BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780164|ref|YP_003064577.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus Liberibacter asiaticus str. psy62] (138 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780164|ref|YP_003064577.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus Liberibacter asiaticus str. psy62] Length = 138 Score = 290 bits (741), Expect = 9e-81, Method: Compositional matrix adjust. Identities = 138/138 (100%), Positives = 138/138 (100%) Query: 1 MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLY 60 MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLY Sbjct: 1 MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLY 60 Query: 61 RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120 RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV Sbjct: 61 RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120 Query: 121 MNYSRQHQYPLQCIMEQK 138 MNYSRQHQYPLQCIMEQK Sbjct: 121 MNYSRQHQYPLQCIMEQK 138 >gi|254781037|ref|YP_003065450.1| porphobilinogen deaminase [Candidatus Liberibacter asiaticus str. psy62] Length = 307 Score = 21.9 bits (45), Expect = 4.8, Method: Compositional matrix adjust. Identities = 7/17 (41%), Positives = 11/17 (64%) Query: 1 MYLFDDGSMYHRVKRDG 17 + L DG ++H V R+G Sbjct: 264 IVLASDGKIFHEVSRNG 280 >gi|255764501|ref|YP_003064973.2| thiamine transporter membrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 535 Score = 21.6 bits (44), Expect = 5.3, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Query: 60 YRVLLVNDNYTPMEFVIHVLQNFFYKDHE--TAKCIMLKVHHQGIGECGVYAYEIAEMKV 117 Y +++V + + + + +L+N Y E A CI L++ +GI + ++ + + Sbjct: 406 YSLIIVTNALMAVPYAVKILENPMYDLAERYNALCISLQI--KGINRLYLIEFKALKRLM 463 Query: 118 NQVMNYS 124 Q ++S Sbjct: 464 AQTFSFS 470 >gi|254780503|ref|YP_003064916.1| putative glutamine synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 21.6 bits (44), Expect = 5.3, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 36 GIAEFDNCLDSEVRFSSK 53 GI EFD +D +FS K Sbjct: 187 GINEFDEIIDDIWKFSEK 204 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.327 0.139 0.421 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,009 Number of Sequences: 1233 Number of extensions: 2990 Number of successful extensions: 8 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 5 length of query: 138 length of database: 328,796 effective HSP length: 66 effective length of query: 72 effective length of database: 247,418 effective search space: 17814096 effective search space used: 17814096 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 34 (17.7 bits)