Query gi|254780165|ref|YP_003064578.1| hypothetical protein CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 71 No_of_seqs 97 out of 99 Neff 3.8 Searched_HMMs 39220 Date Sun May 22 21:03:13 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780165.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam11324 DUF3126 Protein of u 100.0 6E-30 1.5E-34 195.7 8.8 62 9-70 1-63 (63) 2 KOG4589 consensus 73.0 2.7 6.9E-05 23.7 2.3 36 6-41 186-221 (232) 3 TIGR02180 GRX_euk Glutaredoxin 65.2 6.3 0.00016 21.5 2.8 29 9-47 39-67 (85) 4 PRK08557 hypothetical protein; 62.6 16 0.00042 19.1 7.5 58 6-65 10-69 (420) 5 pfam10262 Rdx Rdx family. This 52.8 24 0.00062 18.1 4.8 38 9-46 16-54 (76) 6 PRK11188 rrmJ 23S rRNA methylt 47.1 19 0.00048 18.8 2.8 34 8-41 169-202 (209) 7 pfam00705 PCNA_N Proliferating 45.6 27 0.00069 17.9 3.4 45 26-70 77-124 (127) 8 TIGR00438 rrmJ ribosomal RNA l 42.3 20 0.00051 18.6 2.3 33 9-41 155-187 (192) 9 TIGR00365 TIGR00365 glutaredox 42.1 12 0.00031 19.9 1.2 10 38-47 73-82 (103) 10 PRK08474 F0F1 ATP synthase sub 34.0 49 0.0012 16.4 5.8 30 4-33 113-142 (176) 11 pfam07901 DUF1672 Protein of u 33.3 50 0.0013 16.3 3.7 36 7-42 62-98 (304) 12 PRK11032 hypothetical protein; 32.2 34 0.00088 17.3 2.2 19 4-22 42-60 (160) 13 COG0293 FtsJ 23S rRNA methylas 31.9 53 0.0013 16.2 3.3 34 9-42 164-197 (205) 14 pfam11525 CopK Copper resistan 31.9 28 0.00071 17.8 1.7 21 2-22 51-71 (73) 15 COG0278 Glutaredoxin-related p 29.3 28 0.00073 17.7 1.4 13 36-48 72-84 (105) 16 pfam07295 DUF1451 Protein of u 28.8 44 0.0011 16.7 2.2 20 4-23 32-51 (148) 17 PRK10824 hypothetical protein; 26.6 33 0.00084 17.4 1.3 11 38-48 73-83 (115) 18 KOG0911 consensus 26.3 30 0.00077 17.6 1.1 23 38-60 197-222 (227) 19 pfam08621 RPAP1_N RPAP1-like, 25.4 39 0.001 16.9 1.5 30 4-33 14-45 (49) 20 pfam05894 Podovirus_Gp16 Podov 23.3 76 0.0019 15.3 5.5 41 3-50 52-97 (333) 21 pfam03588 Leu_Phe_trans Leucyl 23.0 77 0.002 15.2 2.7 17 35-51 99-115 (173) 22 PRK03906 mannonate dehydratase 22.6 31 0.0008 17.5 0.6 10 58-68 100-109 (389) 23 pfam01728 FtsJ FtsJ-like methy 21.6 82 0.0021 15.1 2.7 31 11-41 141-171 (176) 24 TIGR03071 couple_hipA HipA N-t 20.5 86 0.0022 14.9 4.4 25 37-62 2-26 (101) No 1 >pfam11324 DUF3126 Protein of unknown function (DUF3126). This family of proteins with unknown function appear to be restricted to Alphaproteobacteria. Probab=99.96 E-value=6e-30 Score=195.66 Aligned_cols=62 Identities=50% Similarity=0.900 Sum_probs=60.4 Q ss_pred HHHHHHHHHHHHCCC-CEEEEECCCCCCCEEEEECCEEEEEEEEECCCCCEEEEEEEEEEECC Q ss_conf 999999999986199-63995079988727898889799999843467825789984544113 Q gi|254780165|r 9 EIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDD 70 (71) Q Consensus 9 Ei~klq~yLr~~F~~-~i~v~~r~~~~DSaEV~i~~EfiGvi~~D~eeGe~sY~f~MtILd~D 70 (71) ||+|||+|||++|+| .|+|++||+++||||||+|+|||||||+|+||||+||+||||||++| T Consensus 1 Ei~klq~yLr~~F~n~~i~v~~r~k~~DSaEV~~~~EFiGvi~~D~eeGe~sy~f~M~ILd~D 63 (63) T pfam11324 1 EIKKLQAYLKRKFGNPTLRVKARPKKGDSAEVYIGDEFIGVLFKDEDEGETSYSFEMAILDID 63 (63) T ss_pred CHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEECCEEEEEEEEECCCCCEEEEEEEEEECCC T ss_conf 958999999997199965997679999876998589899999873578838899988996369 No 2 >KOG4589 consensus Probab=73.00 E-value=2.7 Score=23.67 Aligned_cols=36 Identities=25% Similarity=0.337 Sum_probs=32.1 Q ss_pred CHHHHHHHHHHHHHHCCCCEEEEECCCCCCCEEEEE Q ss_conf 899999999999986199639950799887278988 Q gi|254780165|r 6 RADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLM 41 (71) Q Consensus 6 ~~~Ei~klq~yLr~~F~~~i~v~~r~~~~DSaEV~i 41 (71) +.+|-+++|+-|...|.|--+++|+...++|+|+|+ T Consensus 186 ~g~e~~~l~r~l~~~f~~Vk~vKP~Asr~eS~E~y~ 221 (232) T KOG4589 186 DGSEEALLQRRLQAVFTNVKKVKPDASRDESAETYL 221 (232) T ss_pred CCCCHHHHHHHHHHHHHHCEEECCCCCCCCCCCEEE T ss_conf 497328999999998632176277545554501165 No 3 >TIGR02180 GRX_euk Glutaredoxin; InterPro: IPR011899 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This entry is found in eukaryotic glutaredoxins and includes sequences from fungi, plants and metazoans as well as viruses .; GO: 0006118 electron transport, 0045454 cell redox homeostasis. Probab=65.20 E-value=6.3 Score=21.54 Aligned_cols=29 Identities=28% Similarity=0.599 Sum_probs=21.3 Q ss_pred HHHHHHHHHHHHCCCCEEEEECCCCCCCEEEEECCEEEE Q ss_conf 999999999986199639950799887278988897999 Q gi|254780165|r 9 EIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIG 47 (71) Q Consensus 9 Ei~klq~yLr~~F~~~i~v~~r~~~~DSaEV~i~~EfiG 47 (71) .-..||+||.+.=| .+..|| ||+++.||| T Consensus 39 ~g~~~Q~~L~~~TG--~~TVP~--------iFi~g~~iG 67 (85) T TIGR02180 39 NGSEIQDYLKEITG--QRTVPN--------IFINGKFIG 67 (85) T ss_pred CHHHHHHHHHHHCC--CCCCCC--------EEECCEEEC T ss_conf 85789999998448--923882--------656885767 No 4 >PRK08557 hypothetical protein; Provisional Probab=62.59 E-value=16 Score=19.13 Aligned_cols=58 Identities=19% Similarity=0.217 Sum_probs=48.9 Q ss_pred CHHHHHHHHHHHHHHCCC-C-EEEEECCCCCCCEEEEECCEEEEEEEEECCCCCEEEEEEEE Q ss_conf 899999999999986199-6-39950799887278988897999998434678257899845 Q gi|254780165|r 6 RADEIKKLERYLKRVFGS-G-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMS 65 (71) Q Consensus 6 ~~~Ei~klq~yLr~~F~~-~-i~v~~r~~~~DSaEV~i~~EfiGvi~~D~eeGe~sY~f~Mt 65 (71) .+.||.-|-.-+.+-||- . +.+.+-|-.|..-||.+++..+|.++=|..+ ..|.|..+ T Consensus 10 f~~di~~in~~~~~~fg~~~~vLLNK~pg~D~~~EVivdG~v~G~l~fd~~~--~~W~f~P~ 69 (420) T PRK08557 10 SKYEIKVLNKLTGKNFQEDDLILLEKLSGLDYRKRVYVSEDQIGTLEFDLLD--LTWKFIPS 69 (420) T ss_pred CHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCEEEEECCEEEEEEEECCCC--CEEEECCC T ss_conf 8778999999999774998489971789867550799888899999973556--55775464 No 5 >pfam10262 Rdx Rdx family. This entry is an approximately 100 residue region of selenoprotein-T, conserved from plants to humans. The protein binds to UDP-glucose:glycoprotein glucosyltransferase (UGTR), the endoplasmic reticulum (ER)-resident protein, which is known to be involved in the quality control of protein folding. Selenium (Se) plays an essential role in cell survival and most of the effects of Se are probably mediated by selenoproteins, including selenoprotein T. However, despite its binding to UGTR and that its mRNA is up-regulated in extended asphyxia, the function of the protein and hence of this region of it is unknown. Selenoprotein W contains selenium as selenocysteine in the primary protein structure and levels of this selenoprotein are affected by selenium. Probab=52.78 E-value=24 Score=18.15 Aligned_cols=38 Identities=26% Similarity=0.330 Sum_probs=30.6 Q ss_pred HHHHHHHHHHHHCCCC-EEEEECCCCCCCEEEEECCEEE Q ss_conf 9999999999861996-3995079988727898889799 Q gi|254780165|r 9 EIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFI 46 (71) Q Consensus 9 Ei~klq~yLr~~F~~~-i~v~~r~~~~DSaEV~i~~Efi 46 (71) -...++..|..+|.+. ..+...|....+-||+++++-| T Consensus 16 ra~~l~qeLl~~f~~~i~~v~l~p~~~G~FeV~v~~~li 54 (76) T pfam10262 16 RAAWLAQELLSTFPDDLIEVELQPGTGGAFEVTVNGELI 54 (76) T ss_pred HHHHHHHHHHHHCCCHHHEEEEEECCCCEEEEEECCEEE T ss_conf 999999999987764001588664799359999999998 No 6 >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Probab=47.13 E-value=19 Score=18.81 Aligned_cols=34 Identities=15% Similarity=0.240 Sum_probs=29.2 Q ss_pred HHHHHHHHHHHHHCCCCEEEEECCCCCCCEEEEE Q ss_conf 9999999999986199639950799887278988 Q gi|254780165|r 8 DEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLM 41 (71) Q Consensus 8 ~Ei~klq~yLr~~F~~~i~v~~r~~~~DSaEV~i 41 (71) .+...+...+++.|..-..++|......|.|+|+ T Consensus 169 ~~~~~~~~~~k~~F~~V~~~KP~ASR~~S~E~Yl 202 (209) T PRK11188 169 EGFDEYLREIRSLFTKVKVRKPDSSRARSREVYI 202 (209) T ss_pred CCHHHHHHHHHCCCCEEEEECCCCCCCCCCEEEE T ss_conf 7999999999702597889998674667854677 No 7 >pfam00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain. N-terminal and C-terminal domains of PCNA are topologically identical. Three PCNA molecules are tightly associated to form a closed ring encircling duplex DNA. Probab=45.55 E-value=27 Score=17.87 Aligned_cols=45 Identities=18% Similarity=0.427 Sum_probs=33.4 Q ss_pred EEEECCCCCCCEEEEECC--EEEEEEEEECCCC-CEEEEEEEEEEECC Q ss_conf 995079988727898889--7999998434678-25789984544113 Q gi|254780165|r 26 AVQSRENQSDSVEVLMNS--EFIGLVYRNDDEE-EISYHFDMSILEDD 70 (71) Q Consensus 26 ~v~~r~~~~DSaEV~i~~--EfiGvi~~D~eeG-e~sY~f~MtILd~D 70 (71) ++.++-+++|+......+ +.+++.+..++.. -..|.|+|..+|+| T Consensus 77 Kilk~~~~~d~l~l~~~d~~d~l~i~~e~~~~~~~~~~~~~L~LiDid 124 (127) T pfam00705 77 KILKCAGNEDIVTLKAEDNADTLALVFENENQDKVSIYDLEMKLMDLD 124 (127) T ss_pred HHHHHCCCCCEEEEEEECCCCEEEEEEECCCCCEEEEEEEEEECCCCC T ss_conf 999854799889999946988799999808987068788988512677 No 8 >TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2.1.1 from EC methylates the 23S rRNA. It specifically methylates the uridine in position 2552 of 23s rRNA in the 50S particle using S-adenosyl-L-methionine as a substrate. It was previously known as cell division protein ftsJ.; GO: 0016436 rRNA (uridine) methyltransferase activity, 0006364 rRNA processing. Probab=42.29 E-value=20 Score=18.65 Aligned_cols=33 Identities=21% Similarity=0.342 Sum_probs=20.6 Q ss_pred HHHHHHHHHHHHCCCCEEEEECCCCCCCEEEEE Q ss_conf 999999999986199639950799887278988 Q gi|254780165|r 9 EIKKLERYLKRVFGSGIAVQSRENQSDSVEVLM 41 (71) Q Consensus 9 Ei~klq~yLr~~F~~~i~v~~r~~~~DSaEV~i 41 (71) +|.+.=+=||+.|.--=.-+|..+-.-|||||+ T Consensus 155 ~~d~y~~e~r~~F~~~k~~kP~aSRk~SaEvYi 187 (192) T TIGR00438 155 EIDEYLNELRKLFEKVKVTKPQASRKRSAEVYI 187 (192) T ss_pred CHHHHHHHHHHCCCEEEEECCHHHHHCCCEEEE T ss_conf 288999976520547674478313205746899 No 9 >TIGR00365 TIGR00365 glutaredoxin homolog; InterPro: IPR004480 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This family groups a number of hypothetical proteins from different organisms which are related to glutaredoxin proteins.. Probab=42.06 E-value=12 Score=19.87 Aligned_cols=10 Identities=40% Similarity=0.986 Sum_probs=8.9 Q ss_pred EEEECCEEEE Q ss_conf 8988897999 Q gi|254780165|r 38 EVLMNSEFIG 47 (71) Q Consensus 38 EV~i~~EfiG 47 (71) -+|+++||+| T Consensus 73 QLyVnGEf~G 82 (103) T TIGR00365 73 QLYVNGEFVG 82 (103) T ss_pred CEEECCEEEC T ss_conf 3566553556 No 10 >PRK08474 F0F1 ATP synthase subunit delta; Validated Probab=33.99 E-value=49 Score=16.40 Aligned_cols=30 Identities=23% Similarity=0.510 Sum_probs=24.1 Q ss_pred EECHHHHHHHHHHHHHHCCCCEEEEECCCC Q ss_conf 458999999999999861996399507998 Q gi|254780165|r 4 RMRADEIKKLERYLKRVFGSGIAVQSRENQ 33 (71) Q Consensus 4 ~M~~~Ei~klq~yLr~~F~~~i~v~~r~~~ 33 (71) .++.+++.+|+..|.++||.++.+...+.. T Consensus 113 ~Ls~~q~~~i~~~L~kk~g~~v~l~~~~d~ 142 (176) T PRK08474 113 ELSQETLKKLEEKLSKKFNAKIKLKQKKSD 142 (176) T ss_pred CCCHHHHHHHHHHHHHHHCCEEEEEEEECC T ss_conf 999999999999999987891699962468 No 11 >pfam07901 DUF1672 Protein of unknown function (DUF1672). This family is composed of hypothetical bacterial proteins of unknown function. Probab=33.31 E-value=50 Score=16.33 Aligned_cols=36 Identities=25% Similarity=0.420 Sum_probs=29.7 Q ss_pred HHHHH-HHHHHHHHHCCCCEEEEECCCCCCCEEEEEC Q ss_conf 99999-9999999861996399507998872789888 Q gi|254780165|r 7 ADEIK-KLERYLKRVFGSGIAVQSRENQSDSVEVLMN 42 (71) Q Consensus 7 ~~Ei~-klq~yLr~~F~~~i~v~~r~~~~DSaEV~i~ 42 (71) +.||. +..+|++..|+.+.+|.---...|-|+||+. T Consensus 62 r~ei~k~~~qyfkd~y~~~VKv~NVVga~d~a~V~Ve 98 (304) T pfam07901 62 KDKIAKRGEQFFMDNFGLKVKATNVVGSGDGVEVYVH 98 (304) T ss_pred HHHHHHHHHHHHHHHCCCEEEEEEEECCCCCEEEEEE T ss_conf 9999999999998751730589778617981899998 No 12 >PRK11032 hypothetical protein; Provisional Probab=32.23 E-value=34 Score=17.26 Aligned_cols=19 Identities=21% Similarity=0.438 Sum_probs=16.7 Q ss_pred EECHHHHHHHHHHHHHHCC Q ss_conf 4589999999999998619 Q gi|254780165|r 4 RMRADEIKKLERYLKRVFG 22 (71) Q Consensus 4 ~M~~~Ei~klq~yLr~~F~ 22 (71) .|+++|+++|.+||||-+. T Consensus 42 eLT~eE~~li~~ylkRDl~ 60 (160) T PRK11032 42 ELTRDEVDLITRAVRRDLE 60 (160) T ss_pred HHCHHHHHHHHHHHHHHHH T ss_conf 7079999999999999999 No 13 >COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Probab=31.95 E-value=53 Score=16.20 Aligned_cols=34 Identities=18% Similarity=0.341 Sum_probs=26.5 Q ss_pred HHHHHHHHHHHHCCCCEEEEECCCCCCCEEEEEC Q ss_conf 9999999999861996399507998872789888 Q gi|254780165|r 9 EIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMN 42 (71) Q Consensus 9 Ei~klq~yLr~~F~~~i~v~~r~~~~DSaEV~i~ 42 (71) +...+-.++|+.|..--..++..+-..|+|+|+= T Consensus 164 ~~~~~l~~~~~~F~~v~~~KP~aSR~~S~E~y~v 197 (205) T COG0293 164 DFEDLLKALRRLFRKVKIFKPKASRKRSREIYLV 197 (205) T ss_pred CHHHHHHHHHHHHCEEEEECCCCCCCCCCEEEEE T ss_conf 8799999999863206773585546777148999 No 14 >pfam11525 CopK Copper resistance protein K. CopK is a periplasmic dimeric protein which is strongly up-regulated in the presence of copper, leading to a high periplasmic accumulation. CopK has two different binding sites for Cu(I), each with a different affinity for the metal. Binding of the first Cu(I) ion induces a conformational change of CopK which involves dissociation of the dimeric apo-protein. Binding of a second Cu(I) further increases the plasticity of the protein. CopK has features that are common with functionally related proteins such as a structure consisting of an all-beta fold and a methionine-rich Cu(I) binding site. Probab=31.88 E-value=28 Score=17.81 Aligned_cols=21 Identities=29% Similarity=0.662 Sum_probs=17.5 Q ss_pred CEEECHHHHHHHHHHHHHHCC Q ss_conf 204589999999999998619 Q gi|254780165|r 2 EVRMRADEIKKLERYLKRVFG 22 (71) Q Consensus 2 ~i~M~~~Ei~klq~yLr~~F~ 22 (71) .|.|+-+|+.||..+||+-.. T Consensus 51 kI~m~gdEVaRL~~~l~k~h~ 71 (73) T pfam11525 51 KIMMHGDEVARLDNYLRKGHE 71 (73) T ss_pred EEEECCHHHHHHHHHHHCCCC T ss_conf 788615077768899861026 No 15 >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Probab=29.31 E-value=28 Score=17.74 Aligned_cols=13 Identities=31% Similarity=0.529 Sum_probs=10.1 Q ss_pred CEEEEECCEEEEE Q ss_conf 2789888979999 Q gi|254780165|r 36 SVEVLMNSEFIGL 48 (71) Q Consensus 36 SaEV~i~~EfiGv 48 (71) ---+|+++||||= T Consensus 72 ~PQLyi~GEfvGG 84 (105) T COG0278 72 FPQLYVNGEFVGG 84 (105) T ss_pred CCEEEECCEEECC T ss_conf 6414587787640 No 16 >pfam07295 DUF1451 Protein of unknown function (DUF1451). This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown. Probab=28.76 E-value=44 Score=16.66 Aligned_cols=20 Identities=25% Similarity=0.478 Sum_probs=16.9 Q ss_pred EECHHHHHHHHHHHHHHCCC Q ss_conf 45899999999999986199 Q gi|254780165|r 4 RMRADEIKKLERYLKRVFGS 23 (71) Q Consensus 4 ~M~~~Ei~klq~yLr~~F~~ 23 (71) .|+.+|++.+.+||||-+.. T Consensus 32 elT~eE~~lv~~ylkRDl~e 51 (148) T pfam07295 32 ELTREELALIGAYLKRDLEE 51 (148) T ss_pred HCCHHHHHHHHHHHHHHHHH T ss_conf 65899999999999999999 No 17 >PRK10824 hypothetical protein; Provisional Probab=26.63 E-value=33 Score=17.38 Aligned_cols=11 Identities=18% Similarity=0.543 Sum_probs=9.3 Q ss_pred EEEECCEEEEE Q ss_conf 89888979999 Q gi|254780165|r 38 EVLMNSEFIGL 48 (71) Q Consensus 38 EV~i~~EfiGv 48 (71) -+|+++||||= T Consensus 73 Qlyi~Ge~IGG 83 (115) T PRK10824 73 QLWVDGELVGG 83 (115) T ss_pred CEEECCEEECC T ss_conf 11188976640 No 18 >KOG0911 consensus Probab=26.29 E-value=30 Score=17.59 Aligned_cols=23 Identities=26% Similarity=0.547 Sum_probs=13.7 Q ss_pred EEEECCEEEEE---EEEECCCCCEEE Q ss_conf 89888979999---984346782578 Q gi|254780165|r 38 EVLMNSEFIGL---VYRNDDEEEISY 60 (71) Q Consensus 38 EV~i~~EfiGv---i~~D~eeGe~sY 60 (71) -+|+++||+|= +-.=-+.||..| T Consensus 197 QlyI~GEFiGGlDIl~~m~~~geL~~ 222 (227) T KOG0911 197 QLYVKGEFIGGLDILKEMHEKGELVY 222 (227) T ss_pred CEEECCEECCCCHHHHHHHHCCCHHH T ss_conf 03587775067389999865654888 No 19 >pfam08621 RPAP1_N RPAP1-like, N-terminal. Inhibition of RPAP1 synthesis in Saccharomyces cerevisiae results in changes in global gene expression that are similar to those caused by the loss of the RNAPII subunit Rpb11. This entry represents the N-terminal region of RPAP-1 that is conserved from yeast to humans. Probab=25.41 E-value=39 Score=16.95 Aligned_cols=30 Identities=17% Similarity=0.271 Sum_probs=22.8 Q ss_pred EECHHHHHHHHHHHHHHCCCC-E-EEEECCCC Q ss_conf 458999999999999861996-3-99507998 Q gi|254780165|r 4 RMRADEIKKLERYLKRVFGSG-I-AVQSRENQ 33 (71) Q Consensus 4 ~M~~~Ei~klq~yLr~~F~~~-i-~v~~r~~~ 33 (71) .|++.||..-|..|...|+++ + .+++|..+ T Consensus 14 ~MS~eeI~~e~~eL~~~ldP~ll~~L~~R~~~ 45 (49) T pfam08621 14 SMSPEEIEQEQEELLESLDPKLLEFLLKRAQK 45 (49) T ss_pred CCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHC T ss_conf 29999999999999983999999999986302 No 20 >pfam05894 Podovirus_Gp16 Podovirus DNA encapsidation protein (Gp16). This family consists of several DNA encapsidation protein (Gp16) sequences from the phi-29-like viruses. Gene product 16 catalyses the in vivo and in vitro genome-encapsidation reaction. Probab=23.27 E-value=76 Score=15.27 Aligned_cols=41 Identities=27% Similarity=0.478 Sum_probs=31.7 Q ss_pred EEECHHHHHHHHH-HHHHH---CCC-CEEEEECCCCCCCEEEEECCEEEEEEE Q ss_conf 0458999999999-99986---199-639950799887278988897999998 Q gi|254780165|r 3 VRMRADEIKKLER-YLKRV---FGS-GIAVQSRENQSDSVEVLMNSEFIGLVY 50 (71) Q Consensus 3 i~M~~~Ei~klq~-yLr~~---F~~-~i~v~~r~~~~DSaEV~i~~EfiGvi~ 50 (71) .++..+|++|+.+ |.... |.| ++.|++ --+|+++|.||-.- T Consensus 52 LRr~k~El~k~~n~~F~di~~~fpn~ef~Vkg-------nki~~~~k~igy~i 97 (333) T pfam05894 52 LRRYKTELKKLANEFFNDVAHEFPNNEFYVKG-------NKFYIKGELIGYAI 97 (333) T ss_pred EEECCHHHHHHHHHHHHHHHHHCCCCEEEEEC-------CEEEECCEEEEEEE T ss_conf 99120688877777555166537898079975-------48998782899998 No 21 >pfam03588 Leu_Phe_trans Leucyl/phenylalanyl-tRNA protein transferase. Probab=22.98 E-value=77 Score=15.24 Aligned_cols=17 Identities=41% Similarity=0.634 Sum_probs=14.9 Q ss_pred CCEEEEECCEEEEEEEE Q ss_conf 72789888979999984 Q gi|254780165|r 35 DSVEVLMNSEFIGLVYR 51 (71) Q Consensus 35 DSaEV~i~~EfiGvi~~ 51 (71) -|+||+.++|-+|=+|- T Consensus 99 HSVEvw~~~~LvGGlYG 115 (173) T pfam03588 99 HSVEVWRGDELVGGIYG 115 (173) T ss_pred EEEEEEECCEEEEEEEE T ss_conf 99999989999872007 No 22 >PRK03906 mannonate dehydratase; Provisional Probab=22.65 E-value=31 Score=17.51 Aligned_cols=10 Identities=30% Similarity=1.055 Sum_probs=4.0 Q ss_pred EEEEEEEEEEE Q ss_conf 57899845441 Q gi|254780165|r 58 ISYHFDMSILE 68 (71) Q Consensus 58 ~sY~f~MtILd 68 (71) +||+| |++|| T Consensus 100 iCYNF-MPv~D 109 (389) T PRK03906 100 VCYNF-MPVFD 109 (389) T ss_pred EEEEC-CCCCC T ss_conf 96503-66465 No 23 >pfam01728 FtsJ FtsJ-like methyltransferase. This family consists of FtsJ from various bacterial and archaeal sources FtsJ is a methyltransferase, but actually has no effect on cell division. FtsJ's substrate is the 23S rRNA. The 1.5 A crystal structure of FtsJ in complex with its cofactor S-adenosylmethionine revealed that FtsJ has a methyltransferase fold. This family also includes the N terminus of flaviviral NS5 protein. It has been hypothesized that the N-terminal domain of NS5 is a methyltransferase involved in viral RNA capping. Probab=21.62 E-value=82 Score=15.08 Aligned_cols=31 Identities=19% Similarity=0.123 Sum_probs=24.6 Q ss_pred HHHHHHHHHHCCCCEEEEECCCCCCCEEEEE Q ss_conf 9999999986199639950799887278988 Q gi|254780165|r 11 KKLERYLKRVFGSGIAVQSRENQSDSVEVLM 41 (71) Q Consensus 11 ~klq~yLr~~F~~~i~v~~r~~~~DSaEV~i 41 (71) ..+...|++.|..-...+|.....+|.|.|+ T Consensus 141 ~~l~~~l~~~F~~v~~~KP~aSR~~s~E~Yi 171 (176) T pfam01728 141 VELLYKLKKGFEKVGIFKPPASRPSSSEEYL 171 (176) T ss_pred HHHHHHHHHCCCEEEEECCCCCCCCCCEEEE T ss_conf 9999999831788999868997998866999 No 24 >TIGR03071 couple_hipA HipA N-terminal domain. Although Pfam models pfam07805 and pfam07804 currently are called HipA-like N-terminal domain and HipA-like C-terminal domain, respectively, those models hit the central and C-terminal regions of E. coli HipA but not the N-terminal region. This model hits the N-terminal region of HipA and its homologs, and also identifies proteins that lack match regions for pfam07804 and pfam07805. Probab=20.54 E-value=86 Score=14.95 Aligned_cols=25 Identities=20% Similarity=0.477 Sum_probs=18.8 Q ss_pred EEEEECCEEEEEEEEECCCCCEEEEE Q ss_conf 78988897999998434678257899 Q gi|254780165|r 37 VEVLMNSEFIGLVYRNDDEEEISYHF 62 (71) Q Consensus 37 aEV~i~~EfiGvi~~D~eeGe~sY~f 62 (71) -.||+++..+|++.++. .|..+|.+ T Consensus 2 L~V~~~g~~vG~L~~~~-~g~~~F~Y 26 (101) T TIGR03071 2 LVVWLNGERAGILTEDE-GGKYSFRY 26 (101) T ss_pred EEEEECCEEEEEEEECC-CCCEEEEE T ss_conf 49999999999999838-99189998 Done!