RPSBLAST alignment for GI: 254780164 and conserved domain: PRK13019

>gnl|CDD|183845 PRK13019, clpS, ATP-dependent Clp protease adaptor; Reviewed. Length = 94
 Score = 56.9 bits (138), Expect = 2e-09
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIH-VLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYE 111
           K+    LY+V+++ND++   E V++ +L+       + A  +M+  H +G     V   E
Sbjct: 15  KLERYPLYKVIVLNDDFNTFEHVVNCLLKAIPGMSEDRAWRLMITAHKEGSAVVWVGPLE 74

Query: 112 IAEMKVNQ 119
            AE+   Q
Sbjct: 75  QAELYHQQ 82