQD 111


>gi|170078679|ref|YP_001735317.1| putative ATP-dependent Clp protease adaptor protein [Synechococcus
           sp. PCC 7002]
 gi|169886348|gb|ACB00062.1| putative ATP-dependent Clp protease adaptor protein [Synechococcus
           sp. PCC 7002]
          Length = 97

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 32/84 (38%), Gaps = 1/84 (1%)

Query: 40  FDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVH 98
               +  E    +  +    ++V+++ND++   E V H L         + A  +  +VH
Sbjct: 3   PAPGILKESDRQTVRKPYPNFKVIVLNDDFNTFEHVAHCLMTYIPNMTADQAWNLTNQVH 62

Query: 99  HQGIGECGVYAYEIAEMKVNQVMN 122
             G     V   E AE+   Q+  
Sbjct: 63  FDGQAIVWVGPQEPAELYHQQLRR 86


>gi|329947434|ref|ZP_08294638.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces sp.
           oral taxon 170 str. F0386]
 gi|328525184|gb|EGF52235.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces sp.
           oral taxon 170 str. F0386]
          Length = 111

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 40/96 (41%), Gaps = 6/96 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              + E+   S+ R  +L+  ++ +D    M +V  V  ++F      A+  M++VH  G
Sbjct: 6   PVAEPEILEESRARAQRLWCTVVHDDPINTMSYVTWVFHSYFGFSLPVAEARMMRVHTTG 65

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
                  A E  E+ V  +      H Y L+  +E 
Sbjct: 66  RAVVSRGARERMEVDVTAM------HGYGLRATIEP 95


>gi|152967709|ref|YP_001363493.1| ATP-dependent Clp protease adaptor protein ClpS [Kineococcus
           radiotolerans SRS30216]
 gi|151362226|gb|ABS05229.1| ATP-dependent Clp protease adaptor protein ClpS [Kineococcus
           radiotolerans SRS30216]
          Length = 99

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 31/90 (34%), Gaps = 6/90 (6%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVY 108
                      +  L+ ND    M +V +V +  F      A  +ML VH +G       
Sbjct: 15  ETDLTTVPDTPWVTLVWNDPVNLMSYVAYVFRTHFGYSQAKADALMLDVHQKGRAAVSAG 74

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + E  E  V  +      H Y L   +++ 
Sbjct: 75  SREAMERDVEAM------HGYGLWATLQKD 98


>gi|282895992|ref|ZP_06304023.1| ATP-dependent Clp protease adaptor protein ClpS [Raphidiopsis
           brookii D9]
 gi|281199102|gb|EFA73972.1| ATP-dependent Clp protease adaptor protein ClpS [Raphidiopsis
           brookii D9]
          Length = 107

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 30/71 (42%), Gaps = 1/71 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    Y+++++ND++   E V   L         E A  +  +VH++G     V   E A
Sbjct: 28  KPYPNYKIIVLNDDFNTFEHVAKSLMKYIPGMTTEQAWELTNQVHYEGQAIVWVGPQEQA 87

Query: 114 EMKVNQVMNYS 124
           E+   Q+    
Sbjct: 88  ELYHQQLRRAG 98


>gi|296129169|ref|YP_003636419.1| ATP-dependent Clp protease adaptor protein ClpS [Cellulomonas
           flavigena DSM 20109]
 gi|296020984|gb|ADG74220.1| ATP-dependent Clp protease adaptor protein ClpS [Cellulomonas
           flavigena DSM 20109]
          Length = 100

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 35/97 (36%), Gaps = 6/97 (6%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               D+             +  ++ ND    M +V +V Q  F    E A+ +M +VH +
Sbjct: 7   TTAPDTRPDVDEASSTADAWVTIVWNDPVNLMTYVTYVFQTHFGYAREKAERLMRQVHEE 66

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G         E  E+ V  +      H Y L   +++
Sbjct: 67  GRAVVSTGNREAMEVDVQAM------HSYGLWATLQR 97


>gi|170078877|ref|YP_001735515.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           PCC 7002]
 gi|169886546|gb|ACB00260.1| ATP-dependent Clp protease adaptor protein [Synechococcus sp. PCC
           7002]
          Length = 95

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 37/95 (38%), Gaps = 8/95 (8%)

Query: 46  SEVRFSSKVRVP-KLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIG 103
            E R +S +R P   YRVLL ND++  ME V+  L           A  IM++ H  GI 
Sbjct: 6   IEQRSTSTIRKPAPRYRVLLHNDDFNSMEHVVQTLMQTVAGLTQPQAVSIMMEAHTNGIA 65

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  E AE     +        + L   +E  
Sbjct: 66  LVITCVQEHAEFYCETLKM------HGLTSTIEPD 94


>gi|254446082|ref|ZP_05059558.1| ATP-dependent Clp protease adaptor protein ClpS [Verrucomicrobiae
           bacterium DG1235]
 gi|198260390|gb|EDY84698.1| ATP-dependent Clp protease adaptor protein ClpS [Verrucomicrobiae
           bacterium DG1235]
          Length = 98

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 39/92 (42%), Gaps = 6/92 (6%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E     +  +  ++ V+++ND    M +V  VL+         A+  M++VH +G     
Sbjct: 10  ETETKDETALSDVWGVIVLNDPVNLMSYVTMVLERVLRMSRSKAEEHMMEVHQKGRSLVW 69

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               E AE  V Q+  +     + L  I+E+ 
Sbjct: 70  KGNREKAEGYVYQLQEW-----H-LSAILERD 95


>gi|148972604|ref|ZP_01811408.1| ATP-dependent Clp protease adaptor protein ClpS [Leptolyngbya
           valderiana BDU 20041]
 gi|148872733|gb|EDL71122.1| ATP-dependent Clp protease adaptor protein ClpS [Leptolyngbya
           valderiana BDU 20041]
          Length = 93

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 39/95 (41%), Gaps = 7/95 (7%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIG 103
           ++  + S+  +    YRVLL ND++  ME+V+  L +         A  IM++ H  G+ 
Sbjct: 4   ETIEKRSTVRKHAPRYRVLLHNDDFNTMEYVVQTLVKTVPGLTQPQAVSIMMEAHTNGMA 63

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                A E AE     +        + L   +E  
Sbjct: 64  LVITCAQEHAEFYCETLRR------HGLSSSIEPD 92


>gi|218246012|ref|YP_002371383.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           8801]
 gi|257059062|ref|YP_003136950.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           8802]
 gi|218166490|gb|ACK65227.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           8801]
 gi|256589228|gb|ACV00115.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           8802]
          Length = 97

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 35/92 (38%), Gaps = 7/92 (7%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIGECG 106
              ++  +    YRVLL ND++  ME+V+  L           A  IM++ H  G     
Sbjct: 11  TSSATVRKPAPRYRVLLHNDDFNSMEYVVQTLMQTVAGMTQPQAVDIMMEAHTNGTALVI 70

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             A E AE     + N      + L   +E  
Sbjct: 71  TCALEHAEFYCETLKN------HGLTSSIEPD 96


>gi|262201899|ref|YP_003273107.1| ATP-dependent Clp protease adaptor protein ClpS [Gordonia
           bronchialis DSM 43247]
 gi|262085246|gb|ACY21214.1| ATP-dependent Clp protease adaptor protein ClpS [Gordonia
           bronchialis DSM 43247]
          Length = 112

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 19/118 (16%), Positives = 38/118 (32%), Gaps = 7/118 (5%)

Query: 21  LMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ 80
           +   +  A         +      D EV       + + +  ++ +D    M +V  V Q
Sbjct: 1   MSPDVTRAHEATPGGPGSGGAAVADPEV-ADGATDLDRPWMTIVWDDPVNLMRYVTFVFQ 59

Query: 81  NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             F      A  +M++VH +G         +  E  V ++          L   M++ 
Sbjct: 60  KIFGYSESKANQLMMQVHTEGKAVVSSGDRDKVETDVRKLHAA------GLWATMQRD 111


>gi|320534619|ref|ZP_08035064.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces sp.
           oral taxon 171 str. F0337]
 gi|320133139|gb|EFW25642.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces sp.
           oral taxon 171 str. F0337]
          Length = 111

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 40/96 (41%), Gaps = 6/96 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
             +  E    S+VR  +L+  ++ +D    M +V  V  ++F      A+  M++VH  G
Sbjct: 6   PVVKPETLEESRVRAQRLWCTVVHDDPINTMSYVTWVFHSYFGFSLPVAEARMMQVHTAG 65

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
                  A E  E+ V  +      H Y L+  +E 
Sbjct: 66  RAVVSRGARERMEVDVTAM------HGYGLRATIEP 95


>gi|288921262|ref|ZP_06415546.1| ATP-dependent Clp protease adaptor protein ClpS [Frankia sp. EUN1f]
 gi|288347352|gb|EFC81645.1| ATP-dependent Clp protease adaptor protein ClpS [Frankia sp. EUN1f]
          Length = 96

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 32/91 (35%), Gaps = 6/91 (6%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGV 107
                     +L+  ++ ND    M +V +V +  F    + A  +ML VHH+G      
Sbjct: 12  EDVEDLPEDERLWVTIVWNDPINLMSYVTYVFRKLFGYSEQKATKLMLDVHHKGRATVTS 71

Query: 108 YAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              E  E          R H Y L   + Q 
Sbjct: 72  GTREEMEAAAE------RLHTYGLWATIAQD 96


>gi|325068392|ref|ZP_08127065.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces oris
           K20]
          Length = 105

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 40/96 (41%), Gaps = 6/96 (6%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              + E+   S+ R  +L+  ++ +D    M +V  V  ++F      A+  M++VH  G
Sbjct: 2   PVAEPEILEESRARTQRLWCTVVHDDPVNTMSYVTWVFHSYFGFSLPVAEARMMQVHTTG 61

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
                  A E  E+ V  +      H Y L+  +E 
Sbjct: 62  RAVVSQGARERMEVDVTAM------HGYGLRATIEP 91


>gi|319948542|ref|ZP_08022673.1| ATP-dependent Clp protease adaptor protein ClpS [Dietzia cinnamea
           P4]
 gi|319437789|gb|EFV92778.1| ATP-dependent Clp protease adaptor protein ClpS [Dietzia cinnamea
           P4]
          Length = 97

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 41/113 (36%), Gaps = 18/113 (15%)

Query: 26  FMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYK 85
            M  +   +   A+ D  +D+             +  ++ +D    M +V  V Q  F  
Sbjct: 2   AMPSAAPVETTDADLDGGVDN------------PWLTVVWDDPVNLMSYVTFVFQRVFGY 49

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             E A  +MLKVH+ G       + +  E  V ++          L   M+++
Sbjct: 50  SREKAHELMLKVHNDGRAVVSSGSRDKVENDVRKLQEA------GLWATMQRE 96


>gi|256375147|ref|YP_003098807.1| ATP-dependent Clp protease adaptor protein ClpS [Actinosynnema
           mirum DSM 43827]
 gi|255919450|gb|ACU34961.1| ATP-dependent Clp protease adaptor protein ClpS [Actinosynnema
           mirum DSM 43827]
          Length = 99

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 34/101 (33%), Gaps = 10/101 (9%)

Query: 41  DNCLDSEVRFSSKVRV----PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
                   +              +  L+ ND    M +V +V Q  F    + A  +M+ 
Sbjct: 3   TPVEQERTQAEPVAEEGASADSPWMTLVWNDPVNLMSYVTYVFQKVFGYSKDHATKLMMD 62

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           VHH+G       A +  E  V      ++ H   L   M++
Sbjct: 63  VHHKGRAVVSSGAKDKMEADV------AKLHAAGLWATMQR 97


>gi|32477341|ref|NP_870335.1| hypothetical protein RB12137 [Rhodopirellula baltica SH 1]
 gi|32447892|emb|CAD77410.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
 gi|327537948|gb|EGF24645.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodopirellula
           baltica WH47]
          Length = 116

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 39/90 (43%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
           AE D   + E R   K +    Y V+L +D     ++VI +++  F    E    +  +V
Sbjct: 9   AEPDVVTEEEQRSDRKPKRQPPYHVILWDDTDHSYDYVISMMKRLFRMPIEKGYQVAKEV 68

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQH 127
              G   C     E+AE+K +Q+  + +  
Sbjct: 69  DKSGRAICMTTTLELAELKRDQIHAFGKDE 98


>gi|300864591|ref|ZP_07109450.1| ATP-dependent Clp protease adaptor [Oscillatoria sp. PCC 6506]
 gi|300337415|emb|CBN54598.1| ATP-dependent Clp protease adaptor [Oscillatoria sp. PCC 6506]
          Length = 97

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 2/74 (2%)

Query: 49  RFSSKVRVP-KLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGECG 106
           R S   R P   Y+V+++ND++   + V   L +       + A  +  +VH++G     
Sbjct: 11  RSSQVTRKPYPNYKVIVLNDDFNTFQHVSECLVKYIPGMTSDRAWKLTNQVHYEGQATVW 70

Query: 107 VYAYEIAEMKVNQV 120
           V   E AE+   Q+
Sbjct: 71  VGPQEQAELYHMQL 84


>gi|56750848|ref|YP_171549.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus
           elongatus PCC 6301]
 gi|81596329|sp|Q5N3U1|CLPS_SYNP6 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|56685807|dbj|BAD79029.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 91

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIGEC 105
           +   ++K ++   YRVLL ND++ PME+V+ VL           A  IM++ H  G G  
Sbjct: 8   KPETTTKRKIAPRYRVLLHNDDFNPMEYVVMVLMQTVPSLTQPQAVDIMMEAHTNGTGLV 67

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQY 129
                E AE    Q+ ++  + Q+
Sbjct: 68  ITCDIEPAEFYCEQLKSHGLEQQH 91


>gi|466913|gb|AAA50888.1| B1549_C2_207 [Mycobacterium leprae]
          Length = 94

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
            +  ++ +D    M +V +V Q  F      A  +ML+VH++G     + + E  E+ V 
Sbjct: 20  RWVTIVWDDPVNLMAYVTYVFQKLFGYSEPHATKLMLQVHNEGKAVVSMGSRESMEVDV- 78

Query: 119 QVMNYSRQHQYPLQCIMEQK 138
                S+ H   L   M+Q 
Sbjct: 79  -----SKLHAAGLWATMQQD 93


>gi|226307371|ref|YP_002767331.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodococcus
           erythropolis PR4]
 gi|226186488|dbj|BAH34592.1| putative ATP-dependent Clp protease adaptor protein ClpS
           [Rhodococcus erythropolis PR4]
          Length = 103

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 32/82 (39%), Gaps = 6/82 (7%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
            + +  ++ +D    M +V +V Q  F      A  +M++VH +G       + +  E  
Sbjct: 26  DRPWVTIVWDDPVNLMHYVTYVFQKLFGYSKAKATDLMMQVHSEGKAVVSSGSRDKMEAD 85

Query: 117 VNQVMNYSRQHQYPLQCIMEQK 138
           V       R H   L   M++ 
Sbjct: 86  VR------RLHAAGLWATMQRD 101


>gi|119510612|ref|ZP_01629742.1| ATP-dependent Clp protease adaptor protein ClpS [Nodularia
           spumigena CCY9414]
 gi|119464773|gb|EAW45680.1| ATP-dependent Clp protease adaptor protein ClpS [Nodularia
           spumigena CCY9414]
          Length = 108

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 31/71 (43%), Gaps = 1/71 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    Y+V+++ND++   + V   L         + A  +  ++H++G     V   E+A
Sbjct: 29  KTYPNYKVIVLNDDFNTFQHVSECLMKYIPGMTGDRAWDLTNQIHYEGQAIVWVGPQEMA 88

Query: 114 EMKVNQVMNYS 124
           E+   Q+    
Sbjct: 89  ELYHQQLRRAG 99


>gi|186684027|ref|YP_001867223.1| ATP-dependent Clp protease adaptor protein ClpS [Nostoc punctiforme
           PCC 73102]
 gi|186466479|gb|ACC82280.1| ATP-dependent Clp protease adaptor protein ClpS [Nostoc punctiforme
           PCC 73102]
          Length = 93

 Score = 84.9 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 40/95 (42%), Gaps = 7/95 (7%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIG 103
           ++  + S+  ++   YRVLL ND+Y  ME V+  L           A  IM++ H  G+ 
Sbjct: 4   ETIQKPSTTRKLAPRYRVLLHNDDYNSMEHVVQSLIATVPSLTQPQAVSIMMEAHTNGLA 63

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                A E AE     +++      + L   +E  
Sbjct: 64  LVITCALEHAEFYCETLIS------HGLSSTIEPD 92


>gi|116075699|ref|ZP_01472958.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           RS9916]
 gi|116067014|gb|EAU72769.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           RS9916]
          Length = 104

 Score = 84.9 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIMLK 96
                    + +     +    Y+VLL ND    ME+V+  LQ        + A  +ML+
Sbjct: 8   PGPGGAAVLDKQTERVRKRSPRYKVLLHNDPVNSMEYVVSTLQQVVPQLSEQDAMAVMLE 67

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H+ G+G   V   E AE         ++     L   +E +
Sbjct: 68  AHNSGVGLVIVCDLEPAEFYCE--TLKAK----GLTSTLEPE 103


>gi|15827587|ref|NP_301850.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           leprae TN]
 gi|221230064|ref|YP_002503480.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           leprae Br4923]
 gi|13638637|sp|P53423|CLPS_MYCLE RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|13093138|emb|CAC31546.1| conserved hypothetical protein [Mycobacterium leprae]
 gi|219933171|emb|CAR71260.1| conserved hypothetical protein [Mycobacterium leprae Br4923]
          Length = 108

 Score = 84.9 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
            +  ++ +D    M +V +V Q  F      A  +ML+VH++G     + + E  E+ V 
Sbjct: 34  RWVTIVWDDPVNLMAYVTYVFQKLFGYSEPHATKLMLQVHNEGKAVVSMGSRESMEVDV- 92

Query: 119 QVMNYSRQHQYPLQCIMEQK 138
                S+ H   L   M+Q 
Sbjct: 93  -----SKLHAAGLWATMQQD 107


>gi|124024066|ref|YP_001018373.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus str. MIT 9303]
 gi|123964352|gb|ABM79108.1| Uncharacterized conserved protein [Prochlorococcus marinus str. MIT
           9303]
          Length = 120

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 32/131 (24%), Positives = 51/131 (38%), Gaps = 13/131 (9%)

Query: 9   MYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDN 68
           M  R    G L ++  + MA +  +          L+ +     K      Y+VLL ND 
Sbjct: 1   MGERPTYIGALPIV--LAMAVNAPSPS--PGGAAVLEKQTERIRK--QSPHYKVLLHNDP 54

Query: 69  YTPMEFVIHVLQNFF-YKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQH 127
              ME+V+  LQ        + A  +ML+ H+ G+G   V   E AE         ++  
Sbjct: 55  VNSMEYVVVTLQQVVPQLSEQDAMAVMLEAHNTGVGLVIVCDLEPAEFYCE--TLKAK-- 110

Query: 128 QYPLQCIMEQK 138
              L   +EQ+
Sbjct: 111 --GLTSTLEQE 119


>gi|108800817|ref|YP_641014.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium sp.
           MCS]
 gi|119869957|ref|YP_939909.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium sp.
           KMS]
 gi|126436415|ref|YP_001072106.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium sp.
           JLS]
 gi|108771236|gb|ABG09958.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium sp.
           MCS]
 gi|119696046|gb|ABL93119.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium sp.
           KMS]
 gi|126236215|gb|ABN99615.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium sp.
           JLS]
          Length = 88

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
            +  ++ +D    M +V +VLQ  F      A  +ML+VH++G       + E  E+ V 
Sbjct: 14  PWVTIVWDDPVNLMTYVTYVLQKLFGYSEPHATKLMLQVHNEGKAVVSAGSRESMEVDV- 72

Query: 119 QVMNYSRQHQYPLQCIMEQK 138
                S+ H   L   M+Q 
Sbjct: 73  -----SKLHAAGLWATMQQD 87


>gi|226506038|ref|NP_001150373.1| ATP-dependent Clp protease adaptor protein ClpS containing protein
           [Zea mays]
 gi|194701596|gb|ACF84882.1| unknown [Zea mays]
 gi|195610704|gb|ACG27182.1| ATP-dependent Clp protease adaptor protein ClpS containing protein
           [Zea mays]
 gi|195638746|gb|ACG38841.1| ATP-dependent Clp protease adaptor protein ClpS containing protein
           [Zea mays]
          Length = 160

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 37/101 (36%), Gaps = 7/101 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIMLK 96
            +      SE       ++   YRV+L NDNY   E+V+ VL         + A  IM +
Sbjct: 61  EKTTPGRQSEFDVKKSRKMSPPYRVILHNDNYNRREYVVKVLMKVIPGMTVDNAVNIMQE 120

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            H  G+    V +   AE     +          L+  +E 
Sbjct: 121 AHVNGLSVVIVCSQSEAEEHCTSLR------GNGLRSSIEP 155


>gi|120405250|ref|YP_955079.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           vanbaalenii PYR-1]
 gi|119958068|gb|ABM15073.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           vanbaalenii PYR-1]
          Length = 100

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 41/107 (38%), Gaps = 8/107 (7%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M     A      D +VR  +    P  +  ++ +D    M +V +V Q  F      A 
Sbjct: 1   MVTPAKARPGTREDRDVREDATTDAP--WVTIVWDDPVNLMTYVTYVFQKLFGYSEPHAT 58

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +M++VH++G       + E  E+ V       R H   L   ++Q 
Sbjct: 59  KLMMQVHNEGKAVVSAGSRESMEVDVT------RLHAAGLWATLQQD 99


>gi|50954981|ref|YP_062269.1| ATP-dependent Clp protease adaptor protein ClpS [Leifsonia xyli
           subsp. xyli str. CTCB07]
 gi|50951463|gb|AAT89164.1| conserved hypothetical protein [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 97

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 38/96 (39%), Gaps = 8/96 (8%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              D+ +    ++  P  +  ++ ND    M +V +V +++F      A+ +ML VH +G
Sbjct: 7   PERDTGLEARLRLGEP--WVTIVWNDPVNLMSYVTYVFESYFVYPAREAERLMLLVHTEG 64

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
                    E  E  V  +      H + L   + +
Sbjct: 65  KAGVATGTREEMERHVEAM------HGFGLWATLTK 94


>gi|33241103|ref|NP_876045.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|33238633|gb|AAQ00698.1| Uncharacterized conserved protein [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 103

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 38/107 (35%), Gaps = 9/107 (8%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAK 91
           N          +D +     K      Y+VLL ND    M++V+  L Q       + A 
Sbjct: 4   NPGRGPGGAAVVDKQTERVRKT--SPRYKVLLHNDPVNTMDYVVTTLRQVVPQLSEQDAM 61

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +ML+ H+ GIG       E AE     +          L   +E +
Sbjct: 62  AVMLETHNTGIGLVITCDLEPAEFYSESLK------GKGLTSTIEPE 102


>gi|209526864|ref|ZP_03275384.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira maxima
           CS-328]
 gi|209492735|gb|EDZ93070.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira maxima
           CS-328]
          Length = 97

 Score = 84.5 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 49  RFSSKVRVP-KLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIMLKVHHQGIGECG 106
           R S  VR P   Y+V+++ND++   + V + L  +      + A  +  +VH++G     
Sbjct: 11  RSSQTVRKPYPNYKVIVLNDDFNTFQHVANCLMKYLPGMTSDQAWELTNRVHYEGQATVW 70

Query: 107 VYAYEIAEMKVNQV 120
           V   E AE+   Q+
Sbjct: 71  VGPLEQAELYHTQL 84


>gi|242081547|ref|XP_002445542.1| hypothetical protein SORBIDRAFT_07g021160 [Sorghum bicolor]
 gi|241941892|gb|EES15037.1| hypothetical protein SORBIDRAFT_07g021160 [Sorghum bicolor]
          Length = 159

 Score = 84.5 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 37/101 (36%), Gaps = 7/101 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIMLK 96
            +      SE       ++   YRV+L NDNY   E+V+ VL         + A  IM +
Sbjct: 60  EKTTPGRQSEFDVKKSRKMSPPYRVILHNDNYNRREYVVQVLMKVIPGMTVDNAVNIMQE 119

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            H  G+    V +   AE     +          L+  +E 
Sbjct: 120 AHVNGLSVVIVCSQSEAEEHCTSLR------GNGLRSSIEP 154


>gi|227495764|ref|ZP_03926075.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces
           urogenitalis DSM 15434]
 gi|226834693|gb|EEH67076.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces
           urogenitalis DSM 15434]
          Length = 109

 Score = 84.5 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 41/102 (40%), Gaps = 6/102 (5%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           ++        + R  S  +  + +R ++ +D    M++V+ V +++F      A   M++
Sbjct: 1   MSASAPVASPDTREDSATQRLERWRTVVHDDPVNTMDYVVWVFRSYFRFPLSLAHQRMMQ 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           VH  G         E  E+ V  +      H Y L+  +E  
Sbjct: 61  VHTTGRAIVSRGPRERMEVDVTAM------HSYGLRATIEPD 96


>gi|186684201|ref|YP_001867397.1| ATP-dependent Clp protease adaptor [Nostoc punctiforme PCC 73102]
 gi|186466653|gb|ACC82454.1| ATP-dependent Clp protease adaptor protein ClpS [Nostoc punctiforme
           PCC 73102]
          Length = 108

 Score = 84.5 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 35/92 (38%), Gaps = 3/92 (3%)

Query: 36  GIAEFDNCLDSEVRFSSKV--RVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKC 92
            +             SS+V  +    Y+V+++ND++   + V   L         + A  
Sbjct: 8   DVYGMTTAPTITPERSSQVTRKTYPNYKVIVLNDDFNTFQHVAECLMKYIPGMSGDRAWD 67

Query: 93  IMLKVHHQGIGECGVYAYEIAEMKVNQVMNYS 124
           +  +VH++G     V   E AE+   Q+    
Sbjct: 68  LTNQVHYEGQAIVWVGPQEPAELYHQQLRRAG 99


>gi|331695359|ref|YP_004331598.1| ATP-dependent Clp protease adapter protein clpS [Pseudonocardia
           dioxanivorans CB1190]
 gi|326950048|gb|AEA23745.1| ATP-dependent Clp protease adapter protein clpS [Pseudonocardia
           dioxanivorans CB1190]
          Length = 98

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 38/100 (38%), Gaps = 8/100 (8%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
                 ++     +     P  ++ ++ ND    M +V +VLQ  F      A  +ML V
Sbjct: 6   PVPTRQVEEVTDEAGTADTP--WQAIVWNDPVNLMSYVTYVLQKLFGYPEPKATALMLDV 63

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           HH+G         +  E      ++ ++ H   L   M++
Sbjct: 64  HHKGKAAVSSGDKDKIE------IDVAKLHAAGLWATMQR 97


>gi|284929541|ref|YP_003422063.1| hypothetical protein UCYN_10070 [cyanobacterium UCYN-A]
 gi|284809985|gb|ADB95682.1| uncharacterized conserved protein [cyanobacterium UCYN-A]
          Length = 97

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 7/99 (7%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHH 99
           D      +  S+  +    Y+VLL ND++ PM++V+ +L           A  IM++ H 
Sbjct: 4   DVIEKISLNTSTTKKPVPRYKVLLHNDDFNPMDYVVQILMQTISGMTRPQAAEIMMEAHI 63

Query: 100 QGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            G       A+E AE     + N      + L   +E  
Sbjct: 64  SGTALVITCAFEPAEFYRETLKN------HGLSSSIEPD 96


>gi|307150152|ref|YP_003885536.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           7822]
 gi|306980380|gb|ADN12261.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           7822]
          Length = 108

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 29/69 (42%), Gaps = 1/69 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    Y+V+++ND++   E V   L         + A  +  +VH +G     V   E A
Sbjct: 29  KTYPNYKVIVLNDDFNTFEHVAKCLMKYIPGMTSDRAWELTNQVHFEGQAIVWVGPQEQA 88

Query: 114 EMKVNQVMN 122
           E+   Q+  
Sbjct: 89  ELYHQQLRR 97


>gi|291567197|dbj|BAI89469.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira
           platensis NIES-39]
          Length = 97

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 49  RFSSKVRVP-KLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIMLKVHHQGIGECG 106
           R S  VR P   Y+V+++ND++   + V + L  +      + A  +  +VH++G     
Sbjct: 11  RSSQTVRKPYPNYKVIVLNDDFNTFQHVANCLMKYLPGMTSDQAWELTNRVHYEGQATVW 70

Query: 107 VYAYEIAEMKVNQV 120
           V   E AE+   Q+
Sbjct: 71  VGPLEQAELYHTQL 84


>gi|320095957|ref|ZP_08027575.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces sp.
           oral taxon 178 str. F0338]
 gi|319977114|gb|EFW08839.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces sp.
           oral taxon 178 str. F0338]
          Length = 107

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 32/80 (40%), Gaps = 6/80 (7%)

Query: 58  KLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKV 117
            +++ ++ +D    M +V  VLQ  F      A  +M++VH  G         E  E  V
Sbjct: 26  PVWQAVVWDDPVNLMGYVTAVLQRHFGYSRARAHELMMRVHTTGRAVVNSGPRERIEADV 85

Query: 118 NQVMNYSRQHQYPLQCIMEQ 137
             +      H Y L+  ME 
Sbjct: 86  VAL------HTYGLRATMEP 99


>gi|256832121|ref|YP_003160848.1| ATP-dependent Clp protease adaptor protein ClpS [Jonesia
           denitrificans DSM 20603]
 gi|256685652|gb|ACV08545.1| ATP-dependent Clp protease adaptor protein ClpS [Jonesia
           denitrificans DSM 20603]
          Length = 99

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 29/77 (37%), Gaps = 6/77 (7%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
            + +++ ND    M +V  V   +F      A  +M+ VH +G       + E  E  V 
Sbjct: 24  PWVLIVWNDPVNLMNYVEWVFHTYFNYPRGQAHQLMMTVHTEGRAVVATGSREKIEFDVQ 83

Query: 119 QVMNYSRQHQYPLQCIM 135
            +      H Y L   M
Sbjct: 84  AM------HNYGLWATM 94


>gi|172038476|ref|YP_001804977.1| putative ATP-dependent Clp protease adaptor protein [Cyanothece sp.
           ATCC 51142]
 gi|171699930|gb|ACB52911.1| putative ATP-dependent Clp protease, adaptor protein [Cyanothece
           sp. ATCC 51142]
          Length = 108

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 38/97 (39%), Gaps = 3/97 (3%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKV--RVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYK 85
            S+    GI        +  + S+ +  +    Y+V+++ND++     V + L       
Sbjct: 1   MSKRLSTGIQGMATSTSTAPKGSTVIDRKPYPNYKVIVLNDDFNTFNHVANCLMKYIPGM 60

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
             + A  +  +VH +G+        E AE+   Q+  
Sbjct: 61  SSDRAWELTEQVHFEGLAIVWTGPQEQAELYHQQLRR 97


>gi|161353432|ref|NP_898239.2| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 8102]
          Length = 106

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 40/113 (35%), Gaps = 9/113 (7%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYK 85
           MA +             ++       K      Y+VLL ND    ME+V+  L Q     
Sbjct: 1   MAMAVDTPTRSPGGAAVMEKAPERVRK--QSPRYKVLLHNDPVNTMEYVVTTLRQVVPQL 58

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             + A  +M++ H+ G+G   V   E AE     +          L   +E +
Sbjct: 59  SEQDAMAVMIEAHNTGVGLVIVCDLEPAEFYCETLKAK------GLTSTIEPE 105


>gi|113954242|ref|YP_729603.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           CC9311]
 gi|113881593|gb|ABI46551.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           CC9311]
          Length = 103

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 39/108 (36%), Gaps = 9/108 (8%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETA 90
                       LD +     K      Y+VLL ND    ME+V+  LQ        + A
Sbjct: 3   DTPSRSPGGAAVLDKQTERVRKT--SPRYKVLLHNDPVNSMEYVVVTLQQVVPQLSEQDA 60

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             +ML+ H+ GIG   V   E AE     + N        L   +E +
Sbjct: 61  MAVMLETHNTGIGLVIVCDIEPAEFYCETLKNK------GLTSTIEPE 102


>gi|148238705|ref|YP_001224092.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 7803]
 gi|147847244|emb|CAK22795.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 7803]
          Length = 106

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 39/113 (34%), Gaps = 9/113 (7%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYK 85
           M  +             L+       K      Y+VLL ND    ME+V+  L Q     
Sbjct: 1   MVMAVETPSRTPGGAAVLEKAPERVRK--QSPRYKVLLHNDPVNSMEYVVSTLRQVVPQL 58

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             + A  +ML+ H+ G+G   V   E AE     +          L   +E +
Sbjct: 59  SEQDAMAVMLEAHNTGVGLVIVCDLEPAEFYCETLK------GKGLTSTIEPE 105


>gi|299115355|emb|CBN74180.1| ATP-dependent Clp protease adaptor protein ClpS [Ectocarpus
           siliculosus]
          Length = 152

 Score = 83.7 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 47/115 (40%), Gaps = 4/115 (3%)

Query: 17  GILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVI 76
             L + + + M + +     I   D     EV F + +R    Y+VLL NDN    E+V 
Sbjct: 39  SALNMAAGVAMPEIKTAGPSIGVLD---KKEVSFETSIRPEDKYKVLLFNDNGNTREYVS 95

Query: 77  HVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQ-YP 130
             L         TA  IM + +  G+ + G++  E+A+     +       + +P
Sbjct: 96  RSLVQVVGLSEATAFHIMQQANDNGMAQVGIWHQEMADAYSTSLKERGLIAETHP 150


>gi|297625964|ref|YP_003687727.1| ATP-dependent Clp protease adaptor protein clpS [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
 gi|296921729|emb|CBL56287.1| ATP-dependent Clp protease adaptor protein clpS [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
          Length = 103

 Score = 83.7 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 38/99 (38%), Gaps = 6/99 (6%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           +   +       R +        +  ++ +D    M +V HV  ++F+   + A+ +M++
Sbjct: 7   MTAPEGGTALAERPAEDALSANPWVTVVWDDPVNLMSYVTHVFCSYFHYSRDRAERLMMQ 66

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
           VH +G         E  E  VN +      H + L   +
Sbjct: 67  VHMEGKAVVSSGGREEMERDVNAM------HGFGLWATV 99


>gi|325002222|ref|ZP_08123334.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudonocardia sp.
           P1]
          Length = 107

 Score = 83.7 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 36/100 (36%), Gaps = 6/100 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
                                 ++ ++ ND    M +V +VLQ  F    +TA  +ML V
Sbjct: 13  PSPSPTEQVSPDTDDATSPDTPWQAIVWNDPVNLMSYVTYVLQKVFDYPEQTANALMLDV 72

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           HH+G         +  E+ V      ++ H   L   M++
Sbjct: 73  HHKGKAAVSSGDKDTVEVHV------AKLHAAGLWATMQR 106


>gi|220909224|ref|YP_002484535.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           7425]
 gi|219865835|gb|ACL46174.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           7425]
          Length = 112

 Score = 83.7 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 29/73 (39%), Gaps = 1/73 (1%)

Query: 49  RFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECGV 107
              +  +    Y+V+++ND++   E V   L         + A  +  +V  +G     V
Sbjct: 27  DRQTIRQPYPHYKVIVLNDDFNTFEHVAKCLMKYIPNMTSDRAWELTYQVDREGQAIVWV 86

Query: 108 YAYEIAEMKVNQV 120
              E AE+   Q+
Sbjct: 87  GPQEQAELYHLQL 99


>gi|33864059|ref|NP_895619.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus str. MIT 9313]
 gi|33635643|emb|CAE21967.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9313]
          Length = 130

 Score = 83.7 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 44/115 (38%), Gaps = 9/115 (7%)

Query: 25  IFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF- 83
           I +A +             L+ +     K      Y+VLL ND    ME+V+  LQ    
Sbjct: 23  IVLAMAVNAPSPTPGGAAVLEKQTERIRK--QSPHYKVLLHNDPVNSMEYVVVTLQQVVP 80

Query: 84  YKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               + A  +ML+ H+ G+G   V   E AE         ++     L   +EQ+
Sbjct: 81  QLSEQDAMAVMLEAHNTGVGLVIVCDLEPAEFYCE--TLKAK----GLTSTLEQE 129


>gi|225021570|ref|ZP_03710762.1| hypothetical protein CORMATOL_01591 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305681385|ref|ZP_07404192.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           matruchotii ATCC 14266]
 gi|224945561|gb|EEG26770.1| hypothetical protein CORMATOL_01591 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305659590|gb|EFM49090.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           matruchotii ATCC 14266]
          Length = 133

 Score = 83.7 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 21/127 (16%), Positives = 42/127 (33%), Gaps = 7/127 (5%)

Query: 11  HRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYT 70
            R   D    + S      + +           ++ E+           +  ++ +D   
Sbjct: 12  QRGDGDPRARINSEFDPPPTAITLS-SPMATPGVEQELEVDMATSENLPWVCIVWDDPVN 70

Query: 71  PMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYP 130
            M +V +V Q     D + A  +M++VH +G         +  E  V       + H + 
Sbjct: 71  LMSYVTYVFQTVLGYDKKRAMELMMQVHTEGKAAVSSGEKDKVEADVK------KLHTHG 124

Query: 131 LQCIMEQ 137
           L   M+Q
Sbjct: 125 LWATMQQ 131


>gi|168704346|ref|ZP_02736623.1| ATP-dependent Clp protease adaptor protein ClpS [Gemmata
           obscuriglobus UQM 2246]
          Length = 108

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 39/88 (44%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           ++      +++V    + R    Y V+L+ND+    E+VI +L+  F    E    +   
Sbjct: 1   MSGPTTLPETDVETEQRTRRQPPYHVVLLNDDDHSYEYVIEMLKALFGHPVEKGFLLARL 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYS 124
           V  +G       + E AE+K +Q+  Y 
Sbjct: 61  VDTEGRAIVCTTSLERAELKRDQIHAYG 88


>gi|113474895|ref|YP_720956.1| ATP-dependent Clp protease adaptor protein ClpS [Trichodesmium
           erythraeum IMS101]
 gi|110165943|gb|ABG50483.1| ATP-dependent Clp protease adaptor protein ClpS [Trichodesmium
           erythraeum IMS101]
          Length = 95

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 37/90 (41%), Gaps = 7/90 (7%)

Query: 50  FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIGECGVY 108
            S+  +    YRVLL ND++  ME+V+  L           A  IM++ H  GI    + 
Sbjct: 11  TSTVRKTAPHYRVLLHNDDFNSMEYVVQTLMKTVPSLTQPQAVNIMMEAHSNGIALVIIC 70

Query: 109 AYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           A E AE     + N      + L   +E  
Sbjct: 71  ALEPAEFYCENLKN------HGLTSTIEPD 94


>gi|223943781|gb|ACN25974.1| unknown [Zea mays]
          Length = 119

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 37/101 (36%), Gaps = 7/101 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIMLK 96
            +      SE       ++   YRV+L NDNY   E+V+ VL         + A  IM +
Sbjct: 20  EKTTPGRQSEFDVKKSRKMSPPYRVILHNDNYNRREYVVKVLMKVIPGMTVDNAVNIMQE 79

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            H  G+    V +   AE     +          L+  +E 
Sbjct: 80  AHVNGLSVVIVCSQSEAEEHCTSLR------GNGLRSSIEP 114


>gi|38234427|ref|NP_940194.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           diphtheriae NCTC 13129]
 gi|67460296|sp|Q6NFN0|CLPS_CORDI RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|38200690|emb|CAE50386.1| Conserved hypothetical protein [Corynebacterium diphtheriae]
          Length = 113

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 36/100 (36%), Gaps = 10/100 (10%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
              D  +  EV  S  +     +  ++ +D    M +V +V Q       + A  +M++V
Sbjct: 22  PSLDEEMAVEVASSENL----PWMCIVWDDPVNLMSYVTYVFQTILGYSKKRATELMMQV 77

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H +G         +  E  V ++          L   M+Q
Sbjct: 78  HTEGKAVVSSGERDKVEADVKKLHTA------GLWATMQQ 111


>gi|37521807|ref|NP_925184.1| ATP-dependent Clp protease adaptor [Gloeobacter violaceus PCC 7421]
 gi|35212805|dbj|BAC90179.1| gsl2238 [Gloeobacter violaceus PCC 7421]
          Length = 95

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGECG 106
            +  + V+  K ++V+++ND++   + V + L +   +   + A  +  +VH +G     
Sbjct: 9   TKPETSVKALKPWKVIVLNDDFNTFQHVANCLVKYIPHMHPDRAWKLTQQVHSEGRAIVW 68

Query: 107 VYAYEIAEMKVNQV 120
           V   E AE+   Q+
Sbjct: 69  VGPLEQAELYHEQL 82


>gi|326330823|ref|ZP_08197124.1| ATP-dependent Clp protease adaptor protein ClpS [Nocardioidaceae
           bacterium Broad-1]
 gi|325951353|gb|EGD43392.1| ATP-dependent Clp protease adaptor protein ClpS [Nocardioidaceae
           bacterium Broad-1]
          Length = 91

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 38/92 (41%), Gaps = 6/92 (6%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E      V     +  ++ ND    M +V  V Q +F    + ++ +M++VH+ G     
Sbjct: 5   EPEVDDLVAPATPWVTIVWNDPVNLMSYVTFVFQKYFGYSKKKSEKLMMEVHNDGKSAVS 64

Query: 107 VYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             + E  E  V  +      H+Y L   +E++
Sbjct: 65  SGSREEMERDVQAM------HEYGLWATLEKQ 90


>gi|166363445|ref|YP_001655718.1| ATP-dependent Clp protease adaptor [Microcystis aeruginosa
           NIES-843]
 gi|166085818|dbj|BAG00526.1| ATP-dependent Clp protease adaptor protein [Microcystis aeruginosa
           NIES-843]
          Length = 97

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 32/82 (39%), Gaps = 1/82 (1%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQ 100
                +       +    Y+V+++ND++   + V + L +       + A  +  +VH+Q
Sbjct: 5   PSTTLDKSTQVVKKTYPNYKVIVLNDDFNTFDHVANCLIKYIPDMTTDRAWELTNQVHYQ 64

Query: 101 GIGECGVYAYEIAEMKVNQVMN 122
           G         E AE+   Q+  
Sbjct: 65  GQAIVWTGPQEQAELYHQQLRR 86


>gi|269795793|ref|YP_003315248.1| hypothetical protein Sked_25090 [Sanguibacter keddieii DSM 10542]
 gi|269097978|gb|ACZ22414.1| uncharacterized conserved protein [Sanguibacter keddieii DSM 10542]
          Length = 97

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 8/96 (8%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              +     ++ V  P  +  L+ ND  T M +V++V +++F      A  +M++VH +G
Sbjct: 7   PGQEERQDTAASVGEP--WVTLVWNDPVTTMNYVVYVFESYFGFSERHAHRLMMQVHSEG 64

Query: 102 IGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
                    E  EM V  +      H + L   M++
Sbjct: 65  KAVVSTGGREKVEMDVQAM------HSFGLWATMQR 94


>gi|300932720|ref|ZP_07147976.1| hypothetical protein CresD4_01530 [Corynebacterium resistens DSM
           45100]
          Length = 101

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 36/106 (33%), Gaps = 8/106 (7%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M            +      ++  +P  +  +  +D    M +V +V Q       + A 
Sbjct: 1   MTSPAAPSATPVQERLPETDTEANLP--WMCICWDDPVNLMSYVTYVFQTVLGYSRKRAT 58

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +M++VH++G         +  E  V ++          L   M++
Sbjct: 59  ELMMQVHNEGKAVVSSGERDKVEADVKKLQTA------GLWATMQR 98


>gi|256371012|ref|YP_003108836.1| ATP-dependent Clp protease adaptor protein ClpS [Acidimicrobium
           ferrooxidans DSM 10331]
 gi|256007596|gb|ACU53163.1| ATP-dependent Clp protease adaptor protein ClpS [Acidimicrobium
           ferrooxidans DSM 10331]
          Length = 96

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 37/90 (41%), Gaps = 6/90 (6%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
            E    ++ R  + +  +L +D    + +VI+VLQ  F      A  + ++VH++G    
Sbjct: 10  VESEEVAETRTEESWATILWDDPVNLISYVIYVLQATFAFSKVKATELTMQVHNEGKAIV 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
              + E  E         S+ H Y L   +
Sbjct: 70  ATGSREDME------DAASKLHAYGLWATV 93


>gi|298491120|ref|YP_003721297.1| ATP-dependent Clp protease adaptor protein ClpS ['Nostoc azollae'
           0708]
 gi|298233038|gb|ADI64174.1| ATP-dependent Clp protease adaptor protein ClpS ['Nostoc azollae'
           0708]
          Length = 108

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 31/71 (43%), Gaps = 1/71 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    Y+V+++ND++   ++V   L         + A  +  +VH++G     V   E A
Sbjct: 29  KTYPNYKVIVLNDDFNTFQYVAECLMKYIPGMSGDLAWDLTNQVHYEGQAIVWVGPQEPA 88

Query: 114 EMKVNQVMNYS 124
           E+   Q+    
Sbjct: 89  ELYHQQLRRAG 99


>gi|327332411|gb|EGE74147.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL097PA1]
          Length = 95

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           +  ++ +D    M++V  V   +F    E A  +M++VH+QG       + E  E+ V+ 
Sbjct: 20  WTTVVWDDPVNLMDYVTMVFMRYFGYPRERATQLMIQVHNQGRATVAEGSKEEMEVAVHA 79

Query: 120 VMNYSRQHQYPLQCIMEQ 137
           +      H Y LQ  +E+
Sbjct: 80  M------HGYGLQASVEK 91


>gi|25028966|ref|NP_739020.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           efficiens YS-314]
 gi|23494253|dbj|BAC19220.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
          Length = 186

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 17/113 (15%), Positives = 37/113 (32%), Gaps = 6/113 (5%)

Query: 25  IFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFY 84
           +  +         +      D E+   +       +  ++ +D    M +V +V Q    
Sbjct: 78  VGASGVPPVCSSPSAPTAEPDVEMDVHTVSSENLPWLCIVWDDPVNLMSYVTYVFQTVLG 137

Query: 85  KDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
              + A  +M++VH +G         +  E  V ++          L   M+Q
Sbjct: 138 YSRKRANELMMQVHTEGKAVVSSGEKDKVEGDVKKLHVA------GLWATMQQ 184


>gi|218246561|ref|YP_002371932.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           8801]
 gi|257059601|ref|YP_003137489.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           8802]
 gi|218167039|gb|ACK65776.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           8801]
 gi|256589767|gb|ACV00654.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           8802]
          Length = 97

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 29/69 (42%), Gaps = 1/69 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    Y+V+++ND++   E V   L         + A  +  +VH +G     V   E A
Sbjct: 18  KPYPNYKVIVLNDDFNSFEHVAKCLMTYIPGMTSDRAWELTNQVHFEGQATVWVGPQEQA 77

Query: 114 EMKVNQVMN 122
           E+   Q+  
Sbjct: 78  ELYHQQLRR 86


>gi|126656780|ref|ZP_01727994.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp.
           CCY0110]
 gi|126622000|gb|EAZ92708.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp.
           CCY0110]
          Length = 97

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 29/69 (42%), Gaps = 1/69 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    Y+V+++ND++     V + L         + A  +  +VH +G+        E A
Sbjct: 18  KPYPNYKVIVLNDDFNTFNHVANCLMKYIPGMSSDRAWELTEQVHFEGLAIVWTGPQEQA 77

Query: 114 EMKVNQVMN 122
           E+   Q+  
Sbjct: 78  ELYHQQLRR 86


>gi|308177064|ref|YP_003916470.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrobacter
           arilaitensis Re117]
 gi|307744527|emb|CBT75499.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrobacter
           arilaitensis Re117]
          Length = 94

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 6/91 (6%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE 104
           D    F +     K +R+++ ND    M +V +V +++F    E A+ +ML+VHH G   
Sbjct: 6   DVISEFETLESQDKPWRLIVWNDPVNLMSYVAYVFRSYFGVSPEKAEKLMLQVHHDGFCT 65

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIM 135
               + E  E  V  +      H + L   M
Sbjct: 66  VRSGSREAIESDVQAM------HGFGLNATM 90


>gi|72382903|ref|YP_292258.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus str. NATL2A]
 gi|72002753|gb|AAZ58555.1| conserved hypothetical protein [Prochlorococcus marinus str.
           NATL2A]
          Length = 123

 Score = 82.6 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 42/108 (38%), Gaps = 9/108 (8%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETA 90
            +          +D EV+   K+     Y+VLL ND    M++V+ +L Q       + A
Sbjct: 23  DSANQTDGDTAVIDREVQRVRKI--SPKYKVLLHNDPVNTMDYVVEILRQVVPQLSEQDA 80

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             IML+ H+ G+G       E AE     +          L   +E +
Sbjct: 81  LNIMLETHNNGVGLVITCDLEPAEFYSESLKAK------GLTSTIELE 122


>gi|67924069|ref|ZP_00517517.1| ATP-dependent Clp protease adaptor protein ClpS [Crocosphaera
           watsonii WH 8501]
 gi|67854068|gb|EAM49379.1| ATP-dependent Clp protease adaptor protein ClpS [Crocosphaera
           watsonii WH 8501]
          Length = 97

 Score = 82.6 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 36/101 (35%), Gaps = 7/101 (6%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKV 97
             D         S+  +    YRVLL ND++  ME+V+  L           A  IM++ 
Sbjct: 2   TTDVIEKPSSSTSTVRKPAPRYRVLLHNDDFNSMEYVVQTLMQTVPSITQPQAVDIMMEA 61

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           H  G       A E AE     + N      + L   +E  
Sbjct: 62  HSNGTALVITCALEPAEFYSETLKN------HGLTSTIEPD 96


>gi|258651917|ref|YP_003201073.1| ATP-dependent Clp protease adaptor protein ClpS [Nakamurella
           multipartita DSM 44233]
 gi|258555142|gb|ACV78084.1| ATP-dependent Clp protease adaptor protein ClpS [Nakamurella
           multipartita DSM 44233]
          Length = 103

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 29/89 (32%), Gaps = 6/89 (6%)

Query: 50  FSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYA 109
             +       +  ++ ND    M +V  V Q         A+ +ML VHH+G        
Sbjct: 20  TETVTTPEAPWVTIVWNDPVNLMSYVTLVFQKLLGHPRPKAEALMLDVHHKGRATVSSGP 79

Query: 110 YEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            E  E  V      ++     L   M + 
Sbjct: 80  REKMEADV------AKLQAAGLWATMAKD 102


>gi|227542814|ref|ZP_03972863.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227181440|gb|EEI62412.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           glucuronolyticum ATCC 51866]
          Length = 100

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 39/106 (36%), Gaps = 8/106 (7%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+          +D +V  ++   +P  +  ++ +D    M +V HV         + A 
Sbjct: 1   MSMPASPLATPDVDVDVEVATSENLP--WMCIVWDDPVNLMSYVTHVFMTMLGYSRKRAT 58

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +M++VH +G         +  E  V ++          L   M+Q
Sbjct: 59  ELMMQVHTEGKAVVSSGERDKVEADVKKMHTA------GLWATMQQ 98


>gi|227488216|ref|ZP_03918532.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227091786|gb|EEI27098.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           glucuronolyticum ATCC 51867]
          Length = 100

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 40/106 (37%), Gaps = 8/106 (7%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+   +      +D +V  ++   +P  +  ++ +D    M +V HV         + A 
Sbjct: 1   MSMPALPLATPDVDVDVEVATSENLP--WMCIVWDDPVNLMSYVTHVFMTMLGYSRKRAT 58

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +M++VH +G         +  E  V ++          L   M+Q
Sbjct: 59  ELMMQVHTEGKAVVSSGERDKVEADVKKMHTA------GLWATMQQ 98


>gi|159031002|emb|CAO88704.1| clpS [Microcystis aeruginosa PCC 7806]
          Length = 97

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 32/82 (39%), Gaps = 1/82 (1%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQ 100
                +       +    Y+V+++ND++   + V + L +       + A  +  +VH+Q
Sbjct: 5   PSTTLDKSTQGVKKTYPNYKVIVLNDDFNTFDHVANCLIKYIPDMTTDRAWELTNQVHYQ 64

Query: 101 GIGECGVYAYEIAEMKVNQVMN 122
           G         E AE+   Q+  
Sbjct: 65  GQAIVWTGPQEPAELYHQQLRR 86


>gi|67924463|ref|ZP_00517887.1| ATP-dependent Clp protease adaptor protein ClpS [Crocosphaera
           watsonii WH 8501]
 gi|67853690|gb|EAM49025.1| ATP-dependent Clp protease adaptor protein ClpS [Crocosphaera
           watsonii WH 8501]
          Length = 108

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 39/97 (40%), Gaps = 3/97 (3%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKV--RVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYK 85
            S+    GI        +  + ++ V  +    Y+V+++ND++   + V   L +     
Sbjct: 1   MSKRLSIGIRGMATSTSTAPKGATVVERKRYPNYKVIVLNDDFNTFDHVAKCLLKYIPGM 60

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
             + A  +  +VH +G+        E AE+   Q+  
Sbjct: 61  SSDRAWELTEQVHFEGLATVWTGPQEQAELYHQQLRR 97


>gi|218441397|ref|YP_002379726.1| ATP-dependent Clp protease adaptor [Cyanothece sp. PCC 7424]
 gi|218174125|gb|ACK72858.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           7424]
          Length = 108

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    Y+V+++ND++   + V + L         + A  +  +VH++G     V   E A
Sbjct: 29  KTYPNYKVIVLNDDFNTFQHVANCLMKYIPGMTSDRAWELTNQVHYEGQATVWVGPQEQA 88

Query: 114 EMKVNQVMN 122
           E+   Q+  
Sbjct: 89  ELYHQQLRR 97


>gi|159904162|ref|YP_001551506.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus str. MIT 9211]
 gi|159889338|gb|ABX09552.1| Conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9211]
          Length = 116

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 41/103 (39%), Gaps = 9/103 (8%)

Query: 39  EFDNCLDSEVRFSSKV--RVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIML 95
                  + +   S++  +    Y+VLL ND    M++V+  L Q       + A  +ML
Sbjct: 19  GSSPGGATVIEKQSELVRKRSPRYKVLLHNDPVNSMDYVVTTLRQVVPQLSEQDALAVML 78

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + H+ G+G   V   E AE     +          L   +E++
Sbjct: 79  EAHNTGVGLVIVCDLEPAEFYSESLKAK------GLSSTIEKE 115


>gi|87125032|ref|ZP_01080879.1| hypothetical protein RS9917_03483 [Synechococcus sp. RS9917]
 gi|86167352|gb|EAQ68612.1| hypothetical protein RS9917_03483 [Synechococcus sp. RS9917]
          Length = 111

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/113 (23%), Positives = 41/113 (36%), Gaps = 9/113 (7%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYK 85
           +A               LD +     K      Y+VLL ND    ME+V+  L Q     
Sbjct: 6   LAMVGSTSSTSPGGAAVLDKQTERVRK--HSPRYKVLLHNDPVNTMEYVVTTLRQVVPQL 63

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             + A  +ML+ H+ G+G   V   E AE         ++     L   +E +
Sbjct: 64  SEQDAMAVMLEAHNTGVGLVIVCDLEPAEFYCE--TLKAK----GLTSTLEPE 110


>gi|289424879|ref|ZP_06426658.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes SK187]
 gi|289154578|gb|EFD03264.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes SK187]
 gi|313763390|gb|EFS34754.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL013PA1]
 gi|313814686|gb|EFS52400.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL059PA1]
 gi|314914532|gb|EFS78363.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL005PA4]
 gi|314917600|gb|EFS81431.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL050PA1]
 gi|314919644|gb|EFS83475.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL050PA3]
 gi|314930283|gb|EFS94114.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL067PA1]
 gi|314957639|gb|EFT01742.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL002PA1]
 gi|314968978|gb|EFT13076.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL037PA1]
 gi|315098015|gb|EFT69991.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL059PA2]
 gi|315102639|gb|EFT74615.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL046PA1]
 gi|315104470|gb|EFT76446.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL050PA2]
 gi|327451218|gb|EGE97872.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL087PA3]
 gi|327452575|gb|EGE99229.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL083PA2]
 gi|328751971|gb|EGF65587.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL025PA2]
 gi|328754785|gb|EGF68401.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL087PA1]
          Length = 95

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           +  ++ +D    M++V  V   +F    E A  +M++VH+QG       + E  E+ V+ 
Sbjct: 20  WTTVVWDDPVNLMDYVTMVFMRYFGYPRERATQLMIQVHNQGRATVAEGSKEEMEVAVHA 79

Query: 120 VMNYSRQHQYPLQCIMEQ 137
           +      H Y LQ  +E+
Sbjct: 80  M------HGYGLQASVEK 91


>gi|261886350|ref|ZP_06010389.1| ATP-dependent Clp protease adaptor protein ClpS [Campylobacter
           fetus subsp. venerealis str. Azul-94]
          Length = 76

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 36/74 (48%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
               S  +   K   P L++V+L+ND  T M+FV+ +L + F K    A  +M+K H  G
Sbjct: 3   TKKSSITKTKIKDFKPNLFKVMLLNDEVTTMDFVVMILIDIFNKSKNEAIELMVKNHQSG 62

Query: 102 IGECGVYAYEIAEM 115
              C     EIA+ 
Sbjct: 63  RAICRFSTKEIAQT 76


>gi|159029424|emb|CAO90801.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 95

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 35/98 (35%), Gaps = 9/98 (9%)

Query: 44  LDSEVRFSSKV--RVPKLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQ 100
            +   + S+    +    YRVLL ND++  ME+V+  L           A  IM++ H  
Sbjct: 3   TEVIEKRSTATIRKPAPRYRVLLHNDDFNSMEYVVQSLMQTIAGMTQPQAVDIMMEAHTN 62

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           G         E AE     + N        L   +E  
Sbjct: 63  GTALVITCIQEHAEFYCETLKNK------GLTSSIEPD 94


>gi|119490026|ref|ZP_01622650.1| ATP-dependent Clp protease adaptor protein ClpS [Lyngbya sp. PCC
           8106]
 gi|119454178|gb|EAW35330.1| ATP-dependent Clp protease adaptor protein ClpS [Lyngbya sp. PCC
           8106]
          Length = 97

 Score = 81.8 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 2/74 (2%)

Query: 49  RFSSKVRVP-KLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECG 106
           R S   + P   Y+V+++ND++   E V   L       + + A  +  +VH +G     
Sbjct: 11  RSSQVTQQPYPNYKVIVLNDDFNTFEHVSSCLMKYIPGMNSDLAWKLTNQVHFEGQATVW 70

Query: 107 VYAYEIAEMKVNQV 120
           V   E AE+   Q+
Sbjct: 71  VGPLEQAELYHTQL 84


>gi|124026645|ref|YP_001015760.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus str. NATL1A]
 gi|123961713|gb|ABM76496.1| Uncharacterized conserved protein [Prochlorococcus marinus str.
           NATL1A]
          Length = 123

 Score = 81.8 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 41/108 (37%), Gaps = 9/108 (8%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETA 90
            +          +D EV+   K+     Y+VLL ND    M++V+  L Q       + A
Sbjct: 23  DSANQTDGDTAVIDREVQRVRKI--SPKYKVLLHNDPVNTMDYVVDTLRQVVPQLSEQDA 80

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             IML+ H+ G+G       E AE     +          L   +E +
Sbjct: 81  LNIMLETHNNGVGLVITCDLEPAEFYSESLKAK------GLTSTIELE 122


>gi|166367986|ref|YP_001660259.1| ATP-dependent Clp protease adaptor protein ClpS [Microcystis
           aeruginosa NIES-843]
 gi|166090359|dbj|BAG05067.1| ATP-dependent Clp protease adaptor protein [Microcystis aeruginosa
           NIES-843]
          Length = 91

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 37/95 (38%), Gaps = 8/95 (8%)

Query: 46  SEVRFSSKVRVP-KLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIG 103
            E R ++ +R P   YRVLL ND++  ME+V+  L           A  IM++ H  G  
Sbjct: 2   IEKRSTATIRKPAPRYRVLLHNDDFNSMEYVVQSLMQTIAGMTQPQAVDIMMEAHTNGTA 61

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  E AE     + N        L   +E  
Sbjct: 62  LVITCIQEHAEFYCETLKNK------GLTSSIEPD 90


>gi|156544772|ref|XP_001606200.1| PREDICTED: similar to ubiquitin ligase E3 alpha [Nasonia
           vitripennis]
          Length = 1812

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 43/136 (31%), Gaps = 7/136 (5%)

Query: 3   LFDDGSMYHRVKRDGILALMSFI-FMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYR 61
           L DD +         +L     +  M  S      +   ++     +  S+       Y 
Sbjct: 195 LPDDMAQRAAATFRAVLKYCYDLLSMEHSPSLPNDLCIKNDEDSVSLLASNDT-----YC 249

Query: 62  VLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA-EMKVNQV 120
            +L ND     + VI  L          A   +  +  +G        ++   E+K    
Sbjct: 250 TVLFNDETHTFDQVIITLTRVIKCSQRDAIEYVTNIDREGRAVVKCSGFQHCNELKSEIE 309

Query: 121 MNYSRQHQYPLQCIME 136
              SR +  PL+ ++E
Sbjct: 310 KFTSRHNSRPLKVLVE 325


>gi|226360564|ref|YP_002778342.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodococcus opacus
           B4]
 gi|254763822|sp|C1AVW7|CLPS_RHOOB RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|226239049|dbj|BAH49397.1| putative ATP-dependent Clp protease adaptor protein ClpS
           [Rhodococcus opacus B4]
          Length = 112

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 34/107 (31%), Gaps = 8/107 (7%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
                  +        V        P  +  ++ +D    M +V ++ Q  F      A 
Sbjct: 12  DAMPASPQVTPAESEVVEVDEANDRP--WVTVVWDDPVNLMHYVTYIFQKLFGYSKARAT 69

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +M++VH +G       + +  E  V ++          L   M++ 
Sbjct: 70  ELMMQVHSEGKAVVSSGSRDKVENDVRKLHAA------GLWATMQRD 110


>gi|300859079|ref|YP_003784062.1| ATP-dependent Clp protease adapter protein [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300686533|gb|ADK29455.1| ATP-dependent Clp protease adapter protein [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302206782|gb|ADL11124.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           pseudotuberculosis C231]
 gi|302331335|gb|ADL21529.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           pseudotuberculosis 1002]
 gi|308277027|gb|ADO26926.1| ATP-dependent Clp protease adapter protein ClpS [Corynebacterium
           pseudotuberculosis I19]
          Length = 126

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 38/119 (31%), Gaps = 6/119 (5%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           L  +  + +A +             LD  +           +  ++ +D    M +V +V
Sbjct: 12  LNELPSVVLAPTMDVVVSSPMATPELDEALSVDVASSENLPWMCIVWDDPVNLMSYVTYV 71

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            Q         A  +M++VH +G         +  E  V ++          L   M+Q
Sbjct: 72  FQTILGYSKRRAIELMMQVHTEGKAVVSSGERDKVEGDVKKLHTA------GLWATMQQ 124


>gi|289427807|ref|ZP_06429516.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes J165]
 gi|289158989|gb|EFD07184.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes J165]
 gi|313773267|gb|EFS39233.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL074PA1]
 gi|313793450|gb|EFS41501.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL110PA1]
 gi|313801151|gb|EFS42414.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL110PA2]
 gi|313808500|gb|EFS46965.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL087PA2]
 gi|313812073|gb|EFS49787.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL083PA1]
 gi|313819235|gb|EFS56949.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL046PA2]
 gi|313821093|gb|EFS58807.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL036PA1]
 gi|313823481|gb|EFS61195.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL036PA2]
 gi|313827016|gb|EFS64730.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL063PA1]
 gi|313829870|gb|EFS67584.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL007PA1]
 gi|313834712|gb|EFS72426.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL056PA1]
 gi|313837919|gb|EFS75633.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL086PA1]
 gi|314925922|gb|EFS89753.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL036PA3]
 gi|314960897|gb|EFT04998.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL002PA2]
 gi|314963339|gb|EFT07439.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL082PA1]
 gi|314974016|gb|EFT18112.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL053PA1]
 gi|314975442|gb|EFT19537.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL045PA1]
 gi|314979459|gb|EFT23553.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL072PA2]
 gi|314984202|gb|EFT28294.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL005PA1]
 gi|314988443|gb|EFT32534.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL005PA2]
 gi|314988638|gb|EFT32729.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL005PA3]
 gi|315079381|gb|EFT51379.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL053PA2]
 gi|315083407|gb|EFT55383.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL027PA2]
 gi|315086798|gb|EFT58774.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL002PA3]
 gi|315089445|gb|EFT61421.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL072PA1]
 gi|315097784|gb|EFT69760.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL038PA1]
 gi|327325391|gb|EGE67196.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL096PA2]
 gi|327328270|gb|EGE70034.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL096PA3]
 gi|327443684|gb|EGE90338.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL043PA1]
 gi|327449221|gb|EGE95875.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL043PA2]
 gi|327450185|gb|EGE96839.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL013PA2]
 gi|327451249|gb|EGE97903.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL092PA1]
 gi|328756759|gb|EGF70375.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL020PA1]
 gi|328761033|gb|EGF74585.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL099PA1]
          Length = 95

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           +  ++ +D    M++V  V   +F    E A  +M++VH++G         E  E+ V+ 
Sbjct: 20  WTTVVWDDPVNLMDYVTMVFMRYFGYPRERATQLMIQVHYRGRATVAEGNKEEMEVAVHA 79

Query: 120 VMNYSRQHQYPLQCIMEQ 137
           +      H Y LQ  +E+
Sbjct: 80  M------HGYGLQASVEK 91


>gi|87301880|ref|ZP_01084714.1| hypothetical protein WH5701_01105 [Synechococcus sp. WH 5701]
 gi|87283448|gb|EAQ75403.1| hypothetical protein WH5701_01105 [Synechococcus sp. WH 5701]
          Length = 109

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 45/114 (39%), Gaps = 8/114 (7%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVP-KLYRVLLVNDNYTPMEFVIHVL-QNFFY 84
           M+D+    +             +   +VR P   YRVLL ND    ME+V+  L Q    
Sbjct: 1   MSDTIRATETPTRSPGGAAVIEKEVQRVRKPSPRYRVLLHNDPVNSMEYVVTTLRQVVPS 60

Query: 85  KDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              + A  +ML+ H+ G+G   V   E AE         ++     L   +E +
Sbjct: 61  LSEQDAIAVMLEAHNTGVGLVIVCDLEPAEFYSE--TLKAK----GLSSTIEPE 108


>gi|125603506|gb|EAZ42831.1| hypothetical protein OsJ_27419 [Oryza sativa Japonica Group]
          Length = 160

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIML 95
           I +      SE       ++   YRVLL NDNY   E+V+ VL         + A  IM 
Sbjct: 60  IEKVTPGRQSEFDVRKSRKMTPPYRVLLHNDNYNRREYVVQVLMKVIPGMTVDNAVNIMQ 119

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           + H  G+    + +   AE     +          L+  +E 
Sbjct: 120 EAHVNGLSVVIICSQSEAEEHCTSLR------GNGLRSSIEP 155


>gi|21542305|sp|Q8YZQ3|CLPS_ANASP RecName: Full=ATP-dependent Clp protease adapter protein ClpS
          Length = 97

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 34/84 (40%), Gaps = 1/84 (1%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQ 100
             +  E    +  +    Y+V+++ND++   + V   L +       + A  +  +VH++
Sbjct: 5   PTVTPERSNQTVRKTYPNYKVIVLNDDFNTFQHVAECLVKYIPGMTGDLAWDLTNQVHYE 64

Query: 101 GIGECGVYAYEIAEMKVNQVMNYS 124
           G     V   E AE+   Q+    
Sbjct: 65  GQAIVWVGPQEPAELYHQQLRRAG 88


>gi|312139203|ref|YP_004006539.1| ATP-dependent clp protease adaptor protein clps [Rhodococcus equi
           103S]
 gi|325673491|ref|ZP_08153182.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodococcus equi
           ATCC 33707]
 gi|311888542|emb|CBH47854.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodococcus equi
           103S]
 gi|325555512|gb|EGD25183.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodococcus equi
           ATCC 33707]
          Length = 118

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 34/93 (36%), Gaps = 7/93 (7%)

Query: 47  EVRFSSKVR-VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
           E      V    + +  ++ +D    M +V ++ Q  F      A  +M++VH +G    
Sbjct: 30  EAEIEETVEAQDRPWVTVVWDDPVNLMHYVTYIFQKLFGYSKAKATDLMMQVHKEGKAVV 89

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              + +  E  V ++          L   M++ 
Sbjct: 90  SSGSRDKVENDVRKLHAA------GLWATMQRD 116


>gi|313812343|gb|EFS50057.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL025PA1]
          Length = 95

 Score = 81.4 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           +  ++ +D    M++V  V   +F    E A  +M++VH++G         E  E+ V+ 
Sbjct: 20  WTTVVWDDPVNLMDYVTMVFMRYFGYPRERATQLMIQVHNRGRATVAEGNKEEMEVAVHA 79

Query: 120 VMNYSRQHQYPLQCIMEQ 137
           +      H Y LQ  +E+
Sbjct: 80  M------HGYGLQASVEK 91


>gi|88807954|ref|ZP_01123465.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 7805]
 gi|88787993|gb|EAR19149.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 7805]
          Length = 104

 Score = 81.4 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 36/108 (33%), Gaps = 9/108 (8%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETA 90
                       LD       K      Y+VLL ND    ME+V+  L Q       + A
Sbjct: 4   ETPSLTPGGAAVLDKAPERVRK--QSPRYKVLLHNDPVNSMEYVVSTLRQVVPQLSEQDA 61

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             +ML+ H+ G+G   V   E AE     +          L   +E  
Sbjct: 62  MAVMLEAHNTGVGLVIVCDLEPAEFYCETLK------GKGLTSTLEPD 103


>gi|318042663|ref|ZP_07974619.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           CB0101]
          Length = 121

 Score = 81.4 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 42/104 (40%), Gaps = 9/104 (8%)

Query: 38  AEFDNCLDSEVRFSSKV--RVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIM 94
              ++   + +  + +   +    Y+VLL ND    ME+V+  L Q       + A  +M
Sbjct: 23  PGRESGGGAVMEKAPERVRKPSPRYKVLLHNDPVNTMEYVVGTLRQVVPSLSEQDAIAVM 82

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ H+ G+G   V   E AE         ++     L   +E +
Sbjct: 83  LEAHNTGVGLVIVCDIEPAEFYSE--TLKAK----GLTSTIEPE 120


>gi|22298631|ref|NP_681878.1| ATP-dependent Clp protease adaptor [Thermosynechococcus elongatus
           BP-1]
 gi|37077203|sp|Q8DJY3|CLPS_THEEB RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|22294811|dbj|BAC08640.1| tsr1087 [Thermosynechococcus elongatus BP-1]
          Length = 94

 Score = 81.4 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 33/79 (41%), Gaps = 1/79 (1%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGEC 105
           + R     +    Y+V+++ND++   + V   L         + A  +  +VH++G    
Sbjct: 7   QERQQVTRKHYPNYKVIVLNDDFNTFQHVAACLMKYIPNMTSDRAWELTNQVHYEGQAIV 66

Query: 106 GVYAYEIAEMKVNQVMNYS 124
            V   E AE+   Q++   
Sbjct: 67  WVGPQEQAELYHEQLLRAG 85


>gi|145296512|ref|YP_001139333.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           glutamicum R]
 gi|25009631|sp|Q8NMQ1|CLPS_CORGL RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|158513595|sp|A4QGR5|CLPS_CORGB RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|21325286|dbj|BAB99908.1| Uncharacterized ACR [Corynebacterium glutamicum ATCC 13032]
 gi|140846432|dbj|BAF55431.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 100

 Score = 81.4 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 39/106 (36%), Gaps = 8/106 (7%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
           M+          ++ +V   S   +P  +  ++ +D    M +V +V Q       + A 
Sbjct: 1   MSSPSAPLATPDVELDVHTLSSENLP--WLCIVWDDPVNLMSYVTYVFQTVLGFSKKRAT 58

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            +M++VH +G         +  E  V ++          L   M+Q
Sbjct: 59  ELMMQVHTEGKAVVSSGEKDKVEGDVKKLHTA------GLWATMQQ 98


>gi|227548652|ref|ZP_03978701.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           lipophiloflavum DSM 44291]
 gi|227079266|gb|EEI17229.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           lipophiloflavum DSM 44291]
          Length = 99

 Score = 81.4 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 37/102 (36%), Gaps = 6/102 (5%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
           G       LD ++     V     +  ++ +D    M +V +V Q     D + A  +M+
Sbjct: 2   GSPMATPELDEQLEVDVVVSENLPWMCIVWDDPVNLMSYVSYVFQTVLGYDRKRANELMM 61

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +VH +G         +  E  V ++          L   M+Q
Sbjct: 62  QVHTEGKAVVSSGEKDKVEGDVKKLHTA------GLWATMQQ 97


>gi|315080041|gb|EFT52017.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL078PA1]
          Length = 93

 Score = 81.4 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           +  ++ +D    M++V  V   +F    E A  +M++VH++G         E  E+ V+ 
Sbjct: 20  WTTVVWDDPVNLMDYVTMVFMRYFGYPRERATQLMIQVHYRGRATVAEGNKEEMEVAVHA 79

Query: 120 VMNYSRQHQYPLQCIMEQ 137
           +      H Y LQ  +E+
Sbjct: 80  M------HGYGLQASVEK 91


>gi|17227900|ref|NP_484448.1| ATP-dependent Clp protease adaptor [Nostoc sp. PCC 7120]
 gi|17129749|dbj|BAB72362.1| all0404 [Nostoc sp. PCC 7120]
          Length = 108

 Score = 81.4 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 34/84 (40%), Gaps = 1/84 (1%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQ 100
             +  E    +  +    Y+V+++ND++   + V   L +       + A  +  +VH++
Sbjct: 16  PTVTPERSNQTVRKTYPNYKVIVLNDDFNTFQHVAECLVKYIPGMTGDLAWDLTNQVHYE 75

Query: 101 GIGECGVYAYEIAEMKVNQVMNYS 124
           G     V   E AE+   Q+    
Sbjct: 76  GQAIVWVGPQEPAELYHQQLRRAG 99


>gi|148243279|ref|YP_001228436.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           RCC307]
 gi|147851589|emb|CAK29083.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           RCC307]
          Length = 107

 Score = 81.4 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 41/113 (36%), Gaps = 8/113 (7%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYK 85
           M  +             +  E +  +  +    YRVLL ND    ME+V+  L +     
Sbjct: 1   MTHASETPVSSPGGGAAV-MERQPETVRKPSPRYRVLLHNDPVNSMEYVVTSLREVVPSL 59

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             + A  +ML+ H+ G+G   V   E AE     +          L   +E +
Sbjct: 60  SEQDAMAVMLEAHNSGVGLVIVCDIEPAEFYCESLKAK------GLTSTIEPE 106


>gi|111018445|ref|YP_701417.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodococcus jostii
           RHA1]
 gi|122956016|sp|Q0SGS7|CLPS_RHOSR RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|110817975|gb|ABG93259.1| possible ATP-dependent Clp protease adaptor protein ClpS
           [Rhodococcus jostii RHA1]
          Length = 112

 Score = 81.0 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 33/107 (30%), Gaps = 8/107 (7%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAK 91
                  +        V        P  +  ++ +D    M +V ++ Q  F      A 
Sbjct: 12  DAMPASPQVTPAESEVVEIDEANDRP--WVTVVWDDPVNLMHYVTYIFQKLFGYSKAKAT 69

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +M++VH +G       + +  E  V ++          L   M+  
Sbjct: 70  ELMMQVHSEGKAVVSSGSRDKVENDVRKLHAA------GLWATMQHD 110


>gi|154507592|ref|ZP_02043234.1| hypothetical protein ACTODO_00072 [Actinomyces odontolyticus ATCC
           17982]
 gi|293189261|ref|ZP_06607984.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces
           odontolyticus F0309]
 gi|153797226|gb|EDN79646.1| hypothetical protein ACTODO_00072 [Actinomyces odontolyticus ATCC
           17982]
 gi|292821724|gb|EFF80660.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces
           odontolyticus F0309]
          Length = 95

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 34/81 (41%), Gaps = 6/81 (7%)

Query: 58  KLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKV 117
             +R ++ +D    M +V  V + +F   +  A+ +M+ VH +G         E  E  V
Sbjct: 19  PRWRAVVWDDPVNLMSYVSAVFRQYFGYSNARAEELMMAVHTRGRATVSTGVRERIEADV 78

Query: 118 NQVMNYSRQHQYPLQCIMEQK 138
             +      H Y L+  +E+ 
Sbjct: 79  MAM------HSYGLRATIEED 93


>gi|16330271|ref|NP_440999.1| ATP-dependent Clp protease adaptor [Synechocystis sp. PCC 6803]
 gi|12230854|sp|P73634|CLPS_SYNY3 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|1652760|dbj|BAA17679.1| ssl3379 [Synechocystis sp. PCC 6803]
          Length = 98

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 32/74 (43%), Gaps = 1/74 (1%)

Query: 50  FSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGECGVY 108
            S+  +    ++V+++ND++   + V   L +       + A  +  +VH  G+    V 
Sbjct: 14  TSTVRKTYPNFKVIVLNDDFNTFQHVSDCLLKYIPGMTGDRAWELTNQVHFDGLAIVWVG 73

Query: 109 AYEIAEMKVNQVMN 122
             E AE+   Q+  
Sbjct: 74  PQEQAELYHQQLRR 87


>gi|255534976|ref|YP_003095347.1| hypothetical protein FIC_00832 [Flavobacteriaceae bacterium
           3519-10]
 gi|255341172|gb|ACU07285.1| hypothetical protein FIC_00832 [Flavobacteriaceae bacterium
           3519-10]
          Length = 103

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 38/96 (39%), Gaps = 2/96 (2%)

Query: 30  SRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHET 89
           + M K          + +   +   +  ++Y+++L ND+    +FVI  L        E 
Sbjct: 3   NSMIKNVRDYESPQREYDEEVALLEKEDEVYKLVLWNDDVNTFDFVIEALVEICGHTLEQ 62

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSR 125
           A+   + VH++G       + EI  +K       +R
Sbjct: 63  AEQCTILVHYKGKCTVKTGSLEI--LKPMHEKLLAR 96


>gi|220908775|ref|YP_002484086.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           7425]
 gi|219865386|gb|ACL45725.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. PCC
           7425]
          Length = 93

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 38/95 (40%), Gaps = 7/95 (7%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIG 103
           ++  + S+  ++   YRVLL ND+   ME V+ VL +         A  IM++ H  GI 
Sbjct: 4   ETIEQRSTVRKLAPRYRVLLHNDDVNSMEHVVEVLLKTVPSLTQPQAVDIMMEAHVNGIA 63

Query: 104 ECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                A E AE     +          L   +E  
Sbjct: 64  LVITCALEHAEFYCESLKLG------GLTSTIEPD 92


>gi|254430350|ref|ZP_05044053.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanobium sp. PCC
           7001]
 gi|197624803|gb|EDY37362.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanobium sp. PCC
           7001]
          Length = 113

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 41/118 (34%), Gaps = 7/118 (5%)

Query: 22  MSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-Q 80
           M+   M       +  +        E       +    Y+VLL ND    ME+V+  L Q
Sbjct: 1   MTAAAMTTVPQATQTPSRESGAAVMEKAPERVRKPSPRYKVLLHNDPVNSMEYVVTTLRQ 60

Query: 81  NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                  + A  +ML+ H+ G+G   V   E AE         ++     L   +E  
Sbjct: 61  VVPSLSEQDAIAVMLEAHNTGVGLVIVCDLEPAEFYCE--TLKAK----GLTSTLEPD 112


>gi|295131202|ref|YP_003581865.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes SK137]
 gi|291376050|gb|ADD99904.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes SK137]
          Length = 95

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           +  ++ +D    M++V  V   +F    E A  +M++VH++G         E  E+ V+ 
Sbjct: 20  WTTVVWDDPVNLMDYVTMVFMRYFGYPRECATQLMIQVHYRGRATVAEGNKEEMEVAVHA 79

Query: 120 VMNYSRQHQYPLQCIMEQ 137
           +      H Y LQ  +E+
Sbjct: 80  M------HGYGLQASVEK 91


>gi|75909055|ref|YP_323351.1| ATP-dependent Clp protease adaptor [Anabaena variabilis ATCC 29413]
 gi|75702780|gb|ABA22456.1| ATP-dependent Clp protease adaptor protein ClpS [Anabaena
           variabilis ATCC 29413]
          Length = 108

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 34/84 (40%), Gaps = 1/84 (1%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQ 100
             +  E    +  +    Y+V+++ND++   + V   L +       + A  +  +VH++
Sbjct: 16  PTVTPERSNQTVRKSYPNYKVIVLNDDFNTFQHVAECLVKYIPGMTGDLAWDLTNQVHYE 75

Query: 101 GIGECGVYAYEIAEMKVNQVMNYS 124
           G     V   E AE+   Q+    
Sbjct: 76  GQAIVWVGPQEPAELYHQQLRRAG 99


>gi|254423912|ref|ZP_05037630.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           PCC 7335]
 gi|196191401|gb|EDX86365.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           PCC 7335]
          Length = 97

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 7/93 (7%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGEC 105
           +   S+  ++   YRVLL ND++  ME+V+  L +         A  IM++ H+ GIG  
Sbjct: 10  KPSVSTVRKIAPRYRVLLHNDDFNSMEYVVEALIETVPSLTAPQAIDIMMQTHNTGIGLV 69

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            V   E AE     +          L   +E +
Sbjct: 70  IVCEMEHAEFYCEGLK------GKGLTSTIEPE 96


>gi|16331021|ref|NP_441749.1| ATP-dependent Clp protease adaptor protein ClpS [Synechocystis sp.
           PCC 6803]
 gi|1653516|dbj|BAA18429.1| ssr2723 [Synechocystis sp. PCC 6803]
          Length = 96

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 33/85 (38%), Gaps = 7/85 (8%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    YRVLL ND++  ME V+  L Q         A  IM++ H  G+        E A
Sbjct: 17  KHAPRYRVLLHNDDFNSMEHVVQTLIQTVAGMTQPQAVDIMMEAHFNGMSLVITCELEHA 76

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQK 138
           E     + +      + L   +E  
Sbjct: 77  EFYCETLRS------HGLSSTIEPD 95


>gi|242009898|ref|XP_002425719.1| ubiquitin-protein ligase E3 component N-recognin-2, putative
           [Pediculus humanus corporis]
 gi|212509620|gb|EEB12981.1| ubiquitin-protein ligase E3 component N-recognin-2, putative
           [Pediculus humanus corporis]
          Length = 1786

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 31/80 (38%), Gaps = 1/80 (1%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA-EM 115
           P +Y  +L ND     E VI+ L          A   +  +  +G       +++   E+
Sbjct: 246 PDVYCTVLYNDEIHTFEQVINSLVKIVKCSQRDATEYVTNIDREGRAVVKCTSFQQCQEL 305

Query: 116 KVNQVMNYSRQHQYPLQCIM 135
           K +     S+   +PL+  +
Sbjct: 306 KTDIERFTSKHGGHPLKVEV 325


>gi|94272507|ref|ZP_01292136.1| ATP-dependent Clp protease adaptor protein ClpS [delta
           proteobacterium MLMS-1]
 gi|93450106|gb|EAT01450.1| ATP-dependent Clp protease adaptor protein ClpS [delta
           proteobacterium MLMS-1]
          Length = 58

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 37/58 (63%)

Query: 81  NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             F+ D   A  IM+ VH +G+G  GVY  + AE KV  V N +R+H+YPL+C +EQ+
Sbjct: 1   MVFHHDQAAAHRIMMNVHREGVGVAGVYPRDSAETKVAMVHNLARKHEYPLKCSLEQE 58


>gi|115476544|ref|NP_001061868.1| Os08g0432500 [Oryza sativa Japonica Group]
 gi|37805936|dbj|BAC99353.1| unknown protein [Oryza sativa Japonica Group]
 gi|42409470|dbj|BAD09826.1| unknown protein [Oryza sativa Japonica Group]
 gi|113623837|dbj|BAF23782.1| Os08g0432500 [Oryza sativa Japonica Group]
 gi|125561637|gb|EAZ07085.1| hypothetical protein OsI_29332 [Oryza sativa Indica Group]
 gi|215741119|dbj|BAG97614.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 162

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIML 95
           I +      SE       ++   YRVLL NDNY   E+V+ VL         + A  IM 
Sbjct: 62  IEKVTPGRQSEFDVRKSRKMTPPYRVLLHNDNYNRREYVVQVLMKVIPGMTVDNAVNIMQ 121

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           + H  G+    + +   AE     +          L+  +E 
Sbjct: 122 EAHVNGLSVVIICSQSEAEEHCTSLR------GNGLRSSIEP 157


>gi|182414611|ref|YP_001819677.1| ATP-dependent Clp protease adaptor protein ClpS [Opitutus terrae
           PB90-1]
 gi|177841825|gb|ACB76077.1| ATP-dependent Clp protease adaptor protein ClpS [Opitutus terrae
           PB90-1]
          Length = 107

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 6/100 (6%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
           E +     E + ++ + +  ++RV+++ND    M +V+ V +  F  D  TA+  ML+VH
Sbjct: 11  ESNPHSSPESQGATALALEGIWRVVVLNDPVNLMSYVVMVFKKVFGFDDATARRHMLEVH 70

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            QG         E AE     +  +     + L  ++E  
Sbjct: 71  EQGRSIVWSGLREKAEAYAFTLQQW-----H-LTAVLEPD 104


>gi|19553715|ref|NP_601717.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           glutamicum ATCC 13032]
 gi|62391355|ref|YP_226757.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           glutamicum ATCC 13032]
 gi|41326696|emb|CAF21178.1| conserved hypothetical protein [Corynebacterium glutamicum ATCC
           13032]
          Length = 124

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 40/110 (36%), Gaps = 8/110 (7%)

Query: 28  ADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
           +   M+          ++ +V   S   +P  +  ++ +D    M +V +V Q       
Sbjct: 21  SSLNMSSPSAPLATPDVELDVHTLSSENLP--WLCIVWDDPVNLMSYVTYVFQTVLGFSK 78

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           + A  +M++VH +G         +  E  V ++          L   M+Q
Sbjct: 79  KRATELMMQVHTEGKAVVSSGEKDKVEGDVKKLHTA------GLWATMQQ 122


>gi|315606163|ref|ZP_07881191.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces sp.
           oral taxon 180 str. F0310]
 gi|315312121|gb|EFU60210.1| ATP-dependent Clp protease adaptor protein ClpS [Actinomyces sp.
           oral taxon 180 str. F0310]
          Length = 95

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 34/81 (41%), Gaps = 6/81 (7%)

Query: 58  KLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKV 117
             +R ++ +D    M +V  V + +F      A+ +M++VH +G         E  E  V
Sbjct: 19  PRWRAVVWDDPVNLMTYVTAVFREYFGYSTARAEELMMRVHTRGRATVSTGVRERIEADV 78

Query: 118 NQVMNYSRQHQYPLQCIMEQK 138
             +      H Y L+  +E+ 
Sbjct: 79  MAM------HSYGLRATLEED 93


>gi|213965891|ref|ZP_03394082.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           amycolatum SK46]
 gi|213951469|gb|EEB62860.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           amycolatum SK46]
          Length = 97

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 34/84 (40%), Gaps = 6/84 (7%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
               + ++ ++ +D    M +V +V Q  F  D + A  +M+ VH +G         +  
Sbjct: 18  TESNRPWQCIVWDDQVNSMSYVTYVFQMLFGMDRKKAHALMMTVHTEGKAIVSSGERDKV 77

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQ 137
           E  V       + H+  L   MEQ
Sbjct: 78  EADVK------KLHKAGLWATMEQ 95


>gi|37077250|sp|Q8FMT9|CLPS_COREF RecName: Full=ATP-dependent Clp protease adapter protein ClpS
          Length = 101

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 35/103 (33%), Gaps = 6/103 (5%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIM 94
              +      D E+   +       +  ++ +D    M +V +V Q       + A  +M
Sbjct: 3   SSPSAPTAEPDVEMDVHTVSSENLPWLCIVWDDPVNLMSYVTYVFQTVLGYSRKRANELM 62

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ++VH +G         +  E  V ++          L   M+Q
Sbjct: 63  MQVHTEGKAVVSSGEKDKVEGDVKKLHVA------GLWATMQQ 99


>gi|227504006|ref|ZP_03934055.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           striatum ATCC 6940]
 gi|227199400|gb|EEI79448.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           striatum ATCC 6940]
          Length = 142

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 35/102 (34%), Gaps = 6/102 (5%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
           G       LD  +           +  ++ +D    M +V +V Q     D + A  +M+
Sbjct: 45  GSPMATPELDEAIEVDVASSENLPWMCIVWDDPVNLMSYVSYVFQTVLGYDKKRANELMM 104

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +VH +G         +  E  V ++          L   M+Q
Sbjct: 105 QVHTEGKAAVSTGERDKVEADVKKLQIA------GLWATMQQ 140


>gi|57335897|emb|CAH25350.1| hypothetical protein [Guillardia theta]
          Length = 233

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 29/109 (26%), Positives = 48/109 (44%), Gaps = 10/109 (9%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHET 89
            M K+        +D   R S K    K Y+VLL ND+    ++VI  L         + 
Sbjct: 134 EMEKERQGGRTAVMD---RPSDKTDPGKKYKVLLFNDDKNTRQYVIDTLMKYIPGMTADK 190

Query: 90  AKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           AK I +  H+ G+   GV+ YE+AE   + V+  +      L+  ++ +
Sbjct: 191 AKEITVAAHNTGMAIVGVWMYEMAEAYSD-VLRSA-----GLRSDIDPE 233


>gi|118619139|ref|YP_907471.1| hypothetical protein MUL_3931 [Mycobacterium ulcerans Agy99]
 gi|118571249|gb|ABL06000.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99]
          Length = 70

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 6/75 (8%)

Query: 64  LVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNY 123
           + +D    M +V +V Q  F      A  +ML+VH++G       + E  E+ V      
Sbjct: 1   MWDDPVNLMTYVTYVFQKLFGYSEPHATKLMLQVHNEGRAVVSAGSREAMEVDV------ 54

Query: 124 SRQHQYPLQCIMEQK 138
           S+ H   L   M+Q 
Sbjct: 55  SKLHAAGLWATMQQD 69


>gi|78211862|ref|YP_380641.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           CC9605]
 gi|78196321|gb|ABB34086.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 106

 Score = 80.3 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 40/113 (35%), Gaps = 9/113 (7%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YK 85
           M  +  +          LD       K      Y+VLL ND    ME+V+  LQ      
Sbjct: 1   MVMAVESPSQKPGGAAVLDKAPEKVRK--RSPRYKVLLHNDPVNSMEYVVATLQQVVPQL 58

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             +    +ML+ H+ G+G   V   E AE     + +        L   +E +
Sbjct: 59  SEQDCMAVMLEAHNTGVGLVIVCDIEPAEFYCETLKSK------GLTSSIEPE 105


>gi|158337023|ref|YP_001518198.1| ATP-dependent Clp protease adaptor protein ClpS [Acaryochloris
           marina MBIC11017]
 gi|158307264|gb|ABW28881.1| ATP-dependent Clp protease adaptor protein ClpS [Acaryochloris
           marina MBIC11017]
          Length = 98

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 32/81 (39%), Gaps = 1/81 (1%)

Query: 45  DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIG 103
           + +    +  +    ++V++VND+    E V   L     +   + A  +  ++H +G  
Sbjct: 9   EEKQAQKTVRKPYPNFKVIVVNDDVNTFEHVAKTLMTYIPHMTSDKAWELTNQIHFEGQA 68

Query: 104 ECGVYAYEIAEMKVNQVMNYS 124
              V   E AE+   Q+    
Sbjct: 69  IVWVGPQEQAELYHMQLQRAG 89


>gi|313835868|gb|EFS73582.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL037PA2]
 gi|314927132|gb|EFS90963.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL044PA1]
 gi|314970774|gb|EFT14872.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL037PA3]
 gi|328906038|gb|EGG25813.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           sp. P08]
          Length = 95

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 63  LLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           ++ +D    M++V  V   +F    E A  +M++VH++G       + E  E+ V+ +  
Sbjct: 23  VVWDDPVNLMDYVTMVFMRYFGYPRERATQLMIQVHNEGRATVAEGSKEEMEIAVHAM-- 80

Query: 123 YSRQHQYPLQCIMEQ 137
               H Y LQ  +E+
Sbjct: 81  ----HGYGLQASVEK 91


>gi|227494816|ref|ZP_03925132.1| ATP-dependent Clp protease adaptor protein [Actinomyces coleocanis
           DSM 15436]
 gi|226831268|gb|EEH63651.1| ATP-dependent Clp protease adaptor protein [Actinomyces coleocanis
           DSM 15436]
          Length = 102

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           +  ++ ND    M++V  V Q  F      A  +ML+VH  G         E  E  V  
Sbjct: 25  WATVVWNDPINLMDYVQAVFQRHFGFSQARAHELMLQVHLTGRALVSKGPKERMEADVLA 84

Query: 120 VMNYSRQHQYPLQCIMEQ 137
           +      H Y L+  +E 
Sbjct: 85  M------HGYGLRSTLEP 96


>gi|68535563|ref|YP_250268.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           jeikeium K411]
 gi|123651422|sp|Q4JX07|CLPS_CORJK RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|68263162|emb|CAI36650.1| conserved hypothetical protein [Corynebacterium jeikeium K411]
          Length = 101

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 14/87 (16%), Positives = 30/87 (34%), Gaps = 6/87 (6%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
            +       +  +  +D    M +V +V Q       + A  +M++VH +G         
Sbjct: 18  ETLTEPNLPWMCICWDDPVNLMSYVTYVFQTVLGYSRKRATELMMQVHTEGKAVVSSGER 77

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +  E  V ++          L   M++
Sbjct: 78  DKVEGDVKKLQTA------GLWATMQR 98


>gi|300780576|ref|ZP_07090431.1| ATP-dependent Clp protease adapter protein ClpS [Corynebacterium
           genitalium ATCC 33030]
 gi|300533562|gb|EFK54622.1| ATP-dependent Clp protease adapter protein ClpS [Corynebacterium
           genitalium ATCC 33030]
          Length = 112

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 42/124 (33%), Gaps = 14/124 (11%)

Query: 14  KRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPME 73
                  +   + M  S M    +   D  ++  V  +  +     +  ++ +D      
Sbjct: 1   MTGVNPEIRPGVRMG-SPMATPDL---DEQIEVNVDTAENL----PWMCIVWDDPVNLQS 52

Query: 74  FVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQC 133
           +V +V Q       + A+ +M++VH +G         +  E  V ++          L  
Sbjct: 53  YVTYVFQTVLGYGRKRAQELMMQVHTEGKAVVSSGEKDKVEGDVKKLHTA------GLWA 106

Query: 134 IMEQ 137
            M+Q
Sbjct: 107 TMQQ 110


>gi|260579690|ref|ZP_05847551.1| ATP-dependent Clp protease adapter protein ClpS [Corynebacterium
           jeikeium ATCC 43734]
 gi|258602182|gb|EEW15498.1| ATP-dependent Clp protease adapter protein ClpS [Corynebacterium
           jeikeium ATCC 43734]
          Length = 110

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 14/87 (16%), Positives = 30/87 (34%), Gaps = 6/87 (6%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
            +       +  +  +D    M +V +V Q       + A  +M++VH +G         
Sbjct: 27  ETLTEPNLPWMCICWDDPVNLMSYVTYVFQTVLGYSRKRATELMMQVHTEGKAVVSSGER 86

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +  E  V ++          L   M++
Sbjct: 87  DKVEGDVKKLQTA------GLWATMQR 107


>gi|37520315|ref|NP_923692.1| ATP-dependent Clp protease adaptor protein ClpS [Gloeobacter
           violaceus PCC 7421]
 gi|39930962|sp|Q7NML9|CLPS_GLOVI RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|35211308|dbj|BAC88687.1| gsl0746 [Gloeobacter violaceus PCC 7421]
          Length = 93

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 41/93 (44%), Gaps = 8/93 (8%)

Query: 48  VRFSSKVRVP-KLYRVLLVNDNYTPMEFVIHVLQN-FFYKDHETAKCIMLKVHHQGIGEC 105
           +   S  R P  LY+VLL ND++TPM +VI VL           A+ IML+ H+ G+   
Sbjct: 6   LERKSVQRKPMPLYKVLLHNDDHTPMNYVIEVLMKTIPKMQPSKARKIMLEAHNGGVAVV 65

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            V A E AE     +        + L    E  
Sbjct: 66  IVCALEHAEFYSESLNR------HNLTSTYEPD 92


>gi|298245523|ref|ZP_06969329.1| ATP-dependent Clp protease adaptor protein ClpS [Ktedonobacter
           racemifer DSM 44963]
 gi|297553004|gb|EFH86869.1| ATP-dependent Clp protease adaptor protein ClpS [Ktedonobacter
           racemifer DSM 44963]
          Length = 102

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 58  KLYRVLLVNDNYTPMEFVIH-VLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
            LY+V+L ND+Y  M  V+  +L+       + A  IML  H  G     V  +E+AE  
Sbjct: 27  PLYKVILFNDDYNDMLHVVAALLETVNTLTMQEATHIMLTAHLNGNAIVIVCPHELAEHY 86

Query: 117 VNQVMNYSRQHQYPLQCIMEQK 138
             +++ Y+      L   +E +
Sbjct: 87  QERLLGYA------LTVTIEPE 102


>gi|116072120|ref|ZP_01469388.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           BL107]
 gi|116065743|gb|EAU71501.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           BL107]
          Length = 104

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 39/111 (35%), Gaps = 9/111 (8%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDH 87
            +             LD       K      Y+VLL ND    ME+V+  L Q       
Sbjct: 1   MAEETPTRSPGGAAVLDKAPERVRK--RSPRYKVLLHNDPVNSMEYVMATLRQVVPQLSE 58

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + A  +ML+ H+ GIG   V   E AE     + +        L   +E +
Sbjct: 59  QDAMAVMLEAHNTGIGLVIVCDIEPAEFYCETLKSK------GLTSTIEPE 103


>gi|226493842|ref|NP_001148322.1| ATP-dependent Clp protease adaptor protein ClpS containing protein
           [Zea mays]
 gi|194701232|gb|ACF84700.1| unknown [Zea mays]
 gi|195617588|gb|ACG30624.1| ATP-dependent Clp protease adaptor protein ClpS containing protein
           [Zea mays]
          Length = 160

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 37/101 (36%), Gaps = 7/101 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIMLK 96
            +      SE       ++   +RV+L NDN+   E+V+ VL         + A  IM +
Sbjct: 61  EKITPGRQSEFDVKKSRKMTPPFRVILHNDNHNRREYVVQVLMKVIPGMTVDNALNIMQE 120

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            H  G+    V +   AE     +          L+  +E 
Sbjct: 121 AHVNGLSVVIVCSQSEAEEHCTSLR------GNGLRSSIEP 155


>gi|33862944|ref|NP_894504.1| ATP-dependent Clp protease adaptor [Prochlorococcus marinus str.
           MIT 9313]
 gi|33634861|emb|CAE20847.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9313]
          Length = 98

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 31/81 (38%), Gaps = 1/81 (1%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIMLKVHH 99
                  +  + + +     RV+++ND+    + V+  L+        E A  +  ++  
Sbjct: 5   TPGTTPLLERAKQTQRYPQARVIVLNDDVNTFQHVVDCLRRIIPGMSEERAWNLAHQIDG 64

Query: 100 QGIGECGVYAYEIAEMKVNQV 120
           QG  E      E AE+   Q+
Sbjct: 65  QGSAEVWCGPLEQAELYHQQL 85


>gi|124023254|ref|YP_001017561.1| ATP-dependent Clp protease adaptor [Prochlorococcus marinus str.
           MIT 9303]
 gi|123963540|gb|ABM78296.1| Uncharacterized conserved protein [Prochlorococcus marinus str. MIT
           9303]
          Length = 98

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 31/81 (38%), Gaps = 1/81 (1%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIMLKVHH 99
                  +  + + +     RV+++ND+    + V+  L+        E A  +  ++  
Sbjct: 5   TPGSTPLLERAKQTQRYPQARVIVLNDDVNTFQHVVDCLRRIIPGMSEERAWNLAHQIDG 64

Query: 100 QGIGECGVYAYEIAEMKVNQV 120
           QG  E      E AE+   Q+
Sbjct: 65  QGSAEVWCGPLEQAELYHQQL 85


>gi|313828232|gb|EFS65946.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL063PA2]
 gi|315110454|gb|EFT82430.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL030PA2]
          Length = 95

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           +  ++ +D    M++V  V   +F    E A  +M++VH+QG       + E  E+ V+ 
Sbjct: 20  WTTVVWDDPVNLMDYVTMVFMRYFGYPRERATQLMIQVHNQGRVTVAEGSKEEMEVAVHA 79

Query: 120 VMNYSRQHQYPLQCIMEQ 137
           +      H Y LQ  +E+
Sbjct: 80  M------HGYGLQASVEK 91


>gi|22297755|ref|NP_681002.1| ATP-dependent Clp protease adaptor protein ClpS
           [Thermosynechococcus elongatus BP-1]
 gi|22293932|dbj|BAC07764.1| tll0211 [Thermosynechococcus elongatus BP-1]
          Length = 99

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 38/99 (38%), Gaps = 9/99 (9%)

Query: 42  NCLDSEVRFSSKV--RVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVH 98
             +  +         ++   YRVLL NDN   ME+V+ VL +         A  IM++ H
Sbjct: 5   PTMSVQTIEKPATVRKLAPRYRVLLHNDNVNSMEYVVEVLLKTVPSLTQPQAVDIMMEAH 64

Query: 99  HQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
             G+      A E AE    + +  +      L   +E 
Sbjct: 65  LTGVALVITCALEHAEFYC-EGLKMA-----GLTSTIEP 97


>gi|256824919|ref|YP_003148879.1| hypothetical protein Ksed_10700 [Kytococcus sedentarius DSM 20547]
 gi|256688312|gb|ACV06114.1| uncharacterized conserved protein [Kytococcus sedentarius DSM
           20547]
          Length = 86

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 32/82 (39%), Gaps = 10/82 (12%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAE--MK 116
            +  L+ ND    M +V  VL + F     TA+ +M+ +H +G       + E  E   K
Sbjct: 12  PWYTLVWNDPVNLMSYVTFVLMDHFGYPQRTAEAMMMDIHTKGRCVVSTGSREAMEVDTK 71

Query: 117 VNQVMNYSRQHQYPLQCIMEQK 138
             Q        +Y L   + Q 
Sbjct: 72  AMQ--------EYGLWATLGQD 85


>gi|319441876|ref|ZP_07991032.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           variabile DSM 44702]
          Length = 101

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 14/87 (16%), Positives = 30/87 (34%), Gaps = 6/87 (6%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
            +       +  +  +D    M +V +V Q       + A  +M++VH +G         
Sbjct: 18  DTLTEADLPWLCICWDDPVNLMSYVTYVFQTVLGYSRKRATALMMEVHTEGKAIVSSGDR 77

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           +  E  V ++          L   M++
Sbjct: 78  DKVEADVKKLQTA------GLWATMQR 98


>gi|195652021|gb|ACG45478.1| ATP-dependent Clp protease adaptor protein ClpS containing protein
           [Zea mays]
          Length = 160

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 37/101 (36%), Gaps = 7/101 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIMLK 96
            +      SE       ++   +RV+L NDN+   E+V+ VL         + A  IM +
Sbjct: 61  EKITPGRQSEFDVKKSRKMTPPFRVILHNDNHNRREYVVQVLMKVIPGMTVDNALSIMQE 120

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            H  G+    V +   AE     +          L+  +E 
Sbjct: 121 AHVNGLSVVIVCSQSEAEEHCTSLR------GNGLRSSIEP 155


>gi|224001838|ref|XP_002290591.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220974013|gb|EED92343.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 147

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/109 (25%), Positives = 41/109 (37%), Gaps = 3/109 (2%)

Query: 14  KRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPME 73
            R   L+  + + MA        I + D   + E    SK      + V L ND     E
Sbjct: 30  SRSTALS-KTNLHMAAVAPAP--IKKSDIDTNYETDADSKSAKDPGWLVRLYNDPMNKRE 86

Query: 74  FVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           FV   L      D   A  +M+  H QG+   G Y  E+AE+   ++  
Sbjct: 87  FVARCLMEICGLDDGAAYTVMMHAHQQGLSVIGKYHREVAELYKMKLQM 135


>gi|317968680|ref|ZP_07970070.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           CB0205]
          Length = 106

 Score = 78.7 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 42/104 (40%), Gaps = 9/104 (8%)

Query: 38  AEFDNCLDSEVRFSSKV--RVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIM 94
              ++   + +  + +   +    Y+VLL ND    ME+V+  L Q       + A  +M
Sbjct: 8   PGRESGGAAVMEKAPERVRKPSPRYKVLLHNDPVNTMEYVVSTLRQVVPSLSEQDAIAVM 67

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           ++ H+ G+G   V   E AE         ++     L   +E +
Sbjct: 68  MEAHNTGVGLVIVCDIEPAEFYSE--TLKAK----GLSSTIEPE 105


>gi|254412762|ref|ZP_05026535.1| ATP-dependent Clp protease adaptor protein ClpS [Microcoleus
           chthonoplastes PCC 7420]
 gi|196180497|gb|EDX75488.1| ATP-dependent Clp protease adaptor protein ClpS [Microcoleus
           chthonoplastes PCC 7420]
          Length = 108

 Score = 78.7 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 32/75 (42%), Gaps = 2/75 (2%)

Query: 48  VRFSSKVRVP-KLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGEC 105
            +     R P   Y+V++++D++   + V   L +       + A  +  +VH +G    
Sbjct: 21  EKSRQVTRKPYPNYKVIVLDDDFNTFQHVHDCLVKYIPGMSSDYAWKLTNQVHFEGQAIV 80

Query: 106 GVYAYEIAEMKVNQV 120
            V   E AE+   Q+
Sbjct: 81  WVGPQEQAELYHQQL 95


>gi|33862055|ref|NP_893616.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
 gi|33634273|emb|CAE19958.1| conserved hypothetical protein [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
          Length = 118

 Score = 78.7 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/113 (23%), Positives = 47/113 (41%), Gaps = 10/113 (8%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYK 85
           M++ +  K    E +N    E + +        Y+VLL ND    ME+V + L +     
Sbjct: 14  MSNIKFEK---GENNNAAVLEKKTAPLKNKSPKYKVLLHNDPVNSMEYVTNALREVVPQL 70

Query: 86  DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             + A  IML+ H+ G+G   V   E AE     + +        +   +E++
Sbjct: 71  SEQDAISIMLEAHNTGVGLVIVCDLEPAEFYSESLKSK------GISSSIEKE 117


>gi|326385034|ref|ZP_08206706.1| ATP-dependent Clp protease adaptor protein ClpS [Gordonia
           neofelifaecis NRRL B-59395]
 gi|326196248|gb|EGD53450.1| ATP-dependent Clp protease adaptor protein ClpS [Gordonia
           neofelifaecis NRRL B-59395]
          Length = 85

 Score = 78.7 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 33/88 (37%), Gaps = 6/88 (6%)

Query: 51  SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
             +V   + +  L+ +D    M +V +V Q  F    E AK +M++VH +G         
Sbjct: 3   EPEVTHDRPWVTLVWDDPVNLMNYVAYVFQKVFGYSEEKAKALMMQVHTEGKAVVSSGDR 62

Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
              E  V ++          L   M+  
Sbjct: 63  VKMEADVRKLHAA------GLWATMQHD 84


>gi|108803856|ref|YP_643793.1| ATP-dependent Clp protease adaptor protein ClpS [Rubrobacter
           xylanophilus DSM 9941]
 gi|108765099|gb|ABG03981.1| ATP-dependent Clp protease adaptor protein ClpS [Rubrobacter
           xylanophilus DSM 9941]
          Length = 107

 Score = 78.3 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 35/107 (32%), Gaps = 7/107 (6%)

Query: 33  NKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAK 91
            +              +          YRV+L ND++TPM+ V+  L           A 
Sbjct: 6   TRDIRCSAATKTAPARKTRRAPSREPRYRVILHNDDWTPMDHVVAALMKVVPRLSLRRAV 65

Query: 92  CIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            IML+ H +G         E+AE+    +          L   +E  
Sbjct: 66  SIMLEAHTKGQAVVTRCHRELAELYREGLKAE------GLISTIEPD 106


>gi|78185599|ref|YP_378033.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           CC9902]
 gi|123580669|sp|Q3AUR5|CLPS_SYNS9 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|78169893|gb|ABB26990.1| conserved hypothetical protein [Synechococcus sp. CC9902]
          Length = 104

 Score = 78.3 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 39/111 (35%), Gaps = 9/111 (8%)

Query: 29  DSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDH 87
            +             LD       K      Y+VLL ND    ME+V+  L Q       
Sbjct: 1   MAEETPTRSPGGAAVLDKAPERVRK--RSPRYKVLLHNDPVNSMEYVMTTLRQVVPQLSE 58

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           + A  +ML+ H+ G+G   V   E AE     + +        L   +E +
Sbjct: 59  QDAMAVMLEAHNTGVGLVIVCDIEPAEFYCETLKSK------GLTSSIEPE 103


>gi|311741206|ref|ZP_07715030.1| ATP-dependent Clp protease adapter protein ClpS [Corynebacterium
           pseudogenitalium ATCC 33035]
 gi|311303376|gb|EFQ79455.1| ATP-dependent Clp protease adapter protein ClpS [Corynebacterium
           pseudogenitalium ATCC 33035]
          Length = 108

 Score = 78.3 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 35/100 (35%), Gaps = 6/100 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
                 LD E+           +  ++ +D    M +V +V Q     D + A  +M++V
Sbjct: 13  PMATPELDEELDVDVATSENLPWMCIVWDDPVNLMSYVSYVFQTVLGYDKKRANELMMQV 72

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H +G         +  E  V ++          L   M+Q
Sbjct: 73  HTEGKAAVSSGERDKIEADVKKLQIA------GLWATMQQ 106


>gi|255324319|ref|ZP_05365440.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           tuberculostearicum SK141]
 gi|255298649|gb|EET77945.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           tuberculostearicum SK141]
          Length = 114

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 44/125 (35%), Gaps = 14/125 (11%)

Query: 13  VKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPM 72
           V+ +G+ A    + M+               LD E+           +  ++ +D    M
Sbjct: 2   VRLEGMKAQFPVVRMSS--------PMATPELDEELDVDVATSENLPWMCIVWDDPVNLM 53

Query: 73  EFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQ 132
            +V +V Q     D + A  +M++VH +G         +  E  V ++          L 
Sbjct: 54  SYVSYVFQTVLGYDKKRANELMMQVHTEGKAAVSSGERDKIEADVKKLQIA------GLW 107

Query: 133 CIMEQ 137
             M+Q
Sbjct: 108 ATMQQ 112


>gi|223948869|gb|ACN28518.1| unknown [Zea mays]
          Length = 119

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 37/101 (36%), Gaps = 7/101 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIMLK 96
            +      SE       ++   +RV+L NDN+   E+V+ VL         + A  IM +
Sbjct: 20  EKITPGRQSEFDVKKSRKMTPPFRVILHNDNHNRREYVVQVLMKVIPGMTVDNALNIMQE 79

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            H  G+    V +   AE     +          L+  +E 
Sbjct: 80  AHVNGLSVVIVCSQSEAEEHCTSLR------GNGLRSSIEP 114


>gi|314956858|gb|EFT01012.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL027PA1]
          Length = 95

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQ 119
           +  ++ +D    M++V  V   +F    E A  +M++VH+Q        + E  E+ V+ 
Sbjct: 20  WTTVVWDDPVNLMDYVTMVFMRYFGYPRERATQLMIQVHNQDRATVAEGSKEEMEVAVHA 79

Query: 120 VMNYSRQHQYPLQCIMEQ 137
           +      H Y LQ  +E+
Sbjct: 80  M------HGYGLQASVEK 91


>gi|225166273|ref|ZP_03727970.1| ATP-dependent Clp protease adaptor protein ClpS [Opitutaceae
           bacterium TAV2]
 gi|224799486|gb|EEG18018.1| ATP-dependent Clp protease adaptor protein ClpS [Opitutaceae
           bacterium TAV2]
          Length = 110

 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 39/112 (34%), Gaps = 6/112 (5%)

Query: 27  MADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKD 86
           MAD   N           +              + V+++ND    M +++ VL+     D
Sbjct: 1   MADDTHNHPFHPPASPQENPAAGTHLHPSPDGPWHVVIINDPVNLMSYLVLVLRKVLGID 60

Query: 87  HETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            +TA+  M+ VH +G         E AE     +  +     + L   +E  
Sbjct: 61  EDTARKHMMTVHEEGRSIVWTGLREKAEHYAFSLQQW-----H-LNARIEPD 106


>gi|148239546|ref|YP_001224933.1| ATP-dependent Clp protease adaptor [Synechococcus sp. WH 7803]
 gi|147848085|emb|CAK23636.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 7803]
          Length = 98

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 34/85 (40%), Gaps = 1/85 (1%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIML 95
           +      + + +    + +     RV+++ND++   E V+  L       + E A  +  
Sbjct: 1   MTSSSPGVSTVLERDRQAQRYPQARVIVLNDDFNTFEHVVESLCRIIPGMNTEKAWSLAH 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQV 120
           ++  +G  E      E AE+   Q+
Sbjct: 61  RIDGEGAAEVWCGPLEQAELYHQQL 85


>gi|227833926|ref|YP_002835633.1| hypothetical protein cauri_2102 [Corynebacterium aurimucosum ATCC
           700975]
 gi|254763814|sp|C3PIP1|CLPS_CORA7 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|227454942|gb|ACP33695.1| hypothetical protein cauri_2102 [Corynebacterium aurimucosum ATCC
           700975]
          Length = 111

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 34/100 (34%), Gaps = 6/100 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
                 LD  +           +  ++ +D    M +V +V Q     D + A  +M++V
Sbjct: 16  PMATPELDEAIEVDVATSENLPWMCIVWDDPVNLMSYVSYVFQTVLGYDKKRANELMMQV 75

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H +G         +  E  V ++          L   M+Q
Sbjct: 76  HTEGKAAVSSGERDKVEADVKKLQVA------GLWATMQQ 109


>gi|56751052|ref|YP_171753.1| ATP-dependent Clp protease adaptor [Synechococcus elongatus PCC
           6301]
 gi|56686011|dbj|BAD79233.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 136

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 29/69 (42%), Gaps = 1/69 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    +RV++++D+    + V   L +       + A  +  +VH++G         E A
Sbjct: 57  QPYPHFRVIVLDDDVNTFQHVAECLLKYIPGMTGDRAWDLTNQVHYEGAATVWSGPQEQA 116

Query: 114 EMKVNQVMN 122
           E+   Q+  
Sbjct: 117 ELYHEQLRR 125


>gi|81299287|ref|YP_399495.1| ATP-dependent Clp protease adaptor [Synechococcus elongatus PCC
           7942]
 gi|81168168|gb|ABB56508.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 136

 Score = 77.2 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 29/69 (42%), Gaps = 1/69 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +    +RV++++D+    + V   L +       + A  +  +VH++G         E A
Sbjct: 57  QPYPHFRVIVLDDDVNTFQHVAECLLKYIPGMTGDRAWDLTNQVHYEGAATVWSGPQEQA 116

Query: 114 EMKVNQVMN 122
           E+   Q+  
Sbjct: 117 ELYHEQLRR 125


>gi|259508030|ref|ZP_05750930.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           efficiens YS-314]
 gi|259164371|gb|EEW48925.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           efficiens YS-314]
          Length = 86

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 15/79 (18%), Positives = 30/79 (37%), Gaps = 6/79 (7%)

Query: 59  LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVN 118
            +  ++ +D    M +V +V Q       + A  +M++VH +G         +  E  V 
Sbjct: 12  PWLCIVWDDPVNLMSYVTYVFQTVLGYSRKRANELMMQVHTEGKAVVSSGEKDKVEGDVK 71

Query: 119 QVMNYSRQHQYPLQCIMEQ 137
           ++          L   M+Q
Sbjct: 72  KLHVA------GLWATMQQ 84


>gi|227502992|ref|ZP_03933041.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           accolens ATCC 49725]
 gi|306836777|ref|ZP_07469737.1| ATP-dependent Clp protease adapter protein ClpS [Corynebacterium
           accolens ATCC 49726]
 gi|227076053|gb|EEI14016.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           accolens ATCC 49725]
 gi|304567323|gb|EFM42928.1| ATP-dependent Clp protease adapter protein ClpS [Corynebacterium
           accolens ATCC 49726]
          Length = 108

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 35/110 (31%), Gaps = 6/110 (5%)

Query: 28  ADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDH 87
                 +         LD  +           +  ++ +D    M +V +V Q     D 
Sbjct: 3   PQHPEVRMSSPMATPDLDEGIEVDVAASENLPWMCIVWDDPVNLMSYVSYVFQTVLGYDK 62

Query: 88  ETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           + A  +M++VH +G         +  E  V ++          L   M+Q
Sbjct: 63  KRANELMMQVHTEGKAAVSSGEKDKVEADVKKLQIA------GLWATMQQ 106


>gi|262184929|ref|ZP_06044350.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           aurimucosum ATCC 700975]
          Length = 95

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 34/97 (35%), Gaps = 6/97 (6%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
              LD  +           +  ++ +D    M +V +V Q     D + A  +M++VH +
Sbjct: 3   TPELDEAIEVDVATSENLPWMCIVWDDPVNLMSYVSYVFQTVLGYDKKRANELMMQVHTE 62

Query: 101 GIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           G         +  E  V ++          L   M+Q
Sbjct: 63  GKAAVSSGERDKVEADVKKLQVA------GLWATMQQ 93


>gi|307105846|gb|EFN54094.1| hypothetical protein CHLNCDRAFT_31972 [Chlorella variabilis]
          Length = 166

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 7/82 (8%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIMLKVHHQGIGECGVYAYEIAEM 115
           P  YRVLL NDNY   E+V+ VL         + A  IM + H  G+      A + AE+
Sbjct: 79  PPSYRVLLHNDNYNRREYVVQVLMKVVEGTTVDDAVNIMQEAHINGLAMVTQCAQDKAEL 138

Query: 116 KVNQVMNYSRQHQYPLQCIMEQ 137
               +    R +   L   +E 
Sbjct: 139 YCESL----RLNG--LIATIEP 154


>gi|297571673|ref|YP_003697447.1| ATP-dependent Clp protease adaptor protein ClpS [Arcanobacterium
           haemolyticum DSM 20595]
 gi|296932020|gb|ADH92828.1| ATP-dependent Clp protease adaptor protein ClpS [Arcanobacterium
           haemolyticum DSM 20595]
          Length = 100

 Score = 76.8 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 36/93 (38%), Gaps = 6/93 (6%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
           SE      V     +  ++ +D    M +V  V +++F      A+  ML VH +G    
Sbjct: 13  SETDAQESVFSDAAWLTVVHDDPVNLMAYVQWVFESYFGMTSTVARERMLAVHRKGRAVL 72

Query: 106 GVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
                E  E  V  +      H Y L+  +EQ+
Sbjct: 73  AAGGREAMERDVQAM------HTYGLRATIEQE 99


>gi|88808607|ref|ZP_01124117.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 7805]
 gi|88787595|gb|EAR18752.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 7805]
          Length = 111

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 32/85 (37%), Gaps = 1/85 (1%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIML 95
           +      + + +    +       RV+++ND+    E V+  L       + + A  +  
Sbjct: 14  MTSSSPGVSTVLERDRQALRYPQARVIVLNDDVNTFEHVVESLCRIIPGMNTDKAWALAR 73

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQV 120
           +V  +G  E      E AE+   Q+
Sbjct: 74  RVDGEGSAEVWCGPLEQAELYHQQL 98


>gi|86606056|ref|YP_474819.1| ATP-dependent Clp protease adaptor [Synechococcus sp. JA-3-3Ab]
 gi|86554598|gb|ABC99556.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           JA-3-3Ab]
          Length = 101

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 51  SSKVRVP-KLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGECGVY 108
            ++VR P   ++V++++D++   + V   L +         A+ + ++V  +G     V 
Sbjct: 17  RTRVRQPYPHFKVIVLDDDFNTFQHVTECLLKYIPGMTLPLARQLTVQVDAEGQAVVWVG 76

Query: 109 AYEIAEMKVNQVMN 122
             E AE+   Q++ 
Sbjct: 77  PQEQAELYHQQLLR 90


>gi|326334474|ref|ZP_08200685.1| ATP-dependent Clp protease adaptor protein ClpS [Capnocytophaga sp.
           oral taxon 338 str. F0234]
 gi|325693243|gb|EGD35171.1| ATP-dependent Clp protease adaptor protein ClpS [Capnocytophaga sp.
           oral taxon 338 str. F0234]
          Length = 96

 Score = 76.0 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 32/75 (42%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           + +       E +     +   LY+++L ND+Y   ++VI +L       +E A+   + 
Sbjct: 1   MPQTQPTPQQESQEELLTQYADLYQIILYNDDYNTFDYVIDLLMEVCEHTYEQAEQCAMI 60

Query: 97  VHHQGIGECGVYAYE 111
           VH+ G        YE
Sbjct: 61  VHYSGKCPVKEGTYE 75


>gi|86610000|ref|YP_478762.1| ATP-dependent Clp protease adaptor [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86558542|gb|ABD03499.1| ATP-dependent Clp protease adaptor protein clpS [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 101

 Score = 76.0 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 51  SSKVRVP-KLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGECGVY 108
            ++VR P   ++V++++D++   + V   L +         A+ + ++V  +G     V 
Sbjct: 17  RTQVRQPYPHFKVIVLDDDFNTFQHVTECLLKYIPGMTLPLARQLTVQVDAEGQAVVWVG 76

Query: 109 AYEIAEMKVNQVMN 122
             E AE+   Q++ 
Sbjct: 77  PQEQAELYHQQLLR 90


>gi|149192136|ref|ZP_01870358.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio shilonii
           AK1]
 gi|148834039|gb|EDL51054.1| ATP-dependent Clp protease adaptor protein ClpS [Vibrio shilonii
           AK1]
          Length = 45

 Score = 75.6 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%)

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           ML VH++G   CG Y  E+AE KV QV  YSR++++PL C ME+
Sbjct: 1   MLAVHYEGKAVCGTYTSEVAETKVAQVTMYSRENEHPLLCTMEK 44


>gi|123969234|ref|YP_001010092.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus str. AS9601]
 gi|123199344|gb|ABM70985.1| Uncharacterized conserved protein [Prochlorococcus marinus str.
           AS9601]
          Length = 105

 Score = 75.6 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 41/102 (40%), Gaps = 7/102 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLK 96
           +  +N    E + +        Y+VLL ND    ME+V   L +       + A  IML+
Sbjct: 9   SGSNNSAVIEKKPAELKNKSPKYKVLLHNDPVNSMEYVTISLREVVPQLSEQDAIAIMLE 68

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H+ GIG   V   E AE     + +        +   +E++
Sbjct: 69  AHNTGIGLVIVCDLEPAEFYSESLKSK------GISSSIEKE 104


>gi|123966912|ref|YP_001011993.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus str. MIT 9515]
 gi|229889822|sp|A2BYM5|CLPS_PROM5 RecName: Full=ATP-dependent Clp protease adapter protein ClpS
 gi|123201278|gb|ABM72886.1| Uncharacterized conserved protein [Prochlorococcus marinus str. MIT
           9515]
          Length = 105

 Score = 75.6 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 36/86 (41%), Gaps = 1/86 (1%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIM 94
              + +N    E + ++       Y+VLL ND    ME++   L +       + A  IM
Sbjct: 7   EKGDNNNAAVLEKKTAALKNKSPKYKVLLHNDPVNSMEYITIALREVVPQLSEQDAIAIM 66

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQV 120
           L+ H+ G+G   V   E AE     +
Sbjct: 67  LEAHNNGVGLVIVCDLEPAEFYSESL 92


>gi|78212974|ref|YP_381753.1| ATP-dependent Clp protease adaptor [Synechococcus sp. CC9605]
 gi|78197433|gb|ABB35198.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 98

 Score = 75.2 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 31/86 (36%), Gaps = 1/86 (1%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIML 95
           +        + +      +     RV++++D+    + V+  L+        + A  +  
Sbjct: 1   MTSSSPGSSAVLERQGTTQRYPQARVIVLDDDVNTFQHVVDCLRKIIPGMSEDNAWNLAN 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVM 121
           ++  QG  E      E AE+   Q+ 
Sbjct: 61  RIDGQGSAEVWCGPLEQAELYHQQLQ 86


>gi|296118689|ref|ZP_06837265.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           ammoniagenes DSM 20306]
 gi|295968178|gb|EFG81427.1| ATP-dependent Clp protease adaptor protein ClpS [Corynebacterium
           ammoniagenes DSM 20306]
          Length = 95

 Score = 75.2 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 37/100 (37%), Gaps = 10/100 (10%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKV 97
            + D  +D  V     +     +  ++ +D    M +V +V Q     D + A  +M++V
Sbjct: 4   PKLDEAVDVSVASEENL----PWMCIVWDDPVNLMSYVSYVFQTVLGYDKKRANELMMQV 59

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           H +G         +  E  V ++          L   M+Q
Sbjct: 60  HTEGKAAVTSGERDKVEADVKKLQVA------GLWATMQQ 93


>gi|254526054|ref|ZP_05138106.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus str. MIT 9202]
 gi|221537478|gb|EEE39931.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus str. MIT 9202]
          Length = 105

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 41/104 (39%), Gaps = 8/104 (7%)

Query: 37  IAEFDNCLDSEVRFSSKVR-VPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIM 94
                N      +  ++++     Y+VLL ND    ME+V   L +       + A  IM
Sbjct: 7   EQSVSNGSAVIEKKPAELKNKSPKYKVLLHNDPVNSMEYVTISLREVVPQLSEQDAIAIM 66

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           L+ H+ GIG   +   E AE     + +        +   +E++
Sbjct: 67  LEAHNTGIGLVIICDLEPAEFYSESLKSK------GISSSIEKE 104


>gi|116074794|ref|ZP_01472055.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           RS9916]
 gi|116068016|gb|EAU73769.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           RS9916]
          Length = 98

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 31/86 (36%), Gaps = 1/86 (1%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIML 95
           +        + +  S   +     RV+++ND+    + V+  L         E A  +  
Sbjct: 1   MTGSSGAQSTLLERSRTTQGYPEARVIVLNDDVNTFQHVVDCLCKIIPGMGTERAWDLAH 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVM 121
           +V  QG  E      E AE+   Q+ 
Sbjct: 61  QVDGQGSAEVWCGPLEQAELYHQQLT 86


>gi|78779975|ref|YP_398087.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus str. MIT 9312]
 gi|78713474|gb|ABB50651.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9312]
          Length = 105

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 41/102 (40%), Gaps = 7/102 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLK 96
           +  +N    E + +        YRVLL ND    ME+V   L +       + A  IML+
Sbjct: 9   SVSNNSAVIEKKPAELKNKSPKYRVLLHNDPVNSMEYVTISLREVVPQLSEQDAIAIMLE 68

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
            H+ G+G   V   E AE     + +        +   +E++
Sbjct: 69  AHNTGVGLVIVCDLEPAEFYSESLKSK------GISSSIEKE 104


>gi|260434286|ref|ZP_05788256.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 8109]
 gi|260412160|gb|EEX05456.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           WH 8109]
          Length = 98

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 12/87 (13%), Positives = 31/87 (35%), Gaps = 1/87 (1%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIML 95
           +        + +      +     RV++++D+    + V+  L+        + A  +  
Sbjct: 1   MTSSSPGSSAVLERQGTTQRYPQARVIVLDDDVNTFQHVVDCLRKIIPGMSEDNAWNLAN 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMN 122
           ++   G  E      E AE+   Q+ +
Sbjct: 61  RIDGHGAAEVWCGPLEQAELYHQQLQS 87


>gi|219113493|ref|XP_002186330.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|209583180|gb|ACI65800.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 161

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 39/119 (32%), Gaps = 9/119 (7%)

Query: 13  VKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKL---------YRVL 63
                +        M+ + + ++ +      +       ++V  P           + V 
Sbjct: 30  SFGSSVSRSTVAARMSPATIERESVKVGAPAVLDRPAEKTRVDEPVKERKGMGHEAWEVR 89

Query: 64  LVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           + ND     E V   L          A   M++ H  GI   G + YE+AEM  + + N
Sbjct: 90  IYNDGLNTREHVARSLVQVTGMSEMEAYQTMMQAHQNGIAVVGRWVYEVAEMYHDALQN 148


>gi|157414100|ref|YP_001484966.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus
           marinus str. MIT 9215]
 gi|157388675|gb|ABV51380.1| Conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9215]
          Length = 105

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 38/94 (40%), Gaps = 7/94 (7%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGE 104
            E + +        Y+VLL ND    ME+V   L +       + A  IML+ H+ GIG 
Sbjct: 17  IEKKPAELKNKSPKYKVLLHNDPVNSMEYVTISLREVVPQLSEQDAIAIMLEAHNTGIGL 76

Query: 105 CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
             +   E AE     + +        +   +E++
Sbjct: 77  VIICDLEPAEFYSESLKSK------GISSSIEKE 104


>gi|113955042|ref|YP_730629.1| ATP-dependent Clp protease adaptor [Synechococcus sp. CC9311]
 gi|113882393|gb|ABI47351.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           CC9311]
          Length = 98

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 31/85 (36%), Gaps = 1/85 (1%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIML 95
           +        S ++           RV+++ND+    E V+  L       + + A  +  
Sbjct: 1   MTMATPGTASVLQPERTTLRYPNARVIVLNDDVNTFEHVVECLCKIIPGMNSDKAWTLAH 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQV 120
           ++  +G  E      E AE+   Q+
Sbjct: 61  QIDGEGAAEVWAGPLEPAELYHQQL 85


>gi|33865838|ref|NP_897397.1| ATP-dependent Clp protease adaptor [Synechococcus sp. WH 8102]
 gi|33633008|emb|CAE07819.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 98

 Score = 73.3 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 30/74 (40%), Gaps = 1/74 (1%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIMLKVHHQGIGECG 106
           +   +  +     RV++++D+    + V+  L+        E A  +  ++  QG  E  
Sbjct: 12  LERQTITQRYPQARVIVLDDDVNTFQHVVDCLRKIIPGMSEEKAWSLANRIDGQGSAEVW 71

Query: 107 VYAYEIAEMKVNQV 120
               E AE+   Q+
Sbjct: 72  CGPLEQAELYHQQL 85


>gi|148242507|ref|YP_001227664.1| ATP-dependent Clp protease adaptor [Synechococcus sp. RCC307]
 gi|147850817|emb|CAK28311.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           RCC307]
          Length = 98

 Score = 73.3 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 13/87 (14%), Positives = 30/87 (34%), Gaps = 5/87 (5%)

Query: 35  KGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCI 93
                      + +  +        ++V+++ND     + V+  L +     D + A  +
Sbjct: 3   SSAPSRQTAGSTLLERAP----YPNFKVVVLNDEVNTFQHVVDCLVKYIPAMDPDRAWSL 58

Query: 94  MLKVHHQGIGECGVYAYEIAEMKVNQV 120
             ++   G     V   E AE+   Q+
Sbjct: 59  AQQIDSDGQAVVWVGPQEQAELYHMQL 85


>gi|108804875|ref|YP_644812.1| ATP-dependent Clp protease adaptor protein ClpS [Rubrobacter
           xylanophilus DSM 9941]
 gi|108766118|gb|ABG05000.1| ATP-dependent Clp protease adaptor protein ClpS [Rubrobacter
           xylanophilus DSM 9941]
          Length = 106

 Score = 73.3 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 33/78 (42%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           + R   K      Y V+L++D+    E+VI +L+  F         +  +V   G     
Sbjct: 8   KRRSREKSGGLPPYNVVLLDDDDHSYEYVIFMLRKLFGYPVRKGYELAREVDTTGRAVVA 67

Query: 107 VYAYEIAEMKVNQVMNYS 124
               E AE+K +Q+ ++ 
Sbjct: 68  TTHLEEAELKRDQIQSFG 85


>gi|313205912|ref|YP_004045089.1| ATP-dependent clp protease adaptor protein clps [Riemerella
           anatipestifer DSM 15868]
 gi|312445228|gb|ADQ81583.1| ATP-dependent Clp protease adaptor protein ClpS [Riemerella
           anatipestifer DSM 15868]
          Length = 95

 Score = 72.9 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 37/86 (43%), Gaps = 4/86 (4%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
            I   +N  +  V  S++ +    ++++L ND++   +FVI  L        E A+    
Sbjct: 5   NIPNKENEEEVSVLSSTEAK----HKLVLHNDDFNTFDFVIESLMEVCAHTLEQAEQCTF 60

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVM 121
            VH++G         E+ E    +++
Sbjct: 61  LVHYKGKCTVKTGNLELIEPMHKKLL 86


>gi|228472184|ref|ZP_04056950.1| ATP-dependent Clp protease adaptor protein ClpS [Capnocytophaga
           gingivalis ATCC 33624]
 gi|228276387|gb|EEK15111.1| ATP-dependent Clp protease adaptor protein ClpS [Capnocytophaga
           gingivalis ATCC 33624]
          Length = 96

 Score = 72.9 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 35/88 (39%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           + +       E +     +    Y+++L ND+Y   ++VI +L       +E A+   + 
Sbjct: 1   MPQTQPTPQKESQEELLTQQADNYQIMLYNDDYNTFDYVIELLIEICDHTYEQAEQCAVL 60

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYS 124
           VH  G       +YE    + +++    
Sbjct: 61  VHFSGKCPVKEGSYEDLLPRCSKLTQAG 88


>gi|315022224|gb|EFT35252.1| hypothetical protein RAYM_05465 [Riemerella anatipestifer RA-YM]
 gi|325336648|gb|ADZ12922.1| ClpS [Riemerella anatipestifer RA-GD]
          Length = 97

 Score = 72.9 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 40/91 (43%), Gaps = 4/91 (4%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
           +M  + I   +N  +  V  S++ +    ++++L ND++   +FVI  L        E A
Sbjct: 2   KMVFQNIPNKENEEEVSVLSSTEAK----HKLVLHNDDFNTFDFVIESLMEVCAHTLEQA 57

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVM 121
           +     VH++G         E+ E    +++
Sbjct: 58  EQCTFLVHYKGKCTVKTGNLELIEPMHKKLL 88


>gi|284928874|ref|YP_003421396.1| hypothetical protein UCYN_02930 [cyanobacterium UCYN-A]
 gi|284809333|gb|ADB95038.1| uncharacterized conserved protein [cyanobacterium UCYN-A]
          Length = 106

 Score = 72.9 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 14/87 (16%), Positives = 32/87 (36%), Gaps = 1/87 (1%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIML 95
           I E     + +       +     +++++ND++   + V + L +         A  +  
Sbjct: 9   IPETSISTNIKHSAVIDYKPYPNCKIIVLNDDFNTFDHVANCLIRYIPAMTKSHAWELTQ 68

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMN 122
           K+H  G     +   E AE+   Q+  
Sbjct: 69  KIHFNGFATVWMGPLEQAELYHQQLRR 95


>gi|183222314|ref|YP_001840310.1| putative signal peptide [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189912362|ref|YP_001963917.1| ATP-dependent Clp protease adaptor protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167777038|gb|ABZ95339.1| ATP-dependent Clp protease adaptor protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167780736|gb|ABZ99034.1| Conserved hypothetical protein; putative signal peptide [Leptospira
           biflexa serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 108

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 32/78 (41%), Gaps = 1/78 (1%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E       +    ++V+L +D++   E+VI +L +      E A    ++V  +      
Sbjct: 14  ETEIKP-TKHDGPWKVVLWDDDHHTYEYVIEMLMDVCQMTWEKAFQHAVEVDTRKKTIVF 72

Query: 107 VYAYEIAEMKVNQVMNYS 124
               E AE    +++NY 
Sbjct: 73  SGELEHAEFIHERILNYG 90


>gi|120434799|ref|YP_860485.1| ATP-dependent Clp protease adaptor protein [Gramella forsetii
           KT0803]
 gi|117576949|emb|CAL65418.1| ATP-dependent Clp protease adaptor protein [Gramella forsetii
           KT0803]
          Length = 91

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 33/84 (39%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               +       K +  K   ++L ND+Y   + VI  L        E A+   + VH++
Sbjct: 2   STKEEVLEEVEIKTKDKKENEIVLYNDDYNTFDHVIDTLIYACEHTPEQAEQCSILVHYK 61

Query: 101 GIGECGVYAYEIAEMKVNQVMNYS 124
           G        Y+  + + +++++  
Sbjct: 62  GKCTVKTGPYKELKPRCSKLLDAG 85


>gi|268317544|ref|YP_003291263.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodothermus
           marinus DSM 4252]
 gi|262335078|gb|ACY48875.1| ATP-dependent Clp protease adaptor protein ClpS [Rhodothermus
           marinus DSM 4252]
          Length = 104

 Score = 71.8 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 29/75 (38%), Gaps = 2/75 (2%)

Query: 39  EFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVH 98
                +D E    +++  P  +RV+L ND+    + VI  L          A+ +  KVH
Sbjct: 14  GPAPEVDVEDTEETRLDAP--WRVILYNDDIHTFDEVIFQLMKATGCSLPEAEALTWKVH 71

Query: 99  HQGIGECGVYAYEIA 113
            +G        +E  
Sbjct: 72  TEGKAAVYEGLFEEC 86


>gi|163787701|ref|ZP_02182148.1| hypothetical protein FBALC1_04142 [Flavobacteriales bacterium
           ALC-1]
 gi|159877589|gb|EDP71646.1| hypothetical protein FBALC1_04142 [Flavobacteriales bacterium
           ALC-1]
          Length = 91

 Score = 71.8 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 13/64 (20%), Positives = 28/64 (43%)

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
            ++L ND+    + VI  L        E A+   + VH++G       +Y+  E + + +
Sbjct: 22  EIVLFNDDVNTFDHVIDTLIYACEHTPEQAEQCSIIVHYKGKCTVKTGSYDDLEPRCSML 81

Query: 121 MNYS 124
           ++  
Sbjct: 82  LDAG 85


>gi|314967388|gb|EFT11487.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL082PA2]
 gi|314982107|gb|EFT26200.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL110PA3]
 gi|315090346|gb|EFT62322.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL110PA4]
 gi|315093629|gb|EFT65605.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL060PA1]
 gi|327325469|gb|EGE67273.1| putative ATP-dependent Clp protease adaptor protein ClpS
           [Propionibacterium acnes HL103PA1]
          Length = 198

 Score = 71.8 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 25/52 (48%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYE 111
           +  ++ +D    M++V  V   +F    E A  +M++VH+QG       + +
Sbjct: 20  WTTVVWDDPVNLMDYVTMVFMRYFGYPRERATQLMIQVHNQGRATVAEGSKD 71


>gi|50843142|ref|YP_056369.1| hypothetical protein PPA1680 [Propionibacterium acnes KPA171202]
 gi|50840744|gb|AAT83411.1| conserved protein (DUF174) [Propionibacterium acnes KPA171202]
 gi|315106213|gb|EFT78189.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL030PA1]
          Length = 198

 Score = 71.8 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 25/52 (48%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYE 111
           +  ++ +D    M++V  V   +F    E A  +M++VH+QG       + +
Sbjct: 20  WTTVVWDDPVNLMDYVTMVFMRYFGYPRERATQLMIQVHNQGRATVAEGSKD 71


>gi|254421403|ref|ZP_05035121.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           PCC 7335]
 gi|196188892|gb|EDX83856.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           PCC 7335]
          Length = 71

 Score = 71.8 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 28/62 (45%), Gaps = 1/62 (1%)

Query: 64  LVNDNYTPMEFVIHVLQ-NFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           ++ND++   E V+  L       + + A  +  ++H++G         E AE+  +Q++ 
Sbjct: 1   MLNDDFNTFEHVVKTLTTYIPGMNSDQAWELADQIHNEGQAIVWTGPLEQAELYHSQLIR 60

Query: 123 YS 124
             
Sbjct: 61  AG 62


>gi|86132928|ref|ZP_01051519.1| ATP-dependent Clp protease adaptor protein ClpS [Dokdonia
           donghaensis MED134]
 gi|85816634|gb|EAQ37821.1| ATP-dependent Clp protease adaptor protein ClpS [Dokdonia
           donghaensis MED134]
          Length = 91

 Score = 71.4 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 14/84 (16%), Positives = 30/84 (35%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
            N    +            + ++L ND+    + VI+ L      +   A    L VH++
Sbjct: 2   SNQEKYQEELDILTEESPAHEIILYNDDVNTFDHVINTLIYACDHEENQAHQCALLVHYK 61

Query: 101 GIGECGVYAYEIAEMKVNQVMNYS 124
           G        Y+  E + ++++   
Sbjct: 62  GKCSVKSGDYKDLEPRCSKLLQAG 85


>gi|162449014|ref|YP_001611381.1| hypothetical protein sce0744 [Sorangium cellulosum 'So ce 56']
 gi|161159596|emb|CAN90901.1| hypothetical protein predicted by Glimmer/Critica [Sorangium
           cellulosum 'So ce 56']
          Length = 285

 Score = 71.0 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 33/75 (44%)

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
            V+  ND+ T ME V  +L + F  D   A   ML VH  G    G Y  + A   + + 
Sbjct: 179 EVVFWNDDVTKMEAVQRLLVDCFGMDEVEATHFMLTVHFAGSAAAGPYRPDTAAALLARA 238

Query: 121 MNYSRQHQYPLQCIM 135
              +R+   P++  +
Sbjct: 239 TQVARERGMPIRITL 253


>gi|116070493|ref|ZP_01467762.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           BL107]
 gi|116065898|gb|EAU71655.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus sp.
           BL107]
          Length = 98

 Score = 70.6 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 30/75 (40%), Gaps = 1/75 (1%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIMLKVHHQGIGECG 106
           +      +     +V++++D+    + V+  L+      D + A  +  ++  +G  E  
Sbjct: 12  LERQKTTQRYPEAKVIVLDDDVNTFQHVVDCLRKIIPGMDEDKAWGLAHRIDGEGSAEVW 71

Query: 107 VYAYEIAEMKVNQVM 121
               E AE+   Q+ 
Sbjct: 72  RGPLEQAELYHQQLQ 86


>gi|87302745|ref|ZP_01085556.1| hypothetical protein WH5701_13370 [Synechococcus sp. WH 5701]
 gi|87282628|gb|EAQ74586.1| hypothetical protein WH5701_13370 [Synechococcus sp. WH 5701]
          Length = 96

 Score = 70.6 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 28/69 (40%), Gaps = 1/69 (1%)

Query: 55  RVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           +     RV++++D+    + V++ L  +      + A  +  ++  QG         E A
Sbjct: 17  QRYPHLRVVVLDDDVNTFQHVVNCLVRYLPGMGPDRAWELAHQIDSQGSAVVWSGPQEQA 76

Query: 114 EMKVNQVMN 122
           E+   Q+  
Sbjct: 77  ELYHQQLSQ 85


>gi|314924274|gb|EFS88105.1| ATP-dependent Clp protease adaptor protein ClpS [Propionibacterium
           acnes HL001PA1]
          Length = 198

 Score = 70.6 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 25/52 (48%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYE 111
           +  ++ +D    M++V  V   +F    E A  +M++VH+QG       + +
Sbjct: 20  WTTVVWDDPVNLMDYVTMVFMRYFGYPRERATQLMIQVHNQGRATVVEGSKD 71


>gi|78184628|ref|YP_377063.1| ATP-dependent Clp protease adaptor [Synechococcus sp. CC9902]
 gi|78168922|gb|ABB26019.1| conserved hypothetical protein [Synechococcus sp. CC9902]
          Length = 98

 Score = 70.2 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 30/75 (40%), Gaps = 1/75 (1%)

Query: 48  VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNF-FYKDHETAKCIMLKVHHQGIGECG 106
           +      +     +V++++D+    + V+  L+      D E A  +  ++  QG  E  
Sbjct: 12  LERQKTTQRYPEAKVIVLDDDVNTFQHVVDCLRKIIPGMDEEKAWGLAHRIDGQGSAEVW 71

Query: 107 VYAYEIAEMKVNQVM 121
               E AE+   Q+ 
Sbjct: 72  RGPLEQAELYHLQLQ 86


>gi|300777810|ref|ZP_07087668.1| ATP-dependent Clp protease adaptor protein ClpS [Chryseobacterium
           gleum ATCC 35910]
 gi|300503320|gb|EFK34460.1| ATP-dependent Clp protease adaptor protein ClpS [Chryseobacterium
           gleum ATCC 35910]
          Length = 101

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 12/53 (22%), Positives = 25/53 (47%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           Y+++L ND+    ++VI  L        E A+   + VH++G       + ++
Sbjct: 31  YKLVLHNDDIHTFDYVIDCLIEICKHTLEQAEQCTILVHYKGKCTVKTGSMDV 83


>gi|183221780|ref|YP_001839776.1| putative ATP-dependent Clp protease adaptor protein C [Leptospira
           biflexa serovar Patoc strain 'Patoc 1 (Paris)']
 gi|189911854|ref|YP_001963409.1| ATP-dependent Clp protease adaptor protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167776530|gb|ABZ94831.1| ATP-dependent Clp protease adaptor protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167780202|gb|ABZ98500.1| Putative ATP-dependent Clp protease adaptor protein C [Leptospira
           biflexa serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 94

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 28/76 (36%)

Query: 47  EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECG 106
           E   S K      Y V+L ND+     +V   L    +K    AK I ++ H  G   C 
Sbjct: 10  EEETSLKTDSVYSYFVILFNDSIHEFAYVEDCLMKLCFKTKRDAKKIAIEAHTNGKAICF 69

Query: 107 VYAYEIAEMKVNQVMN 122
             + E  E     + N
Sbjct: 70  QGSMEECETVAENMTN 85


>gi|91080927|ref|XP_974039.1| PREDICTED: similar to ubiquitin ligase E3 alpha [Tribolium
           castaneum]
 gi|270005384|gb|EFA01832.1| hypothetical protein TcasGA2_TC007434 [Tribolium castaneum]
          Length = 1757

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 29/77 (37%), Gaps = 1/77 (1%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA-EMKVN 118
           Y  +L ND     E VI  L      +  TA   +  +  +G       +++   E+K  
Sbjct: 226 YCTILYNDEIHTFEQVISTLTRVLKCNQRTAIEFVTNIDREGRAVVKCSSFQHCTELKQE 285

Query: 119 QVMNYSRQHQYPLQCIM 135
                SR    PL+ ++
Sbjct: 286 IEKYTSRHGNKPLKVLV 302


>gi|255036663|ref|YP_003087284.1| ATP-dependent Clp protease adaptor protein ClpS [Dyadobacter
           fermentans DSM 18053]
 gi|254949419|gb|ACT94119.1| ATP-dependent Clp protease adaptor protein ClpS [Dyadobacter
           fermentans DSM 18053]
          Length = 91

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 30/69 (43%)

Query: 44  LDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIG 103
            D+E+    +     + ++++ ND+    ++VI  L        E A+   + +H++G  
Sbjct: 5   TDTELEILEETVATDIKKLVIYNDDVNTFDWVIDTLVEVCGHTSEQAEQCTIIIHYKGKC 64

Query: 104 ECGVYAYEI 112
                ++E 
Sbjct: 65  SVKEGSFEE 73


>gi|86141235|ref|ZP_01059781.1| hypothetical protein MED217_04437 [Leeuwenhoekiella blandensis
           MED217]
 gi|85831794|gb|EAQ50249.1| hypothetical protein MED217_04437 [Leeuwenhoekiella blandensis
           MED217]
          Length = 91

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 13/64 (20%), Positives = 27/64 (42%)

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
            +++ ND+    + VI  L          A+   L VH++G       +YE  E + + +
Sbjct: 22  EIVVYNDDVNTFDHVIDTLIEVCDHTPIQAEQCSLIVHYKGKCTVKTGSYEYLEPRCSAL 81

Query: 121 MNYS 124
           ++  
Sbjct: 82  LDAG 85


>gi|254495168|ref|ZP_05108092.1| ATP-dependent Clp protease adaptor protein ClpS [Polaribacter sp.
           MED152]
 gi|85819519|gb|EAQ40676.1| ATP-dependent Clp protease adaptor protein ClpS [Polaribacter sp.
           MED152]
          Length = 91

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/84 (16%), Positives = 32/84 (38%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
                 +       +    + ++L ND+    +FVI  L N      E A+   + VH++
Sbjct: 2   STKEKIQEEVDVLEKEVFQHEIVLHNDDVNTFDFVIESLINVCDHTLEQAEQCTILVHYK 61

Query: 101 GIGECGVYAYEIAEMKVNQVMNYS 124
           G        ++  E + ++++   
Sbjct: 62  GKCTVKSGEFKDLEPRCSKLLQLG 85


>gi|213962229|ref|ZP_03390493.1| ATP-dependent Clp protease adaptor protein ClpS [Capnocytophaga
           sputigena Capno]
 gi|213955235|gb|EEB66553.1| ATP-dependent Clp protease adaptor protein ClpS [Capnocytophaga
           sputigena Capno]
          Length = 95

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 30/76 (39%), Gaps = 6/76 (7%)

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
            ++L ND+    + VI  L    +   E A+   + VH +G  +    +YE  E     +
Sbjct: 25  HLILYNDDVNTFDHVIDTLVEVCHHTFEQAEQCAIIVHFKGKCDVKTGSYEYLEPLCTAL 84

Query: 121 MNYSRQHQYPLQCIME 136
           ++        L   +E
Sbjct: 85  LDA------GLSAQIE 94


>gi|295132850|ref|YP_003583526.1| ATP-dependent Clp protease adaptor protein [Zunongwangia profunda
           SM-A87]
 gi|294980865|gb|ADF51330.1| ATP-dependent Clp protease adaptor protein [Zunongwangia profunda
           SM-A87]
          Length = 89

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 34/84 (40%), Gaps = 2/84 (2%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
               +   +  +KV       ++L ND+Y   + VI  L        E A+   + VH++
Sbjct: 2   STQEEVLEKVETKVDKEN--EIVLYNDDYNTFDHVIETLIYACDHTPEQAEQCSILVHYK 59

Query: 101 GIGECGVYAYEIAEMKVNQVMNYS 124
           G       A+   + + +++++  
Sbjct: 60  GKCTVKTGAFADLKPRCSKLLDAG 83


>gi|87124406|ref|ZP_01080255.1| hypothetical protein RS9917_12370 [Synechococcus sp. RS9917]
 gi|86167978|gb|EAQ69236.1| hypothetical protein RS9917_12370 [Synechococcus sp. RS9917]
          Length = 98

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 12/80 (15%), Positives = 30/80 (37%), Gaps = 1/80 (1%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIMLKVHHQ 100
               + +  ++        RV++++D+    + V+  L         E A  +  ++  +
Sbjct: 6   TGTATVLDRATSRSDYPQARVIVLDDDVNTFQHVVDCLCRIIPGMGSERAWDLAHRIDSE 65

Query: 101 GIGECGVYAYEIAEMKVNQV 120
           G  +      E AE+   Q+
Sbjct: 66  GAADVWSGPLEQAELYHQQL 85


>gi|159467236|ref|XP_001691804.1| clp protease adaptor protein [Chlamydomonas reinhardtii]
 gi|158279150|gb|EDP04912.1| clp protease adaptor protein [Chlamydomonas reinhardtii]
          Length = 147

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 37/103 (35%), Gaps = 9/103 (8%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIM 94
                     S V  S K   P +Y+VLL NDNY   E+V+ VL         + A   M
Sbjct: 50  DAPTTTQQPASGVERSQK--RPPIYKVLLHNDNYNKREYVVKVLLKVVEQITVDDAVTCM 107

Query: 95  LKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            + H  G+        + AE     +    R +   L   +E 
Sbjct: 108 QEAHETGVALVVACPQDNAERYCEGL----RLNG--LTSTIEP 144


>gi|157120908|ref|XP_001659789.1| ubiquitin ligase E3 alpha [Aedes aegypti]
 gi|108874767|gb|EAT38992.1| ubiquitin ligase E3 alpha [Aedes aegypti]
          Length = 2550

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 31/90 (34%), Gaps = 9/90 (10%)

Query: 53   KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
             V    +Y  +L ND     E VI  L +      + A   +  +  +G       ++E 
Sbjct: 1002 DVDDEDIYCTILYNDETHTFEQVIQTLTSIVKCTQKEAIEYVTSIDREGRAVVKCASFET 1061

Query: 113  A-------EMKVNQVMNYSRQHQYPLQCIM 135
                    E KV +    ++    PL+  +
Sbjct: 1062 CKKLKEDVENKVIRSSMTAKAS--PLKVTV 1089


>gi|225850997|ref|YP_002731231.1| ATP-dependent Clp protease adaptor protein ClpS [Persephonella
           marina EX-H1]
 gi|225645917|gb|ACO04103.1| ATP-dependent Clp protease adaptor protein ClpS [Persephonella
           marina EX-H1]
          Length = 90

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
            +  EV     V+     +V++ ND++   E VI+ +      D ETA+ +  ++H +G 
Sbjct: 2   GIGFEVEVEKDVQTYIPAKVVVYNDDWHTFEEVIYQIMKAIKCDLETAQNLTWEIHTKGK 61

Query: 103 GECGVYAYEIAEMKVNQVMN 122
                  +E A +KV  ++ 
Sbjct: 62  AVVYEGDFEEA-LKVANILE 80


>gi|326672781|ref|XP_001921590.3| PREDICTED: e3 ubiquitin-protein ligase UBR2 [Danio rerio]
          Length = 1756

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 34/95 (35%), Gaps = 5/95 (5%)

Query: 45  DSEVRFSSKVRVP---KLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
           D E      +  P    +Y  +L ND     E VI+ LQ       + A      V   G
Sbjct: 210 DKEDELPEGLEPPARGDMYYCMLFNDEVHTYEQVIYTLQKAVNCTQKEAVSFATTVDRDG 269

Query: 102 IGECGVYAYEIAEM-KVNQVMNYSRQHQYPLQCIM 135
                   ++  E  K   V N SRQ + PL+  +
Sbjct: 270 RKSVRFGDFQFCEQAKSVIVRNTSRQTK-PLRVQV 303


>gi|149277214|ref|ZP_01883356.1| hypothetical protein PBAL39_10001 [Pedobacter sp. BAL39]
 gi|149232091|gb|EDM37468.1| hypothetical protein PBAL39_10001 [Pedobacter sp. BAL39]
          Length = 115

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 36/92 (39%), Gaps = 6/92 (6%)

Query: 31  RMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETA 90
           +M+ +   E     +      +      ++R++L ND+    + VIH +  +       A
Sbjct: 22  KMSTETKEETFTLEEILTSLKT------IHRLILWNDDVNTFDHVIHCMMKYLDYSESQA 75

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
           + I  +VH++G       ++   E+    +  
Sbjct: 76  EKIAWEVHNKGKCAVLEGSFTEMEVYRKILQQ 107


>gi|110637456|ref|YP_677663.1| hypothetical protein CHU_1046 [Cytophaga hutchinsonii ATCC 33406]
 gi|110280137|gb|ABG58323.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 99

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 30/68 (44%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
             + +V    +V+   +  +++ ND+    E VI VL +      E A+   L +H++G 
Sbjct: 12  QQEEDVALMEEVQTSDMNDLVVYNDDVNTFEHVIQVLMSVCGHSPEQAEQCTLLIHYKGK 71

Query: 103 GECGVYAY 110
               + + 
Sbjct: 72  CTVKMGSL 79


>gi|332170809|gb|AEE20064.1| ATP-dependent Clp protease adaptor protein ClpS [Krokinobacter
           diaphorus 4H-3-7-5]
          Length = 91

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 14/84 (16%), Positives = 29/84 (34%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
            N    +            + ++L ND     + VI+ L      +   A    L VH++
Sbjct: 2   SNQEKYQEDVDVLTEETPSHEIILYNDEVNTFDHVINTLIYACDHEENQAHQCALLVHYK 61

Query: 101 GIGECGVYAYEIAEMKVNQVMNYS 124
           G        Y+  E + ++++   
Sbjct: 62  GKCSVKSGEYKDLEPRCSKLLQAG 85


>gi|325955115|ref|YP_004238775.1| ATP-dependent Clp protease adaptor protein ClpS [Weeksella virosa
           DSM 16922]
 gi|323437733|gb|ADX68197.1| ATP-dependent Clp protease adaptor protein ClpS [Weeksella virosa
           DSM 16922]
          Length = 97

 Score = 68.3 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 13/80 (16%), Positives = 31/80 (38%)

Query: 43  CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGI 102
               E          +  ++++ ND+    ++VI  L +      E A+   L +H+ G 
Sbjct: 10  ETSPETDIEVLTEEKEQNQIIVHNDDVNTFDWVIESLIDVCDHTPEQAEQCTLIIHYNGK 69

Query: 103 GECGVYAYEIAEMKVNQVMN 122
            +     Y   + +  +++N
Sbjct: 70  CDVLTGEYTYLKPRCEELLN 89


>gi|254819164|ref|ZP_05224165.1| ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium
           intracellulare ATCC 13950]
          Length = 62

 Score = 68.3 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 28/67 (41%), Gaps = 6/67 (8%)

Query: 72  MEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPL 131
           M +V +V Q  F      A  +ML+VH++G       + E  E  V      S+ H   L
Sbjct: 1   MTYVTYVFQKLFGYSEPHATKLMLQVHNEGKAVVSAGSRESMEADV------SKLHAAGL 54

Query: 132 QCIMEQK 138
              ++Q 
Sbjct: 55  WATLQQD 61


>gi|318041538|ref|ZP_07973494.1| ATP-dependent Clp protease adaptor [Synechococcus sp. CB0101]
          Length = 93

 Score = 67.9 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 33/76 (43%), Gaps = 2/76 (2%)

Query: 47  EVRFSSKVRVP-KLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGE 104
            VR   +V  P    RV++++D++   + V+ VL +       + A  +  ++  QG   
Sbjct: 5   AVRDKQRVDAPYPTGRVIVLDDDHNTFQHVVEVLVRYIPAMTSDRAWELAHQIDGQGSAL 64

Query: 105 CGVYAYEIAEMKVNQV 120
                 E AE+   Q+
Sbjct: 65  VWSGPLEQAELYHQQL 80


>gi|150025727|ref|YP_001296553.1| hypothetical protein FP1679 [Flavobacterium psychrophilum JIP02/86]
 gi|149772268|emb|CAL43746.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86]
          Length = 91

 Score = 67.9 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
            ++L ND+    + VI+ L    + +   A+   L VH++G        ++  E+K
Sbjct: 22  EIVLFNDDVNTFDHVINTLIRVCHHEELQAEQCALLVHYKGKCVVKTGTFD--ELK 75


>gi|225013083|ref|ZP_03703498.1| ATP-dependent Clp protease adaptor protein ClpS [Flavobacteria
           bacterium MS024-2A]
 gi|225002811|gb|EEG40792.1| ATP-dependent Clp protease adaptor protein ClpS [Flavobacteria
           bacterium MS024-2A]
          Length = 94

 Score = 67.9 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 25/75 (33%)

Query: 37  IAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLK 96
           ++E       E          + + ++L ND+    E VI  L      +   A+     
Sbjct: 1   MSEAQPFNKPEEEVEVSTLTDREHEIILYNDDVNTFEHVIECLVAICDHNALQAEQCAYL 60

Query: 97  VHHQGIGECGVYAYE 111
           VH+ G       + E
Sbjct: 61  VHYSGKCAVKSGSLE 75


>gi|307187669|gb|EFN72641.1| E3 ubiquitin-protein ligase UBR2 [Camponotus floridanus]
          Length = 1784

 Score = 67.9 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 31/77 (40%), Gaps = 1/77 (1%)

Query: 60  YRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA-EMKVN 118
           Y  +L ND +   + VI++LQ       + A   +  V  +G        +    E++V+
Sbjct: 253 YCTVLFNDEHHTFDQVINMLQRVIKCSQKEAVEFVTNVDREGRAVVKCSVFRHCNELRVD 312

Query: 119 QVMNYSRQHQYPLQCIM 135
                 R    PL+ ++
Sbjct: 313 IERFTYRHSNRPLKVLV 329


>gi|312129998|ref|YP_003997338.1| ATP-dependent clp protease adaptor protein clps [Leadbetterella
           byssophila DSM 17132]
 gi|311906544|gb|ADQ16985.1| ATP-dependent Clp protease adaptor protein ClpS [Leadbetterella
           byssophila DSM 17132]
          Length = 95

 Score = 67.9 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 25/55 (45%)

Query: 58  KLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
           KLY +++ ND+    + VI  L  +    +E A+   L +H +G        YE 
Sbjct: 21  KLYSLVVFNDDVNTFDHVIETLVEYCDHTYEQAEQCTLIIHFKGKCAVKNGDYEE 75


>gi|299471643|emb|CBN76865.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 225

 Score = 67.9 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 14/78 (17%), Positives = 28/78 (35%), Gaps = 1/78 (1%)

Query: 46  SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYK-DHETAKCIMLKVHHQGIGE 104
            EV    ++   + +RV+L ND     ++V   +     K   + A  + ++ H  G   
Sbjct: 99  VEVDNKEELDKEQWWRVILHNDEIHTFDYVTQSITKVVKKLTMKKAYEVTMETHKSGKAT 158

Query: 105 CGVYAYEIAEMKVNQVMN 122
                   +E    Q+  
Sbjct: 159 VTQAWKSKSESYCLQLQQ 176


>gi|289569343|ref|ZP_06449570.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Mycobacterium
           tuberculosis T17]
 gi|289543097|gb|EFD46745.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Mycobacterium
           tuberculosis T17]
          Length = 73

 Score = 67.5 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 23/50 (46%)

Query: 56  VPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGEC 105
             + +  ++ +D    M +V +V Q  F      A  +ML+VH++G    
Sbjct: 24  TDRAWVTIVWDDPVNLMSYVTYVFQKLFGYSEPHATKLMLQVHNEGKAVV 73


>gi|325287228|ref|YP_004263018.1| ATP-dependent Clp protease adaptor protein ClpS [Cellulophaga
           lytica DSM 7489]
 gi|324322682|gb|ADY30147.1| ATP-dependent Clp protease adaptor protein ClpS [Cellulophaga
           lytica DSM 7489]
          Length = 91

 Score = 67.5 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 12/64 (18%), Positives = 27/64 (42%)

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
            ++L ND+    + VI  L +        A+     VH++G       +Y+  E + +++
Sbjct: 22  EIVLFNDDVNTFDHVIDTLVDACDHTPIQAEQCAFLVHYKGKCTVKTGSYKDLEPRCSKL 81

Query: 121 MNYS 124
           +   
Sbjct: 82  LQAG 85


>gi|149370136|ref|ZP_01889987.1| hypothetical protein SCB49_03644 [unidentified eubacterium SCB49]
 gi|149356627|gb|EDM45183.1| hypothetical protein SCB49_03644 [unidentified eubacterium SCB49]
          Length = 91

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 13/63 (20%), Positives = 25/63 (39%)

Query: 62  VLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVM 121
           ++L ND+    + VI  L          A+     VH++G       +YE  E + + ++
Sbjct: 23  IVLFNDDVNTFDDVIDALVYACDHTPLQAEQCATLVHYKGKCTVKTGSYEDLEPRCSMLL 82

Query: 122 NYS 124
              
Sbjct: 83  EAG 85


>gi|78779324|ref|YP_397436.1| ATP-dependent Clp protease adaptor [Prochlorococcus marinus str.
           MIT 9312]
 gi|78712823|gb|ABB50000.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9312]
          Length = 95

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 2/72 (2%)

Query: 50  FSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQGIGECGVY 108
             SKV+ P+  RV++++D++   + V + L           A  + +KV + G  E    
Sbjct: 12  KKSKVKYPEA-RVIVLDDSFNTFQHVANCLLIIIPGMSENRAWDLTIKVDNTGSAEVWRG 70

Query: 109 AYEIAEMKVNQV 120
             E AE+   Q+
Sbjct: 71  NLEQAELYHEQL 82


>gi|146301250|ref|YP_001195841.1| ATP-dependent Clp protease adaptor protein ClpS [Flavobacterium
           johnsoniae UW101]
 gi|146155668|gb|ABQ06522.1| ATP-dependent Clp protease adaptor protein ClpS [Flavobacterium
           johnsoniae UW101]
          Length = 91

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 31/83 (37%), Gaps = 2/83 (2%)

Query: 44  LDSEVRFSSKVRVPKLYR--VLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQG 101
              +VR   + +   ++   +++ ND+    + VI  L        E A+   L VH+ G
Sbjct: 3   TKEKVREKVREKEAAVFNNEIIMYNDDVNTFDHVIDTLMRVCDHTAEQAEQCSLIVHYNG 62

Query: 102 IGECGVYAYEIAEMKVNQVMNYS 124
                    E  + +  Q++   
Sbjct: 63  KCTVKTGPIEKLKPQCTQLLEAG 85


>gi|305664962|ref|YP_003861249.1| ribosomal protein L11 methyltransferase [Maribacter sp. HTCC2170]
 gi|88707792|gb|EAR00032.1| ribosomal protein L11 methyltransferase [Maribacter sp. HTCC2170]
          Length = 91

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 25/64 (39%)

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
            ++L ND     + VI  L        E A+   L VH+ G        Y+  E + +++
Sbjct: 22  EIVLFNDEVNTFDHVIDTLIAACDHTPEQAEQCSLIVHYNGKCTVKTGEYKDLEPRCSKL 81

Query: 121 MNYS 124
           +   
Sbjct: 82  LQAG 85


>gi|88803812|ref|ZP_01119335.1| hypothetical protein PI23P_06261 [Polaribacter irgensii 23-P]
 gi|88780340|gb|EAR11522.1| hypothetical protein PI23P_06261 [Polaribacter irgensii 23-P]
          Length = 91

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 12/84 (14%), Positives = 32/84 (38%)

Query: 41  DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100
                 +       +    + ++L ND+    + VI+ L +      E A+   + VH++
Sbjct: 2   STKEKIQEEVDVLEKEIFQHEIVLHNDDVNTFDHVINSLMDVCEHTLEQAEQCAMLVHYK 61

Query: 101 GIGECGVYAYEIAEMKVNQVMNYS 124
           G        ++  E + ++++   
Sbjct: 62  GKCSVKSGEFKDLEPRCSKLLQLG 85


>gi|317970016|ref|ZP_07971406.1| ATP-dependent Clp protease adaptor [Synechococcus sp. CB0205]
          Length = 103

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 13/88 (14%), Positives = 30/88 (34%), Gaps = 1/88 (1%)

Query: 32  MNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETA 90
           M             + +            RV++++D++   + V+ VL ++      + A
Sbjct: 1   MQPIRSISSSPGGQAVMERQRVRAPYPTGRVIVLDDDHNTFQHVVEVLVKHIPAMVSDRA 60

Query: 91  KCIMLKVHHQGIGECGVYAYEIAEMKVN 118
             +  ++  QG         E AE+   
Sbjct: 61  WELAHQIDSQGSAVVWSGPLEQAELYHQ 88


>gi|123968534|ref|YP_001009392.1| ATP-dependent Clp protease adaptor [Prochlorococcus marinus str.
           AS9601]
 gi|123198644|gb|ABM70285.1| Hypothetical protein A9601_10011 [Prochlorococcus marinus str.
           AS9601]
          Length = 95

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 31/80 (38%), Gaps = 1/80 (1%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQ 100
           N L + +            RV++++DN+   + V + L         + A  + +KV   
Sbjct: 3   NSLGTVLEPKKSKAKYPEARVIVLDDNFNTFQHVANCLLTIIPSMSEQRAWDLTIKVDKT 62

Query: 101 GIGECGVYAYEIAEMKVNQV 120
           G  E      E AE+   Q+
Sbjct: 63  GSAEVWRGNLEQAELYHEQL 82


>gi|319952046|ref|YP_004163313.1| ATP-dependent clp protease adaptor protein clps [Cellulophaga
           algicola DSM 14237]
 gi|319420706|gb|ADV47815.1| ATP-dependent Clp protease adaptor protein ClpS [Cellulophaga
           algicola DSM 14237]
          Length = 91

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 24/64 (37%)

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
            ++L ND     + VI  L        E A+   + VHH G        YE  + +  ++
Sbjct: 22  EIVLFNDEVNTFDHVIETLIGVCDHTPEQAEQCSIIVHHNGKCTVKTGDYEDLKPRCTKL 81

Query: 121 MNYS 124
           +   
Sbjct: 82  LQAG 85


>gi|126696337|ref|YP_001091223.1| ATP-dependent Clp protease adaptor [Prochlorococcus marinus str.
           MIT 9301]
 gi|126543380|gb|ABO17622.1| Conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9301]
          Length = 95

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 31/80 (38%), Gaps = 1/80 (1%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQ 100
           N L + +            RV++++DN+   + V + L         + A  + +KV   
Sbjct: 3   NSLGTVLDPKKSKAKYPEARVIVLDDNFNTFQHVANCLLTIIPSMSEQRAWDLTIKVDKT 62

Query: 101 GIGECGVYAYEIAEMKVNQV 120
           G  E      E AE+   Q+
Sbjct: 63  GSAEVWRGNLEQAELYHEQL 82


>gi|163756853|ref|ZP_02163962.1| nucleoside triphosphate pyrophosphohydrolase [Kordia algicida OT-1]
 gi|161323242|gb|EDP94582.1| nucleoside triphosphate pyrophosphohydrolase [Kordia algicida OT-1]
          Length = 91

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 13/64 (20%), Positives = 27/64 (42%)

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120
            ++L ND+    + VI  L        E A+   + VH++G        YE  + + +++
Sbjct: 22  EIVLYNDDVNTFDHVIETLIYACDHTAEQAEQCSIIVHYKGKCTVKTGKYEELKPRCSKL 81

Query: 121 MNYS 124
           +   
Sbjct: 82  LEAG 85


>gi|124003951|ref|ZP_01688798.1| ATP-dependent Clp protease adaptor protein ClpS [Microscilla marina
           ATCC 23134]
 gi|123990530|gb|EAY30010.1| ATP-dependent Clp protease adaptor protein ClpS [Microscilla marina
           ATCC 23134]
          Length = 90

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 10/50 (20%), Positives = 21/50 (42%)

Query: 61  RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110
           ++ + ND+    + VI+ L        E A+     +H++G     V  +
Sbjct: 21  QLTVFNDDINTFDHVINTLIEVCNHTPEQAEQCTWIIHYKGKCSVKVGEF 70


>gi|116620336|ref|YP_822492.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116223498|gb|ABJ82207.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 115

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 37/89 (41%)

Query: 36  GIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95
            +A      D+E+    + +   LYRV+L++DN    ++VI +LQ  F    + A     
Sbjct: 7   QMANPAIAPDTEILEREREQHVPLYRVVLLDDNDHTYDYVIEMLQKIFIFTLDQAYRHAE 66

Query: 96  KVHHQGIGECGVYAYEIAEMKVNQVMNYS 124
           +V   G           AE   +Q+  Y 
Sbjct: 67  EVDRAGRTVLITCELREAEYARDQIQAYG 95


>gi|119624501|gb|EAX04096.1| ubiquitin protein ligase E3 component n-recognin 2, isoform CRA_c
           [Homo sapiens]
          Length = 187

 Score = 66.0 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 30/83 (36%), Gaps = 2/83 (2%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
           V     Y  +L ND     E VI+ LQ       + A      V   G        ++  
Sbjct: 2   VEKSDTYYCMLFNDEVHTYEQVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYC 61

Query: 114 EM-KVNQVMNYSRQHQYPLQCIM 135
           E  K   V N SRQ + PL+  +
Sbjct: 62  EQAKSVIVRNTSRQTK-PLKVQV 83


>gi|302834902|ref|XP_002949013.1| hypothetical protein VOLCADRAFT_73976 [Volvox carteri f.
           nagariensis]
 gi|300265758|gb|EFJ49948.1| hypothetical protein VOLCADRAFT_73976 [Volvox carteri f.
           nagariensis]
          Length = 160

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 36/101 (35%), Gaps = 7/101 (6%)

Query: 38  AEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEF-VIHVLQNFFYKDHETAKCIMLK 96
                  + +       + P +Y+V L NDNY   E+ V  +L+       + A  +M +
Sbjct: 63  DSPTITSEPQQGTDRAYKRPPIYKVFLHNDNYNKREYVVKVLLKVVEEITVDDAVTVMQE 122

Query: 97  VHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
            H  G+        E AE     +    R +   L   +E 
Sbjct: 123 AHETGVALVVACPQENAERYCEGL----RLNG--LTSTIEP 157


>gi|72002284|gb|AAZ58086.1| conserved hypothetical protein [Prochlorococcus marinus str.
           NATL2A]
 gi|123961170|gb|ABM75953.1| Hypothetical protein NATL1_13951 [Prochlorococcus marinus str.
           NATL1A]
          Length = 111

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 52  SKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIMLKVHHQGIGECGVYAY 110
           +K++ P+  R+++++DN+   E V + L         + +  + ++V  +G+ E     +
Sbjct: 30  TKIKYPEA-RIIVLDDNFNTFEHVANCLVTIIPGMSEKRSWELAVEVDREGLAEVWRGPF 88

Query: 111 EIAEMKVNQVMN 122
           E AE+   Q+++
Sbjct: 89  EQAELYHQQLIS 100


>gi|70944829|ref|XP_742303.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 gi|56521205|emb|CAH75820.1| conserved hypothetical protein [Plasmodium chabaudi chabaudi]
          Length = 190

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/103 (15%), Positives = 34/103 (33%), Gaps = 4/103 (3%)

Query: 24  FIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPK---LYRVLLVNDNYTPMEFVIHVLQ 80
              + + +  +  + +       E     K++  K    ++V+L ND+     +V  V+ 
Sbjct: 67  DANLENIKKLRNVVKDIKKENKREYEDEEKLKREKEAYAWKVILYNDDIHNFTYVTDVIV 126

Query: 81  NFFYK-DHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMN 122
                     A  I ++ H  G           AEM   ++  
Sbjct: 127 KVIGYISKAKAHTITVEAHSTGQALILSTWKAKAEMYCEELQK 169


>gi|294463540|gb|ADE77299.1| unknown [Picea sitchensis]
          Length = 202

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 34/115 (29%), Gaps = 8/115 (6%)

Query: 26  FMADSRMNKKGIAEFDNCLDS-EVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFF 83
                +         +   +  +VR         +Y+VLL++        V  VL +   
Sbjct: 90  RPGFDQSQFDATPSAEEGGEIGKVREKRGTGGGDMYKVLLLDHERHTESQVAAVLPKVVP 149

Query: 84  YKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
               E A+    +    G G   V   E AE         +R     L+  +E  
Sbjct: 150 SVTPEEARKCFHESRQTGAGLVTVTVKEHAEFY---AQMMARS---GLRSTIEPD 198


>gi|161347556|ref|YP_291789.2| ATP-dependent Clp protease adaptor [Prochlorococcus marinus str.
           NATL2A]
 gi|161407969|ref|YP_001015218.2| ATP-dependent Clp protease adaptor [Prochlorococcus marinus str.
           NATL1A]
          Length = 98

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 52  SKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF-YKDHETAKCIMLKVHHQGIGECGVYAY 110
           +K++ P+  R+++++DN+   E V + L         + +  + ++V  +G+ E     +
Sbjct: 17  TKIKYPEA-RIIVLDDNFNTFEHVANCLVTIIPGMSEKRSWELAVEVDREGLAEVWRGPF 75

Query: 111 EIAEMKVNQVMN 122
           E AE+   Q+++
Sbjct: 76  EQAELYHQQLIS 87


>gi|224419090|ref|ZP_03657096.1| hypothetical protein HcanM9_07438 [Helicobacter canadensis MIT
           98-5491]
          Length = 41

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/40 (47%), Positives = 28/40 (70%)

Query: 98  HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQ 137
           HH G G CG+Y Y+IAE K  QV   +++ Q+PL+ I+E+
Sbjct: 1   HHNGRGMCGIYPYDIAETKAMQVRKMAKEKQFPLRAILEK 40


>gi|157413367|ref|YP_001484233.1| ATP-dependent Clp protease adaptor [Prochlorococcus marinus str.
           MIT 9215]
 gi|157387942|gb|ABV50647.1| Hypothetical protein P9215_10321 [Prochlorococcus marinus str. MIT
           9215]
          Length = 95

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 34/82 (41%), Gaps = 1/82 (1%)

Query: 42  NCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVL-QNFFYKDHETAKCIMLKVHHQ 100
           N L + +            RV++++D++   ++V + L           A+ + +KV   
Sbjct: 3   NSLSTVLDQKKSKAKYPEARVIVLDDSFNTFQYVANCLLTIIPSMSERRARDLTIKVDKT 62

Query: 101 GIGECGVYAYEIAEMKVNQVMN 122
           G  E      E AE+   Q+++
Sbjct: 63  GSAEVWRGNLEQAELYHEQLLS 84


>gi|170114993|r