BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780165|ref|YP_003064578.1| hypothetical protein CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|254780165|ref|YP_003064578.1| hypothetical protein CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62] gi|254039842|gb|ACT56638.1| hypothetical protein CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 141 bits (356), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY Sbjct: 1 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 Query: 61 HFDMSILEDDL 71 HFDMSILEDDL Sbjct: 61 HFDMSILEDDL 71 >gi|315122669|ref|YP_004063158.1| hypothetical protein CKC_04605 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496071|gb|ADR52670.1| hypothetical protein CKC_04605 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 67 Score = 109 bits (272), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 52/67 (77%), Positives = 59/67 (88%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M DEIKK+ YLK++FGSGI+VQ R NQSDSVEVLMNSEFIGL+YRN+DE EISYHF M Sbjct: 1 MSPDEIKKISAYLKKMFGSGISVQLRANQSDSVEVLMNSEFIGLIYRNNDEGEISYHFAM 60 Query: 65 SILEDDL 71 SILE+DL Sbjct: 61 SILEEDL 67 >gi|240850645|ref|YP_002972045.1| hypothetical protein Bgr_10980 [Bartonella grahamii as4aup] gi|240267768|gb|ACS51356.1| hypothetical protein Bgr_10980 [Bartonella grahamii as4aup] Length = 70 Score = 77.4 bits (189), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 37/68 (54%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M ADEIKKL+ YLK +F S + V++R +SDS EV M EF+G++YR++DE+E+SY+F Sbjct: 1 MNADEIKKLDNYLKNIFQNSALQVRARPKKSDSCEVYMGDEFLGIIYRDEDEDELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDIDL 68 >gi|222148873|ref|YP_002549830.1| hypothetical protein Avi_2541 [Agrobacterium vitis S4] gi|221735859|gb|ACM36822.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 111 Score = 75.5 bits (184), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 33/71 (46%), Positives = 54/71 (76%) Query: 1 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 ME+ ++ADEIKKL+ Y KR F +AV++R + DS EV + EF+G+V+++D++ ++SY Sbjct: 41 MEIFVKADEIKKLDAYFKRTFNPTMAVKARPRKDDSAEVYVGEEFLGVVFKDDEDGDLSY 100 Query: 61 HFDMSILEDDL 71 +F M+IL+ DL Sbjct: 101 NFSMAILDVDL 111 >gi|153009257|ref|YP_001370472.1| hypothetical protein Oant_1927 [Ochrobactrum anthropi ATCC 49188] gi|151561145|gb|ABS14643.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188] Length = 68 Score = 73.2 bits (178), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 33/68 (48%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ +E+KKL+ Y KR F G+ V++R ++DS E+ +N EF+GLVY+++DE E+SY+F Sbjct: 1 MKPEELKKLDAYFKRTFNNPGLQVKARPRKNDSAELYLNDEFLGLVYKDEDEGELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDVDL 68 >gi|163868310|ref|YP_001609519.1| hypothetical protein Btr_1152 [Bartonella tribocorum CIP 105476] gi|161017966|emb|CAK01524.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 87 Score = 72.8 bits (177), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 35/68 (51%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 + ADEIKKL+ YLK F S + V++R + DS EV M EF+G++YR++DE+E+SY+F Sbjct: 18 VNADEIKKLDNYLKNTFQNSALQVRARPKKDDSCEVYMGDEFLGVIYRDEDEDELSYNFS 77 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 78 MAILDIDL 85 >gi|121602164|ref|YP_989119.1| hypothetical protein BARBAKC583_0831 [Bartonella bacilliformis KC583] gi|120614341|gb|ABM44942.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 70 Score = 72.4 bits (176), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 34/68 (50%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M ADEIKKL+ Y K +F S + V++R + DS EV + EF+G++YR++DE+E+SY+F Sbjct: 1 MNADEIKKLDNYFKTIFQNSALQVKARPKKDDSCEVYIRDEFLGIIYRDEDEDELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDVDL 68 >gi|312113810|ref|YP_004011406.1| hypothetical protein Rvan_1033 [Rhodomicrobium vannielii ATCC 17100] gi|311218939|gb|ADP70307.1| hypothetical protein Rvan_1033 [Rhodomicrobium vannielii ATCC 17100] Length = 70 Score = 72.0 bits (175), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E K LE+YL++ F I V+ R+ + DSVEV + EF+G++Y++D++ E+SY F Sbjct: 1 MTPAETKALEKYLRKTFSLEAIEVKKRQKKQDSVEVFVKEEFVGVIYKDDEDNEVSYQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|319408551|emb|CBI82204.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 70 Score = 71.6 bits (174), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 33/68 (48%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M ADEI+KL+ Y K+ F S + V++R + DS EV + EF+G++YR++DE+E+SY+F Sbjct: 1 MNADEIRKLDSYFKKTFQNSALQVKARPKKDDSCEVYIGDEFLGIIYRDEDEDELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDIDL 68 >gi|49474230|ref|YP_032272.1| hypothetical protein BQ06250 [Bartonella quintana str. Toulouse] gi|49239734|emb|CAF26116.1| hypothetical protein BQ06250 [Bartonella quintana str. Toulouse] Length = 112 Score = 71.6 bits (174), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 35/68 (51%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 + ADEIKKL+ YLK F S + V++R +SDS EV + EF+G++YR++DE+E+SY F Sbjct: 43 VNADEIKKLDSYLKNTFQNSALQVRARTKKSDSCEVYIGDEFLGVIYRDEDEDELSYSFS 102 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 103 MAILDIDL 110 >gi|163760305|ref|ZP_02167388.1| hypothetical protein HPDFL43_08584 [Hoeflea phototrophica DFL-43] gi|162282704|gb|EDQ32992.1| hypothetical protein HPDFL43_08584 [Hoeflea phototrophica DFL-43] Length = 69 Score = 69.7 bits (169), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 31/67 (46%), Positives = 49/67 (73%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+A EI KLE Y KR+F + +++R + DS EV + EFIG+V+R+D++ ++SY+F M Sbjct: 1 MKAAEIIKLEAYFKRIFNDNLVIKARPAKDDSAEVYLGDEFIGIVFRDDEDGDLSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDVDL 67 >gi|239832148|ref|ZP_04680477.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] gi|239824415|gb|EEQ95983.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 68 Score = 69.7 bits (169), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 31/68 (45%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ +E+KKL+ Y KR F G+ V++R ++DS E+ + EF+GL+Y+++DE E+SY+F Sbjct: 1 MKPEELKKLDAYFKRTFNNPGLQVKARPRKNDSAELYLEDEFLGLIYKDEDEGELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDVDL 68 >gi|17987018|ref|NP_539652.1| hypothetical protein BMEI0735 [Brucella melitensis bv. 1 str. 16M] gi|23502137|ref|NP_698264.1| hypothetical protein BR1261 [Brucella suis 1330] gi|62290170|ref|YP_221963.1| hypothetical protein BruAb1_1264 [Brucella abortus bv. 1 str. 9-941] gi|82700092|ref|YP_414666.1| hypothetical protein BAB1_1280 [Brucella melitensis biovar Abortus 2308] gi|148559204|ref|YP_001259177.1| hypothetical protein BOV_1223 [Brucella ovis ATCC 25840] gi|161619213|ref|YP_001593100.1| hypothetical protein BCAN_A1283 [Brucella canis ATCC 23365] gi|163843523|ref|YP_001627927.1| hypothetical protein BSUIS_A1309 [Brucella suis ATCC 23445] gi|225627728|ref|ZP_03785765.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225852757|ref|YP_002732990.1| hypothetical protein BMEA_A1309 [Brucella melitensis ATCC 23457] gi|237815677|ref|ZP_04594674.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|256369682|ref|YP_003107192.1| hypothetical protein BMI_I1272 [Brucella microti CCM 4915] gi|260884007|ref|ZP_05895621.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|261222415|ref|ZP_05936696.1| conserved hypothetical protein [Brucella ceti B1/94] gi|265991331|ref|ZP_06103888.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] gi|265995168|ref|ZP_06107725.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|265998382|ref|ZP_06110939.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|294852596|ref|ZP_06793269.1| hypothetical protein BAZG_01524 [Brucella sp. NVSL 07-0026] gi|297248563|ref|ZP_06932281.1| hypothetical protein BAYG_01521 [Brucella abortus bv. 5 str. B3196] gi|17982671|gb|AAL51916.1| hypothetical protein BMEI0735 [Brucella melitensis bv. 1 str. 16M] gi|23348099|gb|AAN30179.1| conserved hypothetical protein [Brucella suis 1330] gi|62196302|gb|AAX74602.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|82616193|emb|CAJ11236.1| conserved hypothetical protein [Brucella melitensis biovar Abortus 2308] gi|148370461|gb|ABQ60440.1| conserved hypothetical protein [Brucella ovis ATCC 25840] gi|161336024|gb|ABX62329.1| Hypothetical protein BCAN_A1283 [Brucella canis ATCC 23365] gi|163674246|gb|ABY38357.1| Hypothetical protein BSUIS_A1309 [Brucella suis ATCC 23445] gi|225617733|gb|EEH14778.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225641122|gb|ACO01036.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457] gi|237788975|gb|EEP63186.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|255999844|gb|ACU48243.1| hypothetical protein BMI_I1272 [Brucella microti CCM 4915] gi|260873535|gb|EEX80604.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|260920999|gb|EEX87652.1| conserved hypothetical protein [Brucella ceti B1/94] gi|262552850|gb|EEZ08840.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|262766281|gb|EEZ12070.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|263002115|gb|EEZ14690.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] gi|294821185|gb|EFG38184.1| hypothetical protein BAZG_01524 [Brucella sp. NVSL 07-0026] gi|297175732|gb|EFH35079.1| hypothetical protein BAYG_01521 [Brucella abortus bv. 5 str. B3196] Length = 84 Score = 68.9 bits (167), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 30/70 (42%), Positives = 53/70 (75%), Gaps = 1/70 (1%) Query: 3 VRMRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYH 61 +R++ +E+KKL+ Y KR F + + V++R ++DS E+ + EF+GL+Y+++DE E+SY+ Sbjct: 15 IRLKPEELKKLDAYFKRTFNNPDLQVKARPRKNDSAELYLADEFLGLIYKDEDEGELSYN 74 Query: 62 FDMSILEDDL 71 F M+IL+ DL Sbjct: 75 FSMAILDVDL 84 >gi|150396333|ref|YP_001326800.1| hypothetical protein Smed_1114 [Sinorhizobium medicae WSM419] gi|307309260|ref|ZP_07588928.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C] gi|307317002|ref|ZP_07596443.1| conserved hypothetical protein [Sinorhizobium meliloti AK83] gi|150027848|gb|ABR59965.1| conserved hypothetical protein [Sinorhizobium medicae WSM419] gi|306897090|gb|EFN27835.1| conserved hypothetical protein [Sinorhizobium meliloti AK83] gi|306900261|gb|EFN30878.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C] Length = 67 Score = 68.6 bits (166), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 50/67 (74%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ +EI+KLE YLKR F + V++R + +S EV + EF+G+V+R++++ E+SY+F M Sbjct: 1 MKPEEIRKLEAYLKRTFNQSMVVKARPKKDESAEVYLGDEFLGVVFRDEEDGELSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDIDL 67 >gi|49475598|ref|YP_033639.1| hypothetical protein BH08330 [Bartonella henselae str. Houston-1] gi|49238405|emb|CAF27632.1| hypothetical protein BH08330 [Bartonella henselae str. Houston-1] Length = 80 Score = 68.6 bits (166), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 33/68 (48%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 + ADEIKKL+ YLK F S + V++R + DS EV + EF+G++YR+++E E+SY+F Sbjct: 11 VNADEIKKLDNYLKNTFQNSALQVRARPKKGDSCEVYIGDEFLGVIYRDEEENELSYNFS 70 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 71 MAILDIDL 78 >gi|328543249|ref|YP_004303358.1| hypothetical protein SL003B_1630 [Polymorphum gilvum SL003B-26A1] gi|326412995|gb|ADZ70058.1| Hypothetical conserved protein [Polymorphum gilvum SL003B-26A1] Length = 72 Score = 67.8 bits (164), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 33/68 (48%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ADEI K+E YL+R F I +++R + DS EV + EFIG+V+R+D++E++S++F Sbjct: 1 MKADEIGKIEAYLRRKFSLPTIKLRARPRKDDSAEVYIGDEFIGVVFRDDEDEDLSWNFQ 60 Query: 64 MSILEDDL 71 M+ILE DL Sbjct: 61 MAILEIDL 68 >gi|222085847|ref|YP_002544378.1| hypothetical protein Arad_2208 [Agrobacterium radiobacter K84] gi|221723295|gb|ACM26451.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 67 Score = 67.4 bits (163), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 31/67 (46%), Positives = 48/67 (71%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ DEIKKL+ Y KR F + V++R ++DS EV + EF+G+VY +D++ + SY+F M Sbjct: 1 MKPDEIKKLDAYFKRTFNPQMVVKARPRKNDSAEVYLGEEFLGVVYIDDEDGDRSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDMDL 67 >gi|195970174|ref|NP_385590.2| hypothetical protein SMc02112 [Sinorhizobium meliloti 1021] gi|187904173|emb|CAC46063.2| Hypothetical unknown protein [Sinorhizobium meliloti 1021] Length = 81 Score = 67.4 bits (163), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 29/67 (43%), Positives = 50/67 (74%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 ++ +EI+KLE YLKR F + V++R + +S EV + EF+G+V+R++++ E+SY+F M Sbjct: 15 LKPEEIRKLEAYLKRTFNQSMVVKARPKKDESAEVYLGDEFLGVVFRDEEDGELSYNFSM 74 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 75 AILDIDL 81 >gi|118593890|ref|ZP_01551248.1| hypothetical protein SIAM614_16652 [Stappia aggregata IAM 12614] gi|118433511|gb|EAV40180.1| hypothetical protein SIAM614_16652 [Stappia aggregata IAM 12614] Length = 71 Score = 67.4 bits (163), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ DEI+K+E YL+ F I VQ+R + DS EV + EFIG+++R+D++E++S++F Sbjct: 1 MKPDEIRKIEAYLRSKFENKTIKVQARPRKDDSAEVYIGDEFIGVIFRDDEDEDLSWNFQ 60 Query: 64 MSILEDDL 71 M+ILE DL Sbjct: 61 MAILEIDL 68 >gi|189024404|ref|YP_001935172.1| hypothetical protein BAbS19_I11930 [Brucella abortus S19] gi|254689473|ref|ZP_05152727.1| hypothetical protein Babob68_04719 [Brucella abortus bv. 6 str. 870] gi|254693959|ref|ZP_05155787.1| hypothetical protein Babob3T_04714 [Brucella abortus bv. 3 str. Tulya] gi|254697611|ref|ZP_05159439.1| hypothetical protein Babob28_07848 [Brucella abortus bv. 2 str. 86/8/59] gi|254701997|ref|ZP_05163825.1| hypothetical protein Bsuib55_14224 [Brucella suis bv. 5 str. 513] gi|254704538|ref|ZP_05166366.1| hypothetical protein Bsuib36_11532 [Brucella suis bv. 3 str. 686] gi|254706566|ref|ZP_05168394.1| hypothetical protein BpinM_06178 [Brucella pinnipedialis M163/99/10] gi|254719312|ref|ZP_05181123.1| hypothetical protein Bru83_07183 [Brucella sp. 83/13] gi|254730502|ref|ZP_05189080.1| hypothetical protein Babob42_04724 [Brucella abortus bv. 4 str. 292] gi|256044903|ref|ZP_05447807.1| hypothetical protein Bmelb1R_10451 [Brucella melitensis bv. 1 str. Rev.1] gi|256061339|ref|ZP_05451483.1| hypothetical protein Bneo5_13335 [Brucella neotomae 5K33] gi|256113818|ref|ZP_05454611.1| hypothetical protein Bmelb3E_13645 [Brucella melitensis bv. 3 str. Ether] gi|256257720|ref|ZP_05463256.1| hypothetical protein Babob9C_10306 [Brucella abortus bv. 9 str. C68] gi|256263759|ref|ZP_05466291.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|260546713|ref|ZP_05822452.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260565495|ref|ZP_05835979.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260566218|ref|ZP_05836688.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260754997|ref|ZP_05867345.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260758213|ref|ZP_05870561.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260762040|ref|ZP_05874383.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|261214251|ref|ZP_05928532.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|261219771|ref|ZP_05934052.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261314024|ref|ZP_05953221.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261317889|ref|ZP_05957086.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261322098|ref|ZP_05961295.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261325340|ref|ZP_05964537.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261752564|ref|ZP_05996273.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261755222|ref|ZP_05998931.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|261758445|ref|ZP_06002154.1| conserved hypothetical protein [Brucella sp. F5/99] gi|265984313|ref|ZP_06097048.1| conserved hypothetical protein [Brucella sp. 83/13] gi|265988917|ref|ZP_06101474.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] gi|306839085|ref|ZP_07471902.1| Hypothetical protein BROD_1925 [Brucella sp. NF 2653] gi|306840274|ref|ZP_07473048.1| Hypothetical protein BIBO2_0073 [Brucella sp. BO2] gi|306844164|ref|ZP_07476757.1| Hypothetical protein BIBO1_0831 [Brucella sp. BO1] gi|189019976|gb|ACD72698.1| hypothetical protein BAbS19_I11930 [Brucella abortus S19] gi|260095763|gb|EEW79640.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260151563|gb|EEW86657.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260155736|gb|EEW90816.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260668531|gb|EEX55471.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260672472|gb|EEX59293.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|260675105|gb|EEX61926.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260915858|gb|EEX82719.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|260924860|gb|EEX91428.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261294788|gb|EEX98284.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261297112|gb|EEY00609.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261301320|gb|EEY04817.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261303050|gb|EEY06547.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261738429|gb|EEY26425.1| conserved hypothetical protein [Brucella sp. F5/99] gi|261742317|gb|EEY30243.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261744975|gb|EEY32901.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|263093816|gb|EEZ17821.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|264661114|gb|EEZ31375.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] gi|264662905|gb|EEZ33166.1| conserved hypothetical protein [Brucella sp. 83/13] gi|306275439|gb|EFM57176.1| Hypothetical protein BIBO1_0831 [Brucella sp. BO1] gi|306289801|gb|EFM60983.1| Hypothetical protein BIBO2_0073 [Brucella sp. BO2] gi|306405632|gb|EFM61894.1| Hypothetical protein BROD_1925 [Brucella sp. NF 2653] gi|326409282|gb|ADZ66347.1| conserved hypothetical protein [Brucella melitensis M28] gi|326538992|gb|ADZ87207.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 68 Score = 67.0 bits (162), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ +E+KKL+ Y KR F + + V++R ++DS E+ + EF+GL+Y+++DE E+SY+F Sbjct: 1 MKPEELKKLDAYFKRTFNNPDLQVKARPRKNDSAELYLADEFLGLIYKDEDEGELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDVDL 68 >gi|86357525|ref|YP_469417.1| hypothetical protein RHE_CH01904 [Rhizobium etli CFN 42] gi|86281627|gb|ABC90690.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 67 Score = 66.6 bits (161), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 31/67 (46%), Positives = 49/67 (73%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ +EIKKL+ Y KR+F I V++R ++DS EV + EF+G+VY +D++ + SY+F M Sbjct: 1 MKPEEIKKLDAYFKRMFNPQIIVKARPRKNDSAEVYLGEEFLGVVYVDDEDGDRSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDVDL 67 >gi|39936491|ref|NP_948767.1| hypothetical protein RPA3428 [Rhodopseudomonas palustris CGA009] gi|39650347|emb|CAE28869.1| conserved unknown protein [Rhodopseudomonas palustris CGA009] Length = 76 Score = 66.6 bits (161), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 33/72 (45%), Positives = 51/72 (70%), Gaps = 1/72 (1%) Query: 1 MEVRMRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEIS 59 ME+ + E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S Sbjct: 1 MEITVDVQEVRKLDAYLKRVFGNPKIRVVPRPKKEDSAEVYIGEEFIGVLFVDDEDDDRS 60 Query: 60 YHFDMSILEDDL 71 + F M+ILEDDL Sbjct: 61 FQFQMAILEDDL 72 >gi|307945513|ref|ZP_07660849.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] gi|307771386|gb|EFO30611.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] Length = 72 Score = 66.6 bits (161), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M +EIKKLE YLK+ F + V++R + DS EV + EFIG++YR+D+++++S++F Sbjct: 1 MNPEEIKKLEAYLKKKFDLQALQVRARPKKDDSAEVYIGDEFIGVIYRDDEDDDLSWNFQ 60 Query: 64 MSILEDDL 71 M+ILE DL Sbjct: 61 MAILEFDL 68 >gi|190891594|ref|YP_001978136.1| hypothetical protein RHECIAT_CH0001997 [Rhizobium etli CIAT 652] gi|218515709|ref|ZP_03512549.1| hypothetical protein Retl8_19454 [Rhizobium etli 8C-3] gi|190696873|gb|ACE90958.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 67 Score = 66.2 bits (160), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 31/67 (46%), Positives = 49/67 (73%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ +EIKKL+ Y KR+F I V++R ++DS EV + EF+G+VY +D++ + SY+F M Sbjct: 1 MKPEEIKKLDAYFKRMFNPQIIVKARPRKNDSAEVYLGEEFLGVVYIDDEDGDRSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDVDL 67 >gi|15888888|ref|NP_354569.1| hypothetical protein Atu1570 [Agrobacterium tumefaciens str. C58] gi|15156658|gb|AAK87354.1| hypothetical protein Atu1570 [Agrobacterium tumefaciens str. C58] Length = 105 Score = 65.9 bits (159), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 31/67 (46%), Positives = 48/67 (71%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 ++ADEIKKL+ Y KR F + V++R + DS EV + EF+G+VY +D++ + SY+F M Sbjct: 39 VKADEIKKLDAYFKRTFNEKMIVKARPRKDDSAEVYLGEEFLGVVYIDDEDGDRSYNFSM 98 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 99 AILDVDL 105 >gi|325292964|ref|YP_004278828.1| hypothetical protein AGROH133_06358 [Agrobacterium sp. H13-3] gi|325060817|gb|ADY64508.1| hypothetical protein AGROH133_06358 [Agrobacterium sp. H13-3] Length = 68 Score = 65.9 bits (159), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 31/67 (46%), Positives = 48/67 (71%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 ++ADEIKKL+ Y KR F + V++R + DS EV + EF+G+VY +D++ + SY+F M Sbjct: 2 VKADEIKKLDAYFKRTFNEKMVVKARPRKDDSAEVYLGEEFLGVVYIDDEDGDRSYNFSM 61 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 62 AILDVDL 68 >gi|319898912|ref|YP_004159005.1| hypothetical protein BARCL_0746 [Bartonella clarridgeiae 73] gi|319402876|emb|CBI76427.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 70 Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M DEIKKL+ Y K F S + +++R + DS EV + EF+G++YR+++E EISY+F Sbjct: 1 MNVDEIKKLDSYFKTKFQNSSLKIKARPKKDDSCEVYIGDEFLGIIYRDEEEGEISYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDIDL 68 >gi|209965113|ref|YP_002298028.1| hypothetical protein RC1_1819 [Rhodospirillum centenum SW] gi|209958579|gb|ACI99215.1| conserved domain protein [Rhodospirillum centenum SW] Length = 77 Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M +EI +L+ YL++ FG+ + V + + VEV++ EFIG +YR++DE ++SY+F+ Sbjct: 1 MTPNEIARLQAYLRKTFGNDRLTVMAPAKKGQPVEVMLGEEFIGTLYRDEDEGDVSYNFN 60 Query: 64 MSILEDDL 71 MSIL +DL Sbjct: 61 MSILSEDL 68 >gi|319404227|emb|CBI77820.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 70 Score = 65.1 bits (157), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 31/68 (45%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M DEIKKL+ Y K F S + +++R ++DS EV + EF+G++YR++D E+SY+F Sbjct: 1 MNVDEIKKLDSYFKTKFQNSSLQIKARPKKNDSCEVYIGDEFLGVIYRDEDNGEVSYNFS 60 Query: 64 MSILEDDL 71 M+IL DL Sbjct: 61 MAILSIDL 68 >gi|154247135|ref|YP_001418093.1| hypothetical protein Xaut_3207 [Xanthobacter autotrophicus Py2] gi|154161220|gb|ABS68436.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2] Length = 69 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E+++++RYL+ +FG+ I V +R + DS EV + EFIG++YR+D+++++SY+F Sbjct: 1 MEKTELERVQRYLRTLFGNPQIKVTARTKKKDSAEVYLGEEFIGVLYRDDEDDDLSYNFQ 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDSDL 68 >gi|209884658|ref|YP_002288515.1| hypothetical protein OCAR_5519 [Oligotropha carboxidovorans OM5] gi|209872854|gb|ACI92650.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5] Length = 73 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 33/68 (48%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKR FG S I V R + DS EV + EFIG+++ +D++++ SY F Sbjct: 1 MDVTEVRKLDAYLKRTFGNSKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSYQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|116251966|ref|YP_767804.1| hypothetical protein RL2210 [Rhizobium leguminosarum bv. viciae 3841] gi|241204494|ref|YP_002975590.1| hypothetical protein Rleg_1766 [Rhizobium leguminosarum bv. trifolii WSM1325] gi|115256614|emb|CAK07702.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] gi|240858384|gb|ACS56051.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 67 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 48/67 (71%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ +EIKKL+ Y KR+F + V++R + DS EV + EF+G+VY +D++ + SY+F M Sbjct: 1 MKPEEIKKLDAYFKRMFNPQMIVKARPRKDDSAEVYLGEEFLGVVYIDDEDGDRSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDVDL 67 >gi|209549168|ref|YP_002281085.1| hypothetical protein Rleg2_1569 [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209534924|gb|ACI54859.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 67 Score = 64.3 bits (155), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 47/67 (70%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ +EIKKL+ Y KR I V++R ++DS EV + EF+G+VY +D++ + SY+F M Sbjct: 1 MKPEEIKKLDAYFKRTLNPQIVVKARPRKNDSAEVYLGEEFLGVVYIDDEDGDRSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDVDL 67 >gi|319405665|emb|CBI79288.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 70 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M DEIKKL+ Y K F S + +++R ++DS EV + EF+G++YR++++ E+SY+F Sbjct: 1 MNVDEIKKLDSYFKTKFQNSSLQIKARPKKNDSCEVYIGDEFLGIIYRDEEDNEVSYNFS 60 Query: 64 MSILEDDL 71 M+IL DL Sbjct: 61 MAILGIDL 68 >gi|192292282|ref|YP_001992887.1| hypothetical protein Rpal_3915 [Rhodopseudomonas palustris TIE-1] gi|192286031|gb|ACF02412.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1] Length = 72 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPKIRVVPRPKKEDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|146339937|ref|YP_001204985.1| hypothetical protein BRADO2941 [Bradyrhizobium sp. ORS278] gi|148256541|ref|YP_001241126.1| hypothetical protein BBta_5230 [Bradyrhizobium sp. BTAi1] gi|146192743|emb|CAL76748.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] gi|146408714|gb|ABQ37220.1| hypothetical protein BBta_5230 [Bradyrhizobium sp. BTAi1] Length = 70 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPKIRVVPRPKKEDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|27380696|ref|NP_772225.1| hypothetical protein bsl5585 [Bradyrhizobium japonicum USDA 110] gi|27353861|dbj|BAC50850.1| bsl5585 [Bradyrhizobium japonicum USDA 110] Length = 72 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVKEVRKLDAYLKRVFGNPKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|254500872|ref|ZP_05113023.1| hypothetical protein SADFL11_908 [Labrenzia alexandrii DFL-11] gi|222436943|gb|EEE43622.1| hypothetical protein SADFL11_908 [Labrenzia alexandrii DFL-11] Length = 71 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M +EI+KLE YL++ F + V++R + DS EV + EFIG+++R+D++E++S++F Sbjct: 1 MNPEEIRKLEAYLRKKFDLPSMQVRARPKKDDSAEVYIGEEFIGVIFRDDEDEDLSWNFQ 60 Query: 64 MSILEDDL 71 M+ILE DL Sbjct: 61 MAILEIDL 68 >gi|316933310|ref|YP_004108292.1| hypothetical protein Rpdx1_1948 [Rhodopseudomonas palustris DX-1] gi|315601024|gb|ADU43559.1| hypothetical protein Rpdx1_1948 [Rhodopseudomonas palustris DX-1] Length = 72 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPKIRVVPRPKKEDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|299135321|ref|ZP_07028512.1| conserved hypothetical protein [Afipia sp. 1NLS2] gi|298590298|gb|EFI50502.1| conserved hypothetical protein [Afipia sp. 1NLS2] Length = 72 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKR FG+ I V R + DS EV + EFIG+++ +D++++ SY F Sbjct: 1 MDVTEVRKLDAYLKRTFGNPKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSYQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|254293015|ref|YP_003059038.1| hypothetical protein Hbal_0639 [Hirschia baltica ATCC 49814] gi|254041546|gb|ACT58341.1| conserved hypothetical protein [Hirschia baltica ATCC 49814] Length = 67 Score = 63.9 bits (154), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 26/67 (38%), Positives = 44/67 (65%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M +E KK+E YL++ I +++R DSVE + EFI ++Y+++DE EI+Y +M Sbjct: 1 MSPEESKKVEAYLQKTLNPAINLKARPKTPDSVEAYLGDEFIAVIYKDEDEGEIAYQLNM 60 Query: 65 SILEDDL 71 +IL +D+ Sbjct: 61 TILPEDV 67 >gi|319407237|emb|CBI80876.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 70 Score = 63.5 bits (153), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M DEIKKL+ Y K F S + +++R ++DS EV + EF+G++YR+++E E+SY+F Sbjct: 1 MNVDEIKKLDSYFKTKFQNSSLQIKARLKKNDSCEVYIGDEFLGVIYRDEEEGEVSYNFS 60 Query: 64 MSILEDDL 71 M+IL DL Sbjct: 61 MAILSIDL 68 >gi|90424634|ref|YP_533004.1| hypothetical protein RPC_3143 [Rhodopseudomonas palustris BisB18] gi|90106648|gb|ABD88685.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18] Length = 72 Score = 63.2 bits (152), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKR+FG+ I V R + DS EV + EFIG+++ +D++E+ S+ F Sbjct: 1 MDVQEVRKLDAYLKRLFGNQKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDEDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|75676360|ref|YP_318781.1| hypothetical protein Nwi_2175 [Nitrobacter winogradskyi Nb-255] gi|74421230|gb|ABA05429.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255] Length = 72 Score = 62.8 bits (151), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MNVQEVRKLDAYLKRVFGNAKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|300023308|ref|YP_003755919.1| hypothetical protein Hden_1795 [Hyphomicrobium denitrificans ATCC 51888] gi|299525129|gb|ADJ23598.1| conserved hypothetical protein [Hyphomicrobium denitrificans ATCC 51888] Length = 71 Score = 62.8 bits (151), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ DE+ KL+ YL++ FG+ + V+ + + D EV +N EF+ +YR +DE EISY Sbjct: 1 MKKDELAKLQAYLRKTFGAPSLEVRPQPKKDDMAEVFINGEFVAALYREEDEGEISYQLQ 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDMDL 68 >gi|83593318|ref|YP_427070.1| hypothetical protein Rru_A1983 [Rhodospirillum rubrum ATCC 11170] gi|83576232|gb|ABC22783.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170] Length = 68 Score = 62.0 bits (149), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A EI+K+E YL+R F + + + S EVL+ EFIG + R++DE E+SY F+ Sbjct: 1 MTAAEIRKVEAYLRRTFATEALTLTPPPKAGGSCEVLLKGEFIGTLNRDEDEGEVSYAFN 60 Query: 64 MSILEDDL 71 M IL+ DL Sbjct: 61 MVILDLDL 68 >gi|92118091|ref|YP_577820.1| hypothetical protein Nham_2578 [Nitrobacter hamburgensis X14] gi|91800985|gb|ABE63360.1| conserved hypothetical protein [Nitrobacter hamburgensis X14] Length = 72 Score = 62.0 bits (149), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPRIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|115524323|ref|YP_781234.1| hypothetical protein RPE_2313 [Rhodopseudomonas palustris BisA53] gi|115518270|gb|ABJ06254.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53] Length = 72 Score = 61.2 bits (147), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNQKIRVVPRPKKEDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|86749257|ref|YP_485753.1| hypothetical protein RPB_2136 [Rhodopseudomonas palustris HaA2] gi|86572285|gb|ABD06842.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2] Length = 72 Score = 61.2 bits (147), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EF+G+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPKIRVVPRPKKDDSAEVYIGEEFVGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|91977753|ref|YP_570412.1| hypothetical protein RPD_3287 [Rhodopseudomonas palustris BisB5] gi|91684209|gb|ABE40511.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5] Length = 72 Score = 61.2 bits (147), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EF+G+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPKIRVVPRPKKDDSAEVYIGEEFVGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|294086062|ref|YP_003552822.1| hypothetical protein SAR116_2495 [Candidatus Puniceispirillum marinum IMCC1322] gi|292665637|gb|ADE40738.1| hypothetical protein SAR116_2495 [Candidatus Puniceispirillum marinum IMCC1322] Length = 72 Score = 61.2 bits (147), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 27/68 (39%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A + K++RYL++ FG+ +++ REN+ DS ++++ EFIG+V++++++ E YH Sbjct: 1 MNASDTAKVQRYLRQRFGNNKLSIARRENKEDSADLMLEDEFIGVVFQDNEDGETCYHVQ 60 Query: 64 MSILEDDL 71 +SILE+DL Sbjct: 61 ISILEEDL 68 >gi|254419200|ref|ZP_05032924.1| hypothetical protein BBAL3_1510 [Brevundimonas sp. BAL3] gi|196185377|gb|EDX80353.1| hypothetical protein BBAL3_1510 [Brevundimonas sp. BAL3] Length = 69 Score = 61.2 bits (147), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 31/68 (45%), Positives = 50/68 (73%), Gaps = 2/68 (2%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ ++K++E +LKR F +G I V++R Q+DS EV + EFIG+V+ ++DEE S+ F+ Sbjct: 1 MKDTDLKRIEAHLKRTFNTGGIIVKARPKQNDSAEVYVGDEFIGIVFEDEDEEG-SFMFE 59 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 60 MAILAEDL 67 >gi|85715632|ref|ZP_01046612.1| hypothetical protein NB311A_18326 [Nitrobacter sp. Nb-311A] gi|85697571|gb|EAQ35448.1| hypothetical protein NB311A_18326 [Nitrobacter sp. Nb-311A] Length = 72 Score = 61.2 bits (147), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ Y KRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MNVQEVRKLDAYFKRVFGNPRIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|110634079|ref|YP_674287.1| hypothetical protein Meso_1728 [Mesorhizobium sp. BNC1] gi|110285063|gb|ABG63122.1| conserved hypothetical protein [Chelativorans sp. BNC1] Length = 70 Score = 60.8 bits (146), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 26/68 (38%), Positives = 49/68 (72%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 ++ +EI+KL+ Y KR F + V++R + DS E+ + EF+G+++++++E E+SY+F Sbjct: 2 LKPEEIRKLDAYFKRTFQNPALQVKARPRKEDSCELYVGDEFLGIIFKDEEEGELSYNFS 61 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 62 MAILDVDL 69 >gi|221235668|ref|YP_002518105.1| hypothetical protein CCNA_02732 [Caulobacter crescentus NA1000] gi|220964841|gb|ACL96197.1| hypothetical protein CCNA_02732 [Caulobacter crescentus NA1000] Length = 68 Score = 60.8 bits (146), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 2/68 (2%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A + KLE++LKR FG+ I V+ R Q DS EV + EFIG+V++++DE+ S+ F+ Sbjct: 1 MDATTVAKLEKHLKRTFGNPHIQVKPRPKQKDSAEVEVAGEFIGVVFQDEDEDG-SFMFE 59 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 60 MAILGEDL 67 >gi|254470243|ref|ZP_05083647.1| conserved hypothetical protein [Pseudovibrio sp. JE062] gi|211960554|gb|EEA95750.1| conserved hypothetical protein [Pseudovibrio sp. JE062] Length = 71 Score = 60.5 bits (145), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 26/68 (38%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ DEI+K++ Y++ F S + V++R + DS EV +N EF+G+++R++++ E+S++F Sbjct: 1 MKPDEIRKVQTYMRNTFKSPELEVRARPRKDDSAEVYINDEFLGVIFRDEEDGELSWNFQ 60 Query: 64 MSILEDDL 71 M+IL+ D+ Sbjct: 61 MAILDIDV 68 >gi|114799391|ref|YP_760550.1| hypothetical protein HNE_1849 [Hyphomonas neptunium ATCC 15444] gi|114739565|gb|ABI77690.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444] Length = 70 Score = 60.5 bits (145), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 28/67 (41%), Positives = 45/67 (67%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M +E +LE YLK G+ + +R+ DSVEV + +EFI +VY+++DE E SY F M Sbjct: 1 MEREETLRLEAYLKEKLHPGLRLLARQKTDDSVEVYLGAEFIAVVYKDEDEGETSYQFMM 60 Query: 65 SILEDDL 71 ++L++D+ Sbjct: 61 TVLKEDI 67 >gi|167647698|ref|YP_001685361.1| hypothetical protein Caul_3736 [Caulobacter sp. K31] gi|167350128|gb|ABZ72863.1| conserved hypothetical protein [Caulobacter sp. K31] Length = 69 Score = 60.5 bits (145), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 2/68 (2%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A I KLE +LKR FG+ IA+++R Q DS EV + EFIG+++ ++DE+ S+ F+ Sbjct: 1 MDAATIAKLEGHLKRTFGNPHIALKARPKQKDSAEVEVKGEFIGVIFEDEDEDG-SFMFE 59 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 60 MAILAEDL 67 >gi|295688483|ref|YP_003592176.1| hypothetical protein Cseg_1053 [Caulobacter segnis ATCC 21756] gi|295430386|gb|ADG09558.1| conserved hypothetical protein [Caulobacter segnis ATCC 21756] Length = 68 Score = 59.3 bits (142), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A+ I K+E++LKR FG+ I ++ R Q DS EV + EFIG++++++DE+ S+ F+ Sbjct: 1 MDANTIAKIEKHLKRTFGNPHIQLKPRPKQKDSAEVEVAGEFIGVIFQDEDEDG-SFMFE 59 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 60 MAILAEDL 67 >gi|154253069|ref|YP_001413893.1| hypothetical protein Plav_2628 [Parvibaculum lavamentivorans DS-1] gi|154157019|gb|ABS64236.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1] Length = 70 Score = 59.3 bits (142), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 31/68 (45%), Positives = 46/68 (67%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M EIK++E YL+R F I+V+ R + DS EV + EFIG+++++ DE E SY F+ Sbjct: 1 MDKTEIKRIEAYLRRKFQLPAISVRQRPQKDDSAEVNIGDEFIGVIFKDVDEGETSYAFN 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDIDL 68 >gi|114707164|ref|ZP_01440062.1| hypothetical protein FP2506_04636 [Fulvimarina pelagi HTCC2506] gi|114537360|gb|EAU40486.1| hypothetical protein FP2506_04636 [Fulvimarina pelagi HTCC2506] Length = 84 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Query: 4 RMRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHF 62 +++ +EIKKL+ YLKR F S ++V++ Q D+ EV EFIG + ++ +E E+SYH Sbjct: 15 QVKPEEIKKLDAYLKRTFSSTDLSVRALPKQGDTAEVYKGDEFIGTLSKDTEEGELSYHL 74 Query: 63 DMSILEDDL 71 ++IL+ DL Sbjct: 75 TVTILDIDL 83 >gi|158425083|ref|YP_001526375.1| hypothetical protein AZC_3459 [Azorhizobium caulinodans ORS 571] gi|158331972|dbj|BAF89457.1| hypothetical protein [Azorhizobium caulinodans ORS 571] Length = 70 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 26/68 (38%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E+++++RYL+ +FG+ I V +R + DS EV + EFIG++++++++ ++SY+F Sbjct: 1 MDKTELERVQRYLRTLFGNPQIKVTARPKKKDSAEVYLGDEFIGVLFKDEEDGDLSYNFQ 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDTDL 68 >gi|330991428|ref|ZP_08315379.1| hypothetical protein SXCC_01333 [Gluconacetobacter sp. SXCC-1] gi|329761447|gb|EGG77940.1| hypothetical protein SXCC_01333 [Gluconacetobacter sp. SXCC-1] Length = 99 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 27/68 (39%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M + EI +L+ L+R+ GS G+ V + SVE+ +N E +G ++R++DE E+SY Sbjct: 28 MSSSEISRLQICLRRLLGSPGLTVNAPPRAGLSVELAVNGEVVGTIHRDEDEGEVSYAVH 87 Query: 64 MSILEDDL 71 M++LE+DL Sbjct: 88 MTVLEEDL 95 >gi|319783228|ref|YP_004142704.1| hypothetical protein Mesci_3534 [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169116|gb|ADV12654.1| hypothetical protein Mesci_3534 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 67 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 3/68 (4%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ DEI+KL+ Y KRVF + V++R + DS EV + EF+G+V++ DE++ Y+F Sbjct: 1 MKPDEIRKLDAYFKRVFQNPKLEVKARPRKDDSAEVYVGDEFLGIVFK--DEDDGDYNFS 58 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 59 MAILDIDL 66 >gi|329851928|ref|ZP_08266609.1| hypothetical protein ABI_46980 [Asticcacaulis biprosthecum C19] gi|328839777|gb|EGF89350.1| hypothetical protein ABI_46980 [Asticcacaulis biprosthecum C19] Length = 66 Score = 58.2 bits (139), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 31/68 (45%), Positives = 47/68 (69%), Gaps = 3/68 (4%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M EI K++ YL R FG+ G+ +++R Q DS EV + EF+G+VY ++DE SY F+ Sbjct: 1 MTPAEITKVQDYLTRTFGTKGLEIKAR-KQKDSAEVFIGEEFVGVVYVDEDEAG-SYLFE 58 Query: 64 MSILEDDL 71 M+IL++DL Sbjct: 59 MAILKEDL 66 >gi|260460736|ref|ZP_05808986.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] gi|259033313|gb|EEW34574.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] Length = 67 Score = 58.2 bits (139), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 3/68 (4%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ DEI+KL+ Y KRVF + V++R + DS EV + EF+G+V++ DE++ Y+F Sbjct: 1 MKPDEIRKLDAYFKRVFQNPKLMVKARPRKEDSAEVYVGEEFLGIVFK--DEDDGDYNFS 58 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 59 MAILDIDL 66 >gi|296114196|ref|ZP_06832851.1| hypothetical protein GXY_00389 [Gluconacetobacter hansenii ATCC 23769] gi|295979272|gb|EFG85995.1| hypothetical protein GXY_00389 [Gluconacetobacter hansenii ATCC 23769] Length = 75 Score = 57.8 bits (138), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 26/68 (38%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 + EI +L+ L+R+ GS G+ V + SVE+ +N E +G ++R++DE E+SY Sbjct: 4 ISTSEISRLQTCLRRLLGSPGLTVNAPPRAGLSVELAVNGEVVGTIHRDEDEGEVSYAVH 63 Query: 64 MSILEDDL 71 M++LE+DL Sbjct: 64 MTVLEEDL 71 >gi|315498842|ref|YP_004087646.1| hypothetical protein Astex_1831 [Asticcacaulis excentricus CB 48] gi|315416854|gb|ADU13495.1| Protein of unknown function DUF3126 [Asticcacaulis excentricus CB 48] Length = 66 Score = 57.8 bits (138), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 3/68 (4%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M EI K++ YL + FG+ G+ V++R Q DS EV + +F+G+VY ++DEE SY F+ Sbjct: 1 MTPAEITKVQAYLTQTFGTKGLEVRAR-KQKDSAEVYIGEDFVGVVYVDEDEEG-SYMFE 58 Query: 64 MSILEDDL 71 M+IL++DL Sbjct: 59 MAILKEDL 66 >gi|302382731|ref|YP_003818554.1| hypothetical protein Bresu_1620 [Brevundimonas subvibrioides ATCC 15264] gi|302193359|gb|ADL00931.1| conserved hypothetical protein [Brevundimonas subvibrioides ATCC 15264] Length = 70 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 48/68 (70%), Gaps = 2/68 (2%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M ++K++E +LKR F +G I V+ R +DS EV + EFIG+V+ +D++E+ S+ F+ Sbjct: 1 MNTADMKRIETHLKRTFNTGGIVVKPRPKVTDSAEVYVGDEFIGVVF-DDEDEDGSFMFE 59 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 60 MAILAEDL 67 >gi|209544150|ref|YP_002276379.1| hypothetical protein Gdia_2004 [Gluconacetobacter diazotrophicus PAl 5] gi|209531827|gb|ACI51764.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus PAl 5] Length = 81 Score = 56.2 bits (134), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 28/68 (41%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A EI +L+ L+R+ GS + V SVE+ + E IG V+R++DE E+SY Sbjct: 4 MSASEITRLQVCLRRLLGSPELTVNPPPRAGLSVEIAVKGEIIGTVHRDEDEGEVSYALH 63 Query: 64 MSILEDDL 71 ++ILE+DL Sbjct: 64 ITILEEDL 71 >gi|162147090|ref|YP_001601551.1| hypothetical protein GDI_1295 [Gluconacetobacter diazotrophicus PAl 5] gi|161785667|emb|CAP55238.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus PAl 5] Length = 81 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 28/68 (41%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A EI +L+ L+R+ GS + V SVE+ + E IG V+R++DE E+SY Sbjct: 4 MSASEITRLQVCLRRLLGSPELTVNPPPRAGLSVEIAVKGEIIGTVHRDEDEGEVSYALH 63 Query: 64 MSILEDDL 71 ++ILE+DL Sbjct: 64 ITILEEDL 71 >gi|163797484|ref|ZP_02191435.1| hypothetical protein BAL199_23407 [alpha proteobacterium BAL199] gi|159177233|gb|EDP61792.1| hypothetical protein BAL199_23407 [alpha proteobacterium BAL199] Length = 71 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 23/68 (33%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M +I +++ Y+++ F + I + RE ++DSVEV+++ EF+G++Y++ ++ E +HF Sbjct: 1 MTPTDIAQVQTYMRKRFANPRIGLIRREKKTDSVEVMLDDEFLGVIYKDVEDGETCFHFQ 60 Query: 64 MSILEDDL 71 M++L+ DL Sbjct: 61 MTMLDIDL 68 >gi|58040671|ref|YP_192635.1| hypothetical protein GOX2245 [Gluconobacter oxydans 621H] gi|58003085|gb|AAW61979.1| Hypothetical protein GOX2245 [Gluconobacter oxydans 621H] Length = 74 Score = 52.0 bits (123), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E+ +L+ L+R+ GS + V + SVE+ + E IG V+R++DE E+SY Sbjct: 4 MTPSEVTRLQTTLQRLLGSPKLTVNKPSRKGMSVELAVAGEVIGTVHRDEDEGEVSYAIH 63 Query: 64 MSILEDDL 71 +++LE+DL Sbjct: 64 ITVLEEDL 71 >gi|329889225|ref|ZP_08267568.1| c [Brevundimonas diminuta ATCC 11568] gi|328844526|gb|EGF94090.1| c [Brevundimonas diminuta ATCC 11568] Length = 68 Score = 51.2 bits (121), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 49/68 (72%), Gaps = 3/68 (4%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M +++K++E +LKR F GI V++R+ +DS EV ++ EFIG+V+ ++DE S+ F+ Sbjct: 1 MTENDLKRVETHLKRTFNHGGIKVKARK-VADSAEVYVDDEFIGVVFEDEDEAG-SFMFE 58 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 59 MAILAEDL 66 >gi|220922762|ref|YP_002498064.1| hypothetical protein Mnod_2810 [Methylobacterium nodulans ORS 2060] gi|219947369|gb|ACL57761.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060] Length = 70 Score = 50.4 bits (119), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E+ K+E YL+R F + + + +R ++DS EV + EFIG++ +D++ + SY+F Sbjct: 1 MNKTEMAKVEGYLRRKFANHSLRLVARPKKTDSAEVYLGEEFIGVLSVDDEDGDRSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDTDL 68 >gi|298292002|ref|YP_003693941.1| hypothetical protein Snov_2024 [Starkeya novella DSM 506] gi|296928513|gb|ADH89322.1| conserved hypothetical protein [Starkeya novella DSM 506] Length = 70 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/68 (32%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M ++++++ Y++R+F + + V +R + DS EV + EFIG+++ + ++ ++SY+F Sbjct: 1 MEKKDLERVQTYMRRLFSNTQLRVVARPKKKDSAEVYLGEEFIGVLFEDKEDGDLSYNFQ 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDTDL 68 >gi|83945646|ref|ZP_00957992.1| hypothetical protein OA2633_15150 [Oceanicaulis alexandrii HTCC2633] gi|83851012|gb|EAP88871.1| hypothetical protein OA2633_15150 [Oceanicaulis alexandrii HTCC2633] Length = 75 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 24/65 (36%), Positives = 42/65 (64%) Query: 7 ADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSI 66 A E KK+E +L+ +AV+ R+ + E+ ++SE +G+V +N +E E+SY F++ I Sbjct: 8 AAEAKKVETFLRSKLNPKLAVRLRQRADECAEIYIDSELLGVVSKNVEEGEVSYSFEIVI 67 Query: 67 LEDDL 71 L+ DL Sbjct: 68 LDIDL 72 >gi|197105686|ref|YP_002131063.1| hypothetical protein PHZ_c2224 [Phenylobacterium zucineum HLK1] gi|196479106|gb|ACG78634.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1] Length = 68 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 25/63 (39%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Query: 10 IKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILE 68 I+K+E +L+ F + I + R Q DS EV + EF+G+V++++DE+ S+ F+M+IL Sbjct: 6 IRKIEGHLRGTFANARITLVPRPKQKDSAEVYIGEEFVGVVFQDEDEDG-SFMFEMAILA 64 Query: 69 DDL 71 +DL Sbjct: 65 EDL 67 >gi|288957387|ref|YP_003447728.1| hypothetical protein AZL_005460 [Azospirillum sp. B510] gi|288909695|dbj|BAI71184.1| hypothetical protein AZL_005460 [Azospirillum sp. B510] Length = 77 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M EI +++ YL++ G+ I ++ S EV ++ EF G + R++DE E+SY + Sbjct: 1 MSDTEIARVQMYLRKTLGNPKIVIEPPAKAGQSAEVTVDGEFFGTLNRDEDEGEVSYALN 60 Query: 64 MSILEDDL 71 + ILE+DL Sbjct: 61 VVILEEDL 68 >gi|304321157|ref|YP_003854800.1| hypothetical protein PB2503_08014 [Parvularcula bermudensis HTCC2503] gi|303300059|gb|ADM09658.1| hypothetical protein PB2503_08014 [Parvularcula bermudensis HTCC2503] Length = 143 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Query: 4 RMRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHF 62 ++ A EI +L++ L VF + + V+ R N+ DS EV + EFIG+++ + +E+E F Sbjct: 68 KISAWEISRLQQILAEVFRTEELRVEHRPNKDDSAEVYIGEEFIGVLFLDTEEDETIVSF 127 Query: 63 DMSILEDDL 71 +M IL+ DL Sbjct: 128 NMGILDIDL 136 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 23/62 (37%), Positives = 32/62 (51%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M E+ KL R+LK F S + V SEF+GL+ R++DE EIS+ F M Sbjct: 1 MSPTELDKLSRFLKARFRSETVTLKAVPGQGAAGVYDESEFLGLLTRDEDEGEISFDFVM 60 Query: 65 SI 66 + Sbjct: 61 RL 62 >gi|296536319|ref|ZP_06898430.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957] gi|296263354|gb|EFH09868.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957] Length = 82 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A ++ +++ YL+R+FG+ I + SVEV + E IG ++R+ ++ EISY Sbjct: 1 MDASDLTRVQTYLRRLFGTDRINLIRPARPGLSVEVAVEDEVIGTLHRDTEDGEISYSVH 60 Query: 64 MSILEDDL 71 ++ILE+DL Sbjct: 61 LTILEEDL 68 >gi|329115259|ref|ZP_08244014.1| Hypothetical protein APO_2075 [Acetobacter pomorum DM001] gi|326695702|gb|EGE47388.1| Hypothetical protein APO_2075 [Acetobacter pomorum DM001] Length = 76 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 22/72 (30%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Query: 1 MEVRMRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEIS 59 M + EI +L+ L+R+ GS + + SVE+ + E IG ++R+D++ ++S Sbjct: 1 MSGSISPSEITRLQTALRRLLGSEKLTINPAPRAGMSVELAADGEVIGTIHRDDEDGDVS 60 Query: 60 YHFDMSILEDDL 71 Y ++ +LE+DL Sbjct: 61 YAVNIVVLEEDL 72 >gi|258541709|ref|YP_003187142.1| hypothetical protein APA01_06120 [Acetobacter pasteurianus IFO 3283-01] gi|256632787|dbj|BAH98762.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01] gi|256635844|dbj|BAI01813.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03] gi|256638899|dbj|BAI04861.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07] gi|256641953|dbj|BAI07908.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22] gi|256645008|dbj|BAI10956.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26] gi|256648063|dbj|BAI14004.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32] gi|256651116|dbj|BAI17050.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C] gi|256654107|dbj|BAI20034.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12] Length = 76 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 22/72 (30%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Query: 1 MEVRMRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEIS 59 M + EI +L+ L+R+ GS + + SVE+ + E IG ++R+D++ ++S Sbjct: 1 MSGSISPSEISRLQTALRRLLGSEKLTINPAPRAGMSVELAADGEVIGTIHRDDEDGDVS 60 Query: 60 YHFDMSILEDDL 71 Y ++ +LE+DL Sbjct: 61 YAVNIVVLEEDL 72 >gi|114329052|ref|YP_746209.1| hypothetical protein GbCGDNIH1_2388 [Granulibacter bethesdensis CGDNIH1] gi|114317226|gb|ABI63286.1| hypothetical protein GbCGDNIH1_2388 [Granulibacter bethesdensis CGDNIH1] Length = 88 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M +I +++ YL+R+ G+ I + SVEV + E IG ++++ D+ E SY Sbjct: 6 MTRTDIDRVQTYLRRLLGTDRIQLIVPPKAGLSVEVAVQDEVIGTIHKDTDDGETSYSVH 65 Query: 64 MSILEDDL 71 ++ILE+DL Sbjct: 66 LTILEEDL 73 >gi|114569619|ref|YP_756299.1| hypothetical protein Mmar10_1068 [Maricaulis maris MCS10] gi|114340081|gb|ABI65361.1| conserved hypothetical protein [Maricaulis maris MCS10] Length = 74 Score = 41.6 bits (96), Expect = 0.034, Method: Compositional matrix adjust. Identities = 23/71 (32%), Positives = 37/71 (52%) Query: 1 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 M M E KL+ +L+ + VQ R + E+ + E +G+V + DE E SY Sbjct: 1 MNKNMTMLEAAKLQMFLQAKLNPEMVVQCRNRPDECAEIHIGDECLGVVAKIIDEGETSY 60 Query: 61 HFDMSILEDDL 71 F+++IL+ DL Sbjct: 61 SFEITILDIDL 71 >gi|304391879|ref|ZP_07373821.1| conserved hypothetical protein [Ahrensia sp. R2A130] gi|303296108|gb|EFL90466.1| conserved hypothetical protein [Ahrensia sp. R2A130] Length = 143 Score = 41.2 bits (95), Expect = 0.043, Method: Compositional matrix adjust. Identities = 23/61 (37%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Query: 12 KLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDD 70 +L +K +F S + V+ R N+SDS E+ EF+G++Y +DD + F+M+IL+ D Sbjct: 71 ELNASVKEIFNSQAVEVRRRPNKSDSAEIYKGEEFLGVLYDDDDAGDGMQIFNMAILDID 130 Query: 71 L 71 L Sbjct: 131 L 131 Score = 36.2 bits (82), Expect = 1.3, Method: Compositional matrix adjust. Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 ++ DEI KL YL +F S IAV + + V + F + R++DE E+SY+F Sbjct: 2 LKQDEIDKLTDYLSTLFSSDSIAVLQHPEEDNVALVAKDQNFFARIDRDEDEGELSYNFS 61 Query: 64 MSI 66 I Sbjct: 62 KEI 64 >gi|163851533|ref|YP_001639576.1| hypothetical protein Mext_2110 [Methylobacterium extorquens PA1] gi|188581315|ref|YP_001924760.1| hypothetical protein Mpop_2062 [Methylobacterium populi BJ001] gi|218530343|ref|YP_002421159.1| hypothetical protein Mchl_2386 [Methylobacterium chloromethanicum CM4] gi|163663138|gb|ABY30505.1| conserved hypothetical protein [Methylobacterium extorquens PA1] gi|179344813|gb|ACB80225.1| conserved hypothetical protein [Methylobacterium populi BJ001] gi|218522646|gb|ACK83231.1| conserved hypothetical protein [Methylobacterium chloromethanicum CM4] Length = 71 Score = 37.4 bits (85), Expect = 0.64, Method: Compositional matrix adjust. Identities = 22/67 (32%), Positives = 36/67 (53%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M E+ KL+ YL+R F + DS EV + E IG++ + ++ + S+ F M Sbjct: 1 MTKTEVAKLQDYLRRKFANASIRVVAMKTGDSAEVFIGDESIGVLADDKEDGDDSFTFRM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDIDL 67 >gi|254561300|ref|YP_003068395.1| hypothetical protein METDI2879 [Methylobacterium extorquens DM4] gi|254268578|emb|CAX24535.1| conserved hypothetical protein [Methylobacterium extorquens DM4] Length = 102 Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 21/63 (33%), Positives = 35/63 (55%) Query: 9 EIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILE 68 E+ KL+ YL+R F + DS EV + E IG++ + ++ + S+ F M+IL+ Sbjct: 36 EVAKLQDYLRRKFANASIRVVAMKTGDSAEVFIGDESIGVLADDKEDGDDSFTFRMAILD 95 Query: 69 DDL 71 DL Sbjct: 96 IDL 98 >gi|23012188|ref|ZP_00052335.1| hypothetical protein Magn03006728 [Magnetospirillum magnetotacticum MS-1] Length = 80 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 21/63 (33%), Positives = 35/63 (55%) Query: 9 EIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILE 68 E+ KL+ YL+R F + DS EV + E IG++ + ++ + S+ F M+IL+ Sbjct: 14 EVAKLQDYLRRKFANANIRVVAMKTGDSAEVFIGDESIGVLADDKEDGDDSFTFRMAILD 73 Query: 69 DDL 71 DL Sbjct: 74 IDL 76 >gi|182677919|ref|YP_001832065.1| hypothetical protein Bind_0927 [Beijerinckia indica subsp. indica ATCC 9039] gi|182633802|gb|ACB94576.1| hypothetical protein Bind_0927 [Beijerinckia indica subsp. indica ATCC 9039] Length = 131 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ +L++ FG+ GI V D +VL+ IG + +D++ + S+ F Sbjct: 1 MEKSELQKLQGFLRQSFGNQGIKVTQARKNPDDADVLLGERQIGEIMVDDEDGDRSFAFA 60 Query: 64 MSI 66 M + Sbjct: 61 MKV 63 Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 2/60 (3%) Query: 13 LERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL 71 L+ YL+R+F + + R ++DSVE+ +F+G++ DD + S+ F M+IL+ DL Sbjct: 70 LQDYLRRLFENDRLKIIPRPKKNDSVELNSGDDFLGVIS-ADDAKGKSFTFQMAILDIDL 128 >gi|170750173|ref|YP_001756433.1| hypothetical protein Mrad2831_3775 [Methylobacterium radiotolerans JCM 2831] gi|170656695|gb|ACB25750.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM 2831] Length = 71 Score = 34.7 bits (78), Expect = 4.1, Method: Compositional matrix adjust. Identities = 22/67 (32%), Positives = 35/67 (52%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M E KL+ YL+R F + DS EV + E IG++ + ++ + S+ F M Sbjct: 1 MTKAETAKLQDYLRRKFANNNIRLMAMKTGDSAEVFIGEESIGVIADDKEDGDDSFVFRM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDIDL 67 >gi|217976273|ref|YP_002360420.1| hypothetical protein Msil_0075 [Methylocella silvestris BL2] gi|217501649|gb|ACK49058.1| conserved hypothetical protein [Methylocella silvestris BL2] Length = 131 Score = 34.3 bits (77), Expect = 6.4, Method: Compositional matrix adjust. Identities = 20/60 (33%), Positives = 37/60 (61%), Gaps = 2/60 (3%) Query: 13 LERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL 71 L+ YL+R+F + + + R ++DSVE+ +F+G++ DD + S+ M+IL+ DL Sbjct: 70 LQDYLRRLFETDKLKIVPRAKKTDSVELNRGDDFLGVI-SADDPKGRSFTLQMAILDLDL 128 Searching..................................................done Results from round 2 >gi|222148873|ref|YP_002549830.1| hypothetical protein Avi_2541 [Agrobacterium vitis S4] gi|221735859|gb|ACM36822.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 111 Score = 119 bits (300), Expect = 9e-26, Method: Composition-based stats. Identities = 33/71 (46%), Positives = 54/71 (76%) Query: 1 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 ME+ ++ADEIKKL+ Y KR F +AV++R + DS EV + EF+G+V+++D++ ++SY Sbjct: 41 MEIFVKADEIKKLDAYFKRTFNPTMAVKARPRKDDSAEVYVGEEFLGVVFKDDEDGDLSY 100 Query: 61 HFDMSILEDDL 71 +F M+IL+ DL Sbjct: 101 NFSMAILDVDL 111 >gi|15888888|ref|NP_354569.1| hypothetical protein Atu1570 [Agrobacterium tumefaciens str. C58] gi|15156658|gb|AAK87354.1| hypothetical protein Atu1570 [Agrobacterium tumefaciens str. C58] Length = 105 Score = 107 bits (268), Expect = 4e-22, Method: Composition-based stats. Identities = 31/69 (44%), Positives = 49/69 (71%) Query: 3 VRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHF 62 + ++ADEIKKL+ Y KR F + V++R + DS EV + EF+G+VY +D++ + SY+F Sbjct: 37 IVVKADEIKKLDAYFKRTFNEKMIVKARPRKDDSAEVYLGEEFLGVVYIDDEDGDRSYNF 96 Query: 63 DMSILEDDL 71 M+IL+ DL Sbjct: 97 SMAILDVDL 105 >gi|195970174|ref|NP_385590.2| hypothetical protein SMc02112 [Sinorhizobium meliloti 1021] gi|187904173|emb|CAC46063.2| Hypothetical unknown protein [Sinorhizobium meliloti 1021] Length = 81 Score = 106 bits (266), Expect = 9e-22, Method: Composition-based stats. Identities = 29/67 (43%), Positives = 50/67 (74%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 ++ +EI+KLE YLKR F + V++R + +S EV + EF+G+V+R++++ E+SY+F M Sbjct: 15 LKPEEIRKLEAYLKRTFNQSMVVKARPKKDESAEVYLGDEFLGVVFRDEEDGELSYNFSM 74 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 75 AILDIDL 81 >gi|17987018|ref|NP_539652.1| hypothetical protein BMEI0735 [Brucella melitensis bv. 1 str. 16M] gi|23502137|ref|NP_698264.1| hypothetical protein BR1261 [Brucella suis 1330] gi|62290170|ref|YP_221963.1| hypothetical protein BruAb1_1264 [Brucella abortus bv. 1 str. 9-941] gi|82700092|ref|YP_414666.1| hypothetical protein BAB1_1280 [Brucella melitensis biovar Abortus 2308] gi|148559204|ref|YP_001259177.1| hypothetical protein BOV_1223 [Brucella ovis ATCC 25840] gi|161619213|ref|YP_001593100.1| hypothetical protein BCAN_A1283 [Brucella canis ATCC 23365] gi|163843523|ref|YP_001627927.1| hypothetical protein BSUIS_A1309 [Brucella suis ATCC 23445] gi|225627728|ref|ZP_03785765.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225852757|ref|YP_002732990.1| hypothetical protein BMEA_A1309 [Brucella melitensis ATCC 23457] gi|237815677|ref|ZP_04594674.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|256369682|ref|YP_003107192.1| hypothetical protein BMI_I1272 [Brucella microti CCM 4915] gi|260884007|ref|ZP_05895621.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|261222415|ref|ZP_05936696.1| conserved hypothetical protein [Brucella ceti B1/94] gi|265991331|ref|ZP_06103888.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] gi|265995168|ref|ZP_06107725.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|265998382|ref|ZP_06110939.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|294852596|ref|ZP_06793269.1| hypothetical protein BAZG_01524 [Brucella sp. NVSL 07-0026] gi|297248563|ref|ZP_06932281.1| hypothetical protein BAYG_01521 [Brucella abortus bv. 5 str. B3196] gi|17982671|gb|AAL51916.1| hypothetical protein BMEI0735 [Brucella melitensis bv. 1 str. 16M] gi|23348099|gb|AAN30179.1| conserved hypothetical protein [Brucella suis 1330] gi|62196302|gb|AAX74602.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|82616193|emb|CAJ11236.1| conserved hypothetical protein [Brucella melitensis biovar Abortus 2308] gi|148370461|gb|ABQ60440.1| conserved hypothetical protein [Brucella ovis ATCC 25840] gi|161336024|gb|ABX62329.1| Hypothetical protein BCAN_A1283 [Brucella canis ATCC 23365] gi|163674246|gb|ABY38357.1| Hypothetical protein BSUIS_A1309 [Brucella suis ATCC 23445] gi|225617733|gb|EEH14778.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225641122|gb|ACO01036.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457] gi|237788975|gb|EEP63186.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|255999844|gb|ACU48243.1| hypothetical protein BMI_I1272 [Brucella microti CCM 4915] gi|260873535|gb|EEX80604.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|260920999|gb|EEX87652.1| conserved hypothetical protein [Brucella ceti B1/94] gi|262552850|gb|EEZ08840.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|262766281|gb|EEZ12070.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|263002115|gb|EEZ14690.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] gi|294821185|gb|EFG38184.1| hypothetical protein BAZG_01524 [Brucella sp. NVSL 07-0026] gi|297175732|gb|EFH35079.1| hypothetical protein BAYG_01521 [Brucella abortus bv. 5 str. B3196] Length = 84 Score = 106 bits (266), Expect = 9e-22, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 53/70 (75%), Gaps = 1/70 (1%) Query: 3 VRMRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYH 61 +R++ +E+KKL+ Y KR F + + V++R ++DS E+ + EF+GL+Y+++DE E+SY+ Sbjct: 15 IRLKPEELKKLDAYFKRTFNNPDLQVKARPRKNDSAELYLADEFLGLIYKDEDEGELSYN 74 Query: 62 FDMSILEDDL 71 F M+IL+ DL Sbjct: 75 FSMAILDVDL 84 >gi|150396333|ref|YP_001326800.1| hypothetical protein Smed_1114 [Sinorhizobium medicae WSM419] gi|307309260|ref|ZP_07588928.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C] gi|307317002|ref|ZP_07596443.1| conserved hypothetical protein [Sinorhizobium meliloti AK83] gi|150027848|gb|ABR59965.1| conserved hypothetical protein [Sinorhizobium medicae WSM419] gi|306897090|gb|EFN27835.1| conserved hypothetical protein [Sinorhizobium meliloti AK83] gi|306900261|gb|EFN30878.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C] Length = 67 Score = 106 bits (264), Expect = 2e-21, Method: Composition-based stats. Identities = 30/67 (44%), Positives = 50/67 (74%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ +EI+KLE YLKR F + V++R + +S EV + EF+G+V+R++++ E+SY+F M Sbjct: 1 MKPEEIRKLEAYLKRTFNQSMVVKARPKKDESAEVYLGDEFLGVVFRDEEDGELSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDIDL 67 >gi|222085847|ref|YP_002544378.1| hypothetical protein Arad_2208 [Agrobacterium radiobacter K84] gi|221723295|gb|ACM26451.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 67 Score = 106 bits (264), Expect = 2e-21, Method: Composition-based stats. Identities = 31/67 (46%), Positives = 48/67 (71%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ DEIKKL+ Y KR F + V++R ++DS EV + EF+G+VY +D++ + SY+F M Sbjct: 1 MKPDEIKKLDAYFKRTFNPQMVVKARPRKNDSAEVYLGEEFLGVVYIDDEDGDRSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDMDL 67 >gi|209549168|ref|YP_002281085.1| hypothetical protein Rleg2_1569 [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209534924|gb|ACI54859.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 67 Score = 105 bits (262), Expect = 2e-21, Method: Composition-based stats. Identities = 30/67 (44%), Positives = 47/67 (70%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ +EIKKL+ Y KR I V++R ++DS EV + EF+G+VY +D++ + SY+F M Sbjct: 1 MKPEEIKKLDAYFKRTLNPQIVVKARPRKNDSAEVYLGEEFLGVVYIDDEDGDRSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDVDL 67 >gi|153009257|ref|YP_001370472.1| hypothetical protein Oant_1927 [Ochrobactrum anthropi ATCC 49188] gi|151561145|gb|ABS14643.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188] Length = 68 Score = 105 bits (262), Expect = 2e-21, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ +E+KKL+ Y KR F + + V++R ++DS E+ +N EF+GLVY+++DE E+SY+F Sbjct: 1 MKPEELKKLDAYFKRTFNNPGLQVKARPRKNDSAELYLNDEFLGLVYKDEDEGELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDVDL 68 >gi|86357525|ref|YP_469417.1| hypothetical protein RHE_CH01904 [Rhizobium etli CFN 42] gi|86281627|gb|ABC90690.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 67 Score = 105 bits (262), Expect = 2e-21, Method: Composition-based stats. Identities = 31/67 (46%), Positives = 49/67 (73%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ +EIKKL+ Y KR+F I V++R ++DS EV + EF+G+VY +D++ + SY+F M Sbjct: 1 MKPEEIKKLDAYFKRMFNPQIIVKARPRKNDSAEVYLGEEFLGVVYVDDEDGDRSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDVDL 67 >gi|190891594|ref|YP_001978136.1| hypothetical protein RHECIAT_CH0001997 [Rhizobium etli CIAT 652] gi|218515709|ref|ZP_03512549.1| hypothetical protein Retl8_19454 [Rhizobium etli 8C-3] gi|190696873|gb|ACE90958.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 67 Score = 104 bits (261), Expect = 3e-21, Method: Composition-based stats. Identities = 31/67 (46%), Positives = 49/67 (73%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ +EIKKL+ Y KR+F I V++R ++DS EV + EF+G+VY +D++ + SY+F M Sbjct: 1 MKPEEIKKLDAYFKRMFNPQIIVKARPRKNDSAEVYLGEEFLGVVYIDDEDGDRSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDVDL 67 >gi|319408551|emb|CBI82204.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 70 Score = 104 bits (260), Expect = 4e-21, Method: Composition-based stats. Identities = 33/68 (48%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M ADEI+KL+ Y K+ F S + V++R + DS EV + EF+G++YR++DE+E+SY+F Sbjct: 1 MNADEIRKLDSYFKKTFQNSALQVKARPKKDDSCEVYIGDEFLGIIYRDEDEDELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDIDL 68 >gi|49475598|ref|YP_033639.1| hypothetical protein BH08330 [Bartonella henselae str. Houston-1] gi|49238405|emb|CAF27632.1| hypothetical protein BH08330 [Bartonella henselae str. Houston-1] Length = 80 Score = 104 bits (259), Expect = 5e-21, Method: Composition-based stats. Identities = 34/71 (47%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Query: 2 EVRMRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 E + ADEIKKL+ YLK F S + V++R + DS EV + EF+G++YR+++E E+SY Sbjct: 8 ESIVNADEIKKLDNYLKNTFQNSALQVRARPKKGDSCEVYIGDEFLGVIYRDEEENELSY 67 Query: 61 HFDMSILEDDL 71 +F M+IL+ DL Sbjct: 68 NFSMAILDIDL 78 >gi|163868310|ref|YP_001609519.1| hypothetical protein Btr_1152 [Bartonella tribocorum CIP 105476] gi|161017966|emb|CAK01524.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 87 Score = 103 bits (258), Expect = 7e-21, Method: Composition-based stats. Identities = 36/71 (50%), Positives = 52/71 (73%), Gaps = 1/71 (1%) Query: 2 EVRMRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 E + ADEIKKL+ YLK F S + V++R + DS EV M EF+G++YR++DE+E+SY Sbjct: 15 ESIVNADEIKKLDNYLKNTFQNSALQVRARPKKDDSCEVYMGDEFLGVIYRDEDEDELSY 74 Query: 61 HFDMSILEDDL 71 +F M+IL+ DL Sbjct: 75 NFSMAILDIDL 85 >gi|319404227|emb|CBI77820.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 70 Score = 103 bits (257), Expect = 8e-21, Method: Composition-based stats. Identities = 31/68 (45%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M DEIKKL+ Y K F S + +++R ++DS EV + EF+G++YR++D E+SY+F Sbjct: 1 MNVDEIKKLDSYFKTKFQNSSLQIKARPKKNDSCEVYIGDEFLGVIYRDEDNGEVSYNFS 60 Query: 64 MSILEDDL 71 M+IL DL Sbjct: 61 MAILSIDL 68 >gi|49474230|ref|YP_032272.1| hypothetical protein BQ06250 [Bartonella quintana str. Toulouse] gi|49239734|emb|CAF26116.1| hypothetical protein BQ06250 [Bartonella quintana str. Toulouse] Length = 112 Score = 103 bits (257), Expect = 1e-20, Method: Composition-based stats. Identities = 36/71 (50%), Positives = 52/71 (73%), Gaps = 1/71 (1%) Query: 2 EVRMRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 E + ADEIKKL+ YLK F S + V++R +SDS EV + EF+G++YR++DE+E+SY Sbjct: 40 ESIVNADEIKKLDSYLKNTFQNSALQVRARTKKSDSCEVYIGDEFLGVIYRDEDEDELSY 99 Query: 61 HFDMSILEDDL 71 F M+IL+ DL Sbjct: 100 SFSMAILDIDL 110 >gi|239832148|ref|ZP_04680477.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] gi|239824415|gb|EEQ95983.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 68 Score = 102 bits (256), Expect = 1e-20, Method: Composition-based stats. Identities = 30/68 (44%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ +E+KKL+ Y KR F + + V++R ++DS E+ + EF+GL+Y+++DE E+SY+F Sbjct: 1 MKPEELKKLDAYFKRTFNNPGLQVKARPRKNDSAELYLEDEFLGLIYKDEDEGELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDVDL 68 >gi|116251966|ref|YP_767804.1| hypothetical protein RL2210 [Rhizobium leguminosarum bv. viciae 3841] gi|241204494|ref|YP_002975590.1| hypothetical protein Rleg_1766 [Rhizobium leguminosarum bv. trifolii WSM1325] gi|115256614|emb|CAK07702.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] gi|240858384|gb|ACS56051.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 67 Score = 102 bits (256), Expect = 1e-20, Method: Composition-based stats. Identities = 30/67 (44%), Positives = 48/67 (71%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+ +EIKKL+ Y KR+F + V++R + DS EV + EF+G+VY +D++ + SY+F M Sbjct: 1 MKPEEIKKLDAYFKRMFNPQMIVKARPRKDDSAEVYLGEEFLGVVYIDDEDGDRSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDVDL 67 >gi|189024404|ref|YP_001935172.1| hypothetical protein BAbS19_I11930 [Brucella abortus S19] gi|254689473|ref|ZP_05152727.1| hypothetical protein Babob68_04719 [Brucella abortus bv. 6 str. 870] gi|254693959|ref|ZP_05155787.1| hypothetical protein Babob3T_04714 [Brucella abortus bv. 3 str. Tulya] gi|254697611|ref|ZP_05159439.1| hypothetical protein Babob28_07848 [Brucella abortus bv. 2 str. 86/8/59] gi|254701997|ref|ZP_05163825.1| hypothetical protein Bsuib55_14224 [Brucella suis bv. 5 str. 513] gi|254704538|ref|ZP_05166366.1| hypothetical protein Bsuib36_11532 [Brucella suis bv. 3 str. 686] gi|254706566|ref|ZP_05168394.1| hypothetical protein BpinM_06178 [Brucella pinnipedialis M163/99/10] gi|254719312|ref|ZP_05181123.1| hypothetical protein Bru83_07183 [Brucella sp. 83/13] gi|254730502|ref|ZP_05189080.1| hypothetical protein Babob42_04724 [Brucella abortus bv. 4 str. 292] gi|256044903|ref|ZP_05447807.1| hypothetical protein Bmelb1R_10451 [Brucella melitensis bv. 1 str. Rev.1] gi|256061339|ref|ZP_05451483.1| hypothetical protein Bneo5_13335 [Brucella neotomae 5K33] gi|256113818|ref|ZP_05454611.1| hypothetical protein Bmelb3E_13645 [Brucella melitensis bv. 3 str. Ether] gi|256257720|ref|ZP_05463256.1| hypothetical protein Babob9C_10306 [Brucella abortus bv. 9 str. C68] gi|256263759|ref|ZP_05466291.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|260546713|ref|ZP_05822452.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260565495|ref|ZP_05835979.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260566218|ref|ZP_05836688.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260754997|ref|ZP_05867345.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260758213|ref|ZP_05870561.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260762040|ref|ZP_05874383.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|261214251|ref|ZP_05928532.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|261219771|ref|ZP_05934052.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261314024|ref|ZP_05953221.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261317889|ref|ZP_05957086.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261322098|ref|ZP_05961295.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261325340|ref|ZP_05964537.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261752564|ref|ZP_05996273.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261755222|ref|ZP_05998931.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|261758445|ref|ZP_06002154.1| conserved hypothetical protein [Brucella sp. F5/99] gi|265984313|ref|ZP_06097048.1| conserved hypothetical protein [Brucella sp. 83/13] gi|265988917|ref|ZP_06101474.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] gi|306839085|ref|ZP_07471902.1| Hypothetical protein BROD_1925 [Brucella sp. NF 2653] gi|306840274|ref|ZP_07473048.1| Hypothetical protein BIBO2_0073 [Brucella sp. BO2] gi|306844164|ref|ZP_07476757.1| Hypothetical protein BIBO1_0831 [Brucella sp. BO1] gi|189019976|gb|ACD72698.1| hypothetical protein BAbS19_I11930 [Brucella abortus S19] gi|260095763|gb|EEW79640.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260151563|gb|EEW86657.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260155736|gb|EEW90816.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260668531|gb|EEX55471.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260672472|gb|EEX59293.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|260675105|gb|EEX61926.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260915858|gb|EEX82719.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|260924860|gb|EEX91428.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261294788|gb|EEX98284.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261297112|gb|EEY00609.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261301320|gb|EEY04817.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261303050|gb|EEY06547.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261738429|gb|EEY26425.1| conserved hypothetical protein [Brucella sp. F5/99] gi|261742317|gb|EEY30243.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261744975|gb|EEY32901.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|263093816|gb|EEZ17821.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|264661114|gb|EEZ31375.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] gi|264662905|gb|EEZ33166.1| conserved hypothetical protein [Brucella sp. 83/13] gi|306275439|gb|EFM57176.1| Hypothetical protein BIBO1_0831 [Brucella sp. BO1] gi|306289801|gb|EFM60983.1| Hypothetical protein BIBO2_0073 [Brucella sp. BO2] gi|306405632|gb|EFM61894.1| Hypothetical protein BROD_1925 [Brucella sp. NF 2653] gi|326409282|gb|ADZ66347.1| conserved hypothetical protein [Brucella melitensis M28] gi|326538992|gb|ADZ87207.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 68 Score = 102 bits (255), Expect = 1e-20, Method: Composition-based stats. Identities = 30/68 (44%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ +E+KKL+ Y KR F + + V++R ++DS E+ + EF+GL+Y+++DE E+SY+F Sbjct: 1 MKPEELKKLDAYFKRTFNNPDLQVKARPRKNDSAELYLADEFLGLIYKDEDEGELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDVDL 68 >gi|110634079|ref|YP_674287.1| hypothetical protein Meso_1728 [Mesorhizobium sp. BNC1] gi|110285063|gb|ABG63122.1| conserved hypothetical protein [Chelativorans sp. BNC1] Length = 70 Score = 101 bits (253), Expect = 3e-20, Method: Composition-based stats. Identities = 26/68 (38%), Positives = 49/68 (72%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 ++ +EI+KL+ Y KR F + V++R + DS E+ + EF+G+++++++E E+SY+F Sbjct: 2 LKPEEIRKLDAYFKRTFQNPALQVKARPRKEDSCELYVGDEFLGIIFKDEEEGELSYNFS 61 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 62 MAILDVDL 69 >gi|319898912|ref|YP_004159005.1| hypothetical protein BARCL_0746 [Bartonella clarridgeiae 73] gi|319402876|emb|CBI76427.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 70 Score = 101 bits (252), Expect = 4e-20, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M DEIKKL+ Y K F S + +++R + DS EV + EF+G++YR+++E EISY+F Sbjct: 1 MNVDEIKKLDSYFKTKFQNSSLKIKARPKKDDSCEVYIGDEFLGIIYRDEEEGEISYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDIDL 68 >gi|254470243|ref|ZP_05083647.1| conserved hypothetical protein [Pseudovibrio sp. JE062] gi|211960554|gb|EEA95750.1| conserved hypothetical protein [Pseudovibrio sp. JE062] Length = 71 Score = 101 bits (251), Expect = 4e-20, Method: Composition-based stats. Identities = 26/68 (38%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ DEI+K++ Y++ F S + V++R + DS EV +N EF+G+++R++++ E+S++F Sbjct: 1 MKPDEIRKVQTYMRNTFKSPELEVRARPRKDDSAEVYINDEFLGVIFRDEEDGELSWNFQ 60 Query: 64 MSILEDDL 71 M+IL+ D+ Sbjct: 61 MAILDIDV 68 >gi|209965113|ref|YP_002298028.1| hypothetical protein RC1_1819 [Rhodospirillum centenum SW] gi|209958579|gb|ACI99215.1| conserved domain protein [Rhodospirillum centenum SW] Length = 77 Score = 101 bits (251), Expect = 4e-20, Method: Composition-based stats. Identities = 29/68 (42%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M +EI +L+ YL++ FG+ + V + + VEV++ EFIG +YR++DE ++SY+F+ Sbjct: 1 MTPNEIARLQAYLRKTFGNDRLTVMAPAKKGQPVEVMLGEEFIGTLYRDEDEGDVSYNFN 60 Query: 64 MSILEDDL 71 MSIL +DL Sbjct: 61 MSILSEDL 68 >gi|240850645|ref|YP_002972045.1| hypothetical protein Bgr_10980 [Bartonella grahamii as4aup] gi|240267768|gb|ACS51356.1| hypothetical protein Bgr_10980 [Bartonella grahamii as4aup] Length = 70 Score = 101 bits (251), Expect = 5e-20, Method: Composition-based stats. Identities = 37/68 (54%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M ADEIKKL+ YLK +F S + V++R +SDS EV M EF+G++YR++DE+E+SY+F Sbjct: 1 MNADEIKKLDNYLKNIFQNSALQVRARPKKSDSCEVYMGDEFLGIIYRDEDEDELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDIDL 68 >gi|319405665|emb|CBI79288.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 70 Score = 100 bits (250), Expect = 6e-20, Method: Composition-based stats. Identities = 30/68 (44%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M DEIKKL+ Y K F S + +++R ++DS EV + EF+G++YR++++ E+SY+F Sbjct: 1 MNVDEIKKLDSYFKTKFQNSSLQIKARPKKNDSCEVYIGDEFLGIIYRDEEDNEVSYNFS 60 Query: 64 MSILEDDL 71 M+IL DL Sbjct: 61 MAILGIDL 68 >gi|163760305|ref|ZP_02167388.1| hypothetical protein HPDFL43_08584 [Hoeflea phototrophica DFL-43] gi|162282704|gb|EDQ32992.1| hypothetical protein HPDFL43_08584 [Hoeflea phototrophica DFL-43] Length = 69 Score = 99.5 bits (247), Expect = 1e-19, Method: Composition-based stats. Identities = 31/67 (46%), Positives = 49/67 (73%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M+A EI KLE Y KR+F + +++R + DS EV + EFIG+V+R+D++ ++SY+F M Sbjct: 1 MKAAEIIKLEAYFKRIFNDNLVIKARPAKDDSAEVYLGDEFIGIVFRDDEDGDLSYNFSM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDVDL 67 >gi|319407237|emb|CBI80876.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 70 Score = 99.1 bits (246), Expect = 2e-19, Method: Composition-based stats. Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M DEIKKL+ Y K F S + +++R ++DS EV + EF+G++YR+++E E+SY+F Sbjct: 1 MNVDEIKKLDSYFKTKFQNSSLQIKARLKKNDSCEVYIGDEFLGVIYRDEEEGEVSYNFS 60 Query: 64 MSILEDDL 71 M+IL DL Sbjct: 61 MAILSIDL 68 >gi|325292964|ref|YP_004278828.1| hypothetical protein AGROH133_06358 [Agrobacterium sp. H13-3] gi|325060817|gb|ADY64508.1| hypothetical protein AGROH133_06358 [Agrobacterium sp. H13-3] Length = 68 Score = 98.7 bits (245), Expect = 2e-19, Method: Composition-based stats. Identities = 31/67 (46%), Positives = 48/67 (71%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 ++ADEIKKL+ Y KR F + V++R + DS EV + EF+G+VY +D++ + SY+F M Sbjct: 2 VKADEIKKLDAYFKRTFNEKMVVKARPRKDDSAEVYLGEEFLGVVYIDDEDGDRSYNFSM 61 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 62 AILDVDL 68 >gi|158425083|ref|YP_001526375.1| hypothetical protein AZC_3459 [Azorhizobium caulinodans ORS 571] gi|158331972|dbj|BAF89457.1| hypothetical protein [Azorhizobium caulinodans ORS 571] Length = 70 Score = 98.4 bits (244), Expect = 3e-19, Method: Composition-based stats. Identities = 26/68 (38%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E+++++RYL+ +FG+ I V +R + DS EV + EFIG++++++++ ++SY+F Sbjct: 1 MDKTELERVQRYLRTLFGNPQIKVTARPKKKDSAEVYLGDEFIGVLFKDEEDGDLSYNFQ 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDTDL 68 >gi|121602164|ref|YP_989119.1| hypothetical protein BARBAKC583_0831 [Bartonella bacilliformis KC583] gi|120614341|gb|ABM44942.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 70 Score = 98.0 bits (243), Expect = 4e-19, Method: Composition-based stats. Identities = 34/68 (50%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M ADEIKKL+ Y K +F S + V++R + DS EV + EF+G++YR++DE+E+SY+F Sbjct: 1 MNADEIKKLDNYFKTIFQNSALQVKARPKKDDSCEVYIRDEFLGIIYRDEDEDELSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDVDL 68 >gi|254500872|ref|ZP_05113023.1| hypothetical protein SADFL11_908 [Labrenzia alexandrii DFL-11] gi|222436943|gb|EEE43622.1| hypothetical protein SADFL11_908 [Labrenzia alexandrii DFL-11] Length = 71 Score = 98.0 bits (243), Expect = 4e-19, Method: Composition-based stats. Identities = 30/68 (44%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M +EI+KLE YL++ F + V++R + DS EV + EFIG+++R+D++E++S++F Sbjct: 1 MNPEEIRKLEAYLRKKFDLPSMQVRARPKKDDSAEVYIGEEFIGVIFRDDEDEDLSWNFQ 60 Query: 64 MSILEDDL 71 M+ILE DL Sbjct: 61 MAILEIDL 68 >gi|307945513|ref|ZP_07660849.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] gi|307771386|gb|EFO30611.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] Length = 72 Score = 97.6 bits (242), Expect = 5e-19, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M +EIKKLE YLK+ F + V++R + DS EV + EFIG++YR+D+++++S++F Sbjct: 1 MNPEEIKKLEAYLKKKFDLQALQVRARPKKDDSAEVYIGDEFIGVIYRDDEDDDLSWNFQ 60 Query: 64 MSILEDDL 71 M+ILE DL Sbjct: 61 MAILEFDL 68 >gi|83593318|ref|YP_427070.1| hypothetical protein Rru_A1983 [Rhodospirillum rubrum ATCC 11170] gi|83576232|gb|ABC22783.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170] Length = 68 Score = 96.4 bits (239), Expect = 1e-18, Method: Composition-based stats. Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A EI+K+E YL+R F + + + S EVL+ EFIG + R++DE E+SY F+ Sbjct: 1 MTAAEIRKVEAYLRRTFATEALTLTPPPKAGGSCEVLLKGEFIGTLNRDEDEGEVSYAFN 60 Query: 64 MSILEDDL 71 M IL+ DL Sbjct: 61 MVILDLDL 68 >gi|85715632|ref|ZP_01046612.1| hypothetical protein NB311A_18326 [Nitrobacter sp. Nb-311A] gi|85697571|gb|EAQ35448.1| hypothetical protein NB311A_18326 [Nitrobacter sp. Nb-311A] Length = 72 Score = 96.4 bits (239), Expect = 1e-18, Method: Composition-based stats. Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ Y KRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MNVQEVRKLDAYFKRVFGNPRIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|315122669|ref|YP_004063158.1| hypothetical protein CKC_04605 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496071|gb|ADR52670.1| hypothetical protein CKC_04605 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 67 Score = 96.0 bits (238), Expect = 1e-18, Method: Composition-based stats. Identities = 52/67 (77%), Positives = 59/67 (88%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M DEIKK+ YLK++FGSGI+VQ R NQSDSVEVLMNSEFIGL+YRN+DE EISYHF M Sbjct: 1 MSPDEIKKISAYLKKMFGSGISVQLRANQSDSVEVLMNSEFIGLIYRNNDEGEISYHFAM 60 Query: 65 SILEDDL 71 SILE+DL Sbjct: 61 SILEEDL 67 >gi|118593890|ref|ZP_01551248.1| hypothetical protein SIAM614_16652 [Stappia aggregata IAM 12614] gi|118433511|gb|EAV40180.1| hypothetical protein SIAM614_16652 [Stappia aggregata IAM 12614] Length = 71 Score = 96.0 bits (238), Expect = 1e-18, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ DEI+K+E YL+ F I VQ+R + DS EV + EFIG+++R+D++E++S++F Sbjct: 1 MKPDEIRKIEAYLRSKFENKTIKVQARPRKDDSAEVYIGDEFIGVIFRDDEDEDLSWNFQ 60 Query: 64 MSILEDDL 71 M+ILE DL Sbjct: 61 MAILEIDL 68 >gi|328543249|ref|YP_004303358.1| hypothetical protein SL003B_1630 [Polymorphum gilvum SL003B-26A1] gi|326412995|gb|ADZ70058.1| Hypothetical conserved protein [Polymorphum gilvum SL003B-26A1] Length = 72 Score = 96.0 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 33/68 (48%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ADEI K+E YL+R F I +++R + DS EV + EFIG+V+R+D++E++S++F Sbjct: 1 MKADEIGKIEAYLRRKFSLPTIKLRARPRKDDSAEVYIGDEFIGVVFRDDEDEDLSWNFQ 60 Query: 64 MSILEDDL 71 M+ILE DL Sbjct: 61 MAILEIDL 68 >gi|319783228|ref|YP_004142704.1| hypothetical protein Mesci_3534 [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169116|gb|ADV12654.1| hypothetical protein Mesci_3534 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 67 Score = 96.0 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 29/68 (42%), Positives = 48/68 (70%), Gaps = 3/68 (4%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ DEI+KL+ Y KRVF + V++R + DS EV + EF+G+V++++D+ + Y+F Sbjct: 1 MKPDEIRKLDAYFKRVFQNPKLEVKARPRKDDSAEVYVGDEFLGIVFKDEDDGD--YNFS 58 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 59 MAILDIDL 66 >gi|254293015|ref|YP_003059038.1| hypothetical protein Hbal_0639 [Hirschia baltica ATCC 49814] gi|254041546|gb|ACT58341.1| conserved hypothetical protein [Hirschia baltica ATCC 49814] Length = 67 Score = 95.7 bits (237), Expect = 2e-18, Method: Composition-based stats. Identities = 26/67 (38%), Positives = 44/67 (65%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M +E KK+E YL++ I +++R DSVE + EFI ++Y+++DE EI+Y +M Sbjct: 1 MSPEESKKVEAYLQKTLNPAINLKARPKTPDSVEAYLGDEFIAVIYKDEDEGEIAYQLNM 60 Query: 65 SILEDDL 71 +IL +D+ Sbjct: 61 TILPEDV 67 >gi|75676360|ref|YP_318781.1| hypothetical protein Nwi_2175 [Nitrobacter winogradskyi Nb-255] gi|74421230|gb|ABA05429.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255] Length = 72 Score = 95.3 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MNVQEVRKLDAYLKRVFGNAKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|92118091|ref|YP_577820.1| hypothetical protein Nham_2578 [Nitrobacter hamburgensis X14] gi|91800985|gb|ABE63360.1| conserved hypothetical protein [Nitrobacter hamburgensis X14] Length = 72 Score = 95.3 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPRIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|330991428|ref|ZP_08315379.1| hypothetical protein SXCC_01333 [Gluconacetobacter sp. SXCC-1] gi|329761447|gb|EGG77940.1| hypothetical protein SXCC_01333 [Gluconacetobacter sp. SXCC-1] Length = 99 Score = 94.5 bits (234), Expect = 4e-18, Method: Composition-based stats. Identities = 26/68 (38%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M + EI +L+ L+R+ GS + V + SVE+ +N E +G ++R++DE E+SY Sbjct: 28 MSSSEISRLQICLRRLLGSPGLTVNAPPRAGLSVELAVNGEVVGTIHRDEDEGEVSYAVH 87 Query: 64 MSILEDDL 71 M++LE+DL Sbjct: 88 MTVLEEDL 95 >gi|154253069|ref|YP_001413893.1| hypothetical protein Plav_2628 [Parvibaculum lavamentivorans DS-1] gi|154157019|gb|ABS64236.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1] Length = 70 Score = 94.5 bits (234), Expect = 4e-18, Method: Composition-based stats. Identities = 31/68 (45%), Positives = 46/68 (67%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M EIK++E YL+R F I+V+ R + DS EV + EFIG+++++ DE E SY F+ Sbjct: 1 MDKTEIKRIEAYLRRKFQLPAISVRQRPQKDDSAEVNIGDEFIGVIFKDVDEGETSYAFN 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDIDL 68 >gi|86749257|ref|YP_485753.1| hypothetical protein RPB_2136 [Rhodopseudomonas palustris HaA2] gi|86572285|gb|ABD06842.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2] Length = 72 Score = 94.5 bits (234), Expect = 4e-18, Method: Composition-based stats. Identities = 30/68 (44%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EF+G+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPKIRVVPRPKKDDSAEVYIGEEFVGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|299135321|ref|ZP_07028512.1| conserved hypothetical protein [Afipia sp. 1NLS2] gi|298590298|gb|EFI50502.1| conserved hypothetical protein [Afipia sp. 1NLS2] Length = 72 Score = 94.1 bits (233), Expect = 5e-18, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKR FG+ I V R + DS EV + EFIG+++ +D++++ SY F Sbjct: 1 MDVTEVRKLDAYLKRTFGNPKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSYQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|91977753|ref|YP_570412.1| hypothetical protein RPD_3287 [Rhodopseudomonas palustris BisB5] gi|91684209|gb|ABE40511.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5] Length = 72 Score = 94.1 bits (233), Expect = 5e-18, Method: Composition-based stats. Identities = 30/68 (44%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EF+G+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPKIRVVPRPKKDDSAEVYIGEEFVGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|39936491|ref|NP_948767.1| hypothetical protein RPA3428 [Rhodopseudomonas palustris CGA009] gi|39650347|emb|CAE28869.1| conserved unknown protein [Rhodopseudomonas palustris CGA009] Length = 76 Score = 94.1 bits (233), Expect = 6e-18, Method: Composition-based stats. Identities = 33/72 (45%), Positives = 51/72 (70%), Gaps = 1/72 (1%) Query: 1 MEVRMRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEIS 59 ME+ + E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S Sbjct: 1 MEITVDVQEVRKLDAYLKRVFGNPKIRVVPRPKKEDSAEVYIGEEFIGVLFVDDEDDDRS 60 Query: 60 YHFDMSILEDDL 71 + F M+ILEDDL Sbjct: 61 FQFQMAILEDDL 72 >gi|260460736|ref|ZP_05808986.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] gi|259033313|gb|EEW34574.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] Length = 67 Score = 93.7 bits (232), Expect = 7e-18, Method: Composition-based stats. Identities = 29/68 (42%), Positives = 48/68 (70%), Gaps = 3/68 (4%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ DEI+KL+ Y KRVF + V++R + DS EV + EF+G+V++++D+ + Y+F Sbjct: 1 MKPDEIRKLDAYFKRVFQNPKLMVKARPRKEDSAEVYVGEEFLGIVFKDEDDGD--YNFS 58 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 59 MAILDIDL 66 >gi|209884658|ref|YP_002288515.1| hypothetical protein OCAR_5519 [Oligotropha carboxidovorans OM5] gi|209872854|gb|ACI92650.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5] Length = 73 Score = 93.3 bits (231), Expect = 9e-18, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKR FG+ I V R + DS EV + EFIG+++ +D++++ SY F Sbjct: 1 MDVTEVRKLDAYLKRTFGNSKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSYQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|220922762|ref|YP_002498064.1| hypothetical protein Mnod_2810 [Methylobacterium nodulans ORS 2060] gi|219947369|gb|ACL57761.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060] Length = 70 Score = 93.3 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E+ K+E YL+R F + + + +R ++DS EV + EFIG++ +D++ + SY+F Sbjct: 1 MNKTEMAKVEGYLRRKFANHSLRLVARPKKTDSAEVYLGEEFIGVLSVDDEDGDRSYNFS 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDTDL 68 >gi|209544150|ref|YP_002276379.1| hypothetical protein Gdia_2004 [Gluconacetobacter diazotrophicus PAl 5] gi|209531827|gb|ACI51764.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus PAl 5] Length = 81 Score = 93.3 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 1/69 (1%) Query: 4 RMRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHF 62 M A EI +L+ L+R+ GS + V SVE+ + E IG V+R++DE E+SY Sbjct: 3 SMSASEITRLQVCLRRLLGSPELTVNPPPRAGLSVEIAVKGEIIGTVHRDEDEGEVSYAL 62 Query: 63 DMSILEDDL 71 ++ILE+DL Sbjct: 63 HITILEEDL 71 >gi|254780165|ref|YP_003064578.1| hypothetical protein CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62] gi|254039842|gb|ACT56638.1| hypothetical protein CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 93.0 bits (230), Expect = 1e-17, Method: Composition-based stats. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY Sbjct: 1 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 Query: 61 HFDMSILEDDL 71 HFDMSILEDDL Sbjct: 61 HFDMSILEDDL 71 >gi|154247135|ref|YP_001418093.1| hypothetical protein Xaut_3207 [Xanthobacter autotrophicus Py2] gi|154161220|gb|ABS68436.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2] Length = 69 Score = 92.6 bits (229), Expect = 1e-17, Method: Composition-based stats. Identities = 29/68 (42%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E+++++RYL+ +FG+ I V +R + DS EV + EFIG++YR+D+++++SY+F Sbjct: 1 MEKTELERVQRYLRTLFGNPQIKVTARTKKKDSAEVYLGEEFIGVLYRDDEDDDLSYNFQ 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDSDL 68 >gi|114707164|ref|ZP_01440062.1| hypothetical protein FP2506_04636 [Fulvimarina pelagi HTCC2506] gi|114537360|gb|EAU40486.1| hypothetical protein FP2506_04636 [Fulvimarina pelagi HTCC2506] Length = 84 Score = 92.6 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Query: 4 RMRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHF 62 +++ +EIKKL+ YLKR F S ++V++ Q D+ EV EFIG + ++ +E E+SYH Sbjct: 15 QVKPEEIKKLDAYLKRTFSSTDLSVRALPKQGDTAEVYKGDEFIGTLSKDTEEGELSYHL 74 Query: 63 DMSILEDDL 71 ++IL+ DL Sbjct: 75 TVTILDIDL 83 >gi|296114196|ref|ZP_06832851.1| hypothetical protein GXY_00389 [Gluconacetobacter hansenii ATCC 23769] gi|295979272|gb|EFG85995.1| hypothetical protein GXY_00389 [Gluconacetobacter hansenii ATCC 23769] Length = 75 Score = 92.6 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 + EI +L+ L+R+ GS + V + SVE+ +N E +G ++R++DE E+SY Sbjct: 4 ISTSEISRLQTCLRRLLGSPGLTVNAPPRAGLSVELAVNGEVVGTIHRDEDEGEVSYAVH 63 Query: 64 MSILEDDL 71 M++LE+DL Sbjct: 64 MTVLEEDL 71 >gi|115524323|ref|YP_781234.1| hypothetical protein RPE_2313 [Rhodopseudomonas palustris BisA53] gi|115518270|gb|ABJ06254.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53] Length = 72 Score = 92.2 bits (228), Expect = 2e-17, Method: Composition-based stats. Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNQKIRVVPRPKKEDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILE+DL Sbjct: 61 MAILEEDL 68 >gi|27380696|ref|NP_772225.1| hypothetical protein bsl5585 [Bradyrhizobium japonicum USDA 110] gi|27353861|dbj|BAC50850.1| bsl5585 [Bradyrhizobium japonicum USDA 110] Length = 72 Score = 91.8 bits (227), Expect = 2e-17, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVKEVRKLDAYLKRVFGNPKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|162147090|ref|YP_001601551.1| hypothetical protein GDI_1295 [Gluconacetobacter diazotrophicus PAl 5] gi|161785667|emb|CAP55238.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus PAl 5] Length = 81 Score = 91.8 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 1/69 (1%) Query: 4 RMRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHF 62 M A EI +L+ L+R+ GS + V SVE+ + E IG V+R++DE E+SY Sbjct: 3 SMSASEITRLQVCLRRLLGSPELTVNPPPRAGLSVEIAVKGEIIGTVHRDEDEGEVSYAL 62 Query: 63 DMSILEDDL 71 ++ILE+DL Sbjct: 63 HITILEEDL 71 >gi|146339937|ref|YP_001204985.1| hypothetical protein BRADO2941 [Bradyrhizobium sp. ORS278] gi|148256541|ref|YP_001241126.1| hypothetical protein BBta_5230 [Bradyrhizobium sp. BTAi1] gi|146192743|emb|CAL76748.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] gi|146408714|gb|ABQ37220.1| hypothetical protein BBta_5230 [Bradyrhizobium sp. BTAi1] Length = 70 Score = 91.8 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPKIRVVPRPKKEDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|90424634|ref|YP_533004.1| hypothetical protein RPC_3143 [Rhodopseudomonas palustris BisB18] gi|90106648|gb|ABD88685.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18] Length = 72 Score = 91.8 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKR+FG+ I V R + DS EV + EFIG+++ +D++E+ S+ F Sbjct: 1 MDVQEVRKLDAYLKRLFGNQKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDEDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|316933310|ref|YP_004108292.1| hypothetical protein Rpdx1_1948 [Rhodopseudomonas palustris DX-1] gi|315601024|gb|ADU43559.1| hypothetical protein Rpdx1_1948 [Rhodopseudomonas palustris DX-1] Length = 72 Score = 91.8 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPKIRVVPRPKKEDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|192292282|ref|YP_001992887.1| hypothetical protein Rpal_3915 [Rhodopseudomonas palustris TIE-1] gi|192286031|gb|ACF02412.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1] Length = 72 Score = 91.4 bits (226), Expect = 3e-17, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ YLKRVFG+ I V R + DS EV + EFIG+++ +D++++ S+ F Sbjct: 1 MDVQEVRKLDAYLKRVFGNPKIRVVPRPKKEDSAEVYIGEEFIGVLFVDDEDDDRSFQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|298292002|ref|YP_003693941.1| hypothetical protein Snov_2024 [Starkeya novella DSM 506] gi|296928513|gb|ADH89322.1| conserved hypothetical protein [Starkeya novella DSM 506] Length = 70 Score = 91.0 bits (225), Expect = 5e-17, Method: Composition-based stats. Identities = 22/68 (32%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M ++++++ Y++R+F + + V +R + DS EV + EFIG+++ + ++ ++SY+F Sbjct: 1 MEKKDLERVQTYMRRLFSNTQLRVVARPKKKDSAEVYLGEEFIGVLFEDKEDGDLSYNFQ 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDTDL 68 >gi|300023308|ref|YP_003755919.1| hypothetical protein Hden_1795 [Hyphomicrobium denitrificans ATCC 51888] gi|299525129|gb|ADJ23598.1| conserved hypothetical protein [Hyphomicrobium denitrificans ATCC 51888] Length = 71 Score = 90.6 bits (224), Expect = 7e-17, Method: Composition-based stats. Identities = 29/68 (42%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ DE+ KL+ YL++ FG + V+ + + D EV +N EF+ +YR +DE EISY Sbjct: 1 MKKDELAKLQAYLRKTFGAPSLEVRPQPKKDDMAEVFINGEFVAALYREEDEGEISYQLQ 60 Query: 64 MSILEDDL 71 M+IL+ DL Sbjct: 61 MAILDMDL 68 >gi|163797484|ref|ZP_02191435.1| hypothetical protein BAL199_23407 [alpha proteobacterium BAL199] gi|159177233|gb|EDP61792.1| hypothetical protein BAL199_23407 [alpha proteobacterium BAL199] Length = 71 Score = 87.6 bits (216), Expect = 5e-16, Method: Composition-based stats. Identities = 23/68 (33%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M +I +++ Y+++ F + I + RE ++DSVEV+++ EF+G++Y++ ++ E +HF Sbjct: 1 MTPTDIAQVQTYMRKRFANPRIGLIRREKKTDSVEVMLDDEFLGVIYKDVEDGETCFHFQ 60 Query: 64 MSILEDDL 71 M++L+ DL Sbjct: 61 MTMLDIDL 68 >gi|302382731|ref|YP_003818554.1| hypothetical protein Bresu_1620 [Brevundimonas subvibrioides ATCC 15264] gi|302193359|gb|ADL00931.1| conserved hypothetical protein [Brevundimonas subvibrioides ATCC 15264] Length = 70 Score = 87.2 bits (215), Expect = 6e-16, Method: Composition-based stats. Identities = 29/68 (42%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M ++K++E +LKR F +G I V+ R +DS EV + EFIG+V+ ++DE+ S+ F+ Sbjct: 1 MNTADMKRIETHLKRTFNTGGIVVKPRPKVTDSAEVYVGDEFIGVVFDDEDEDG-SFMFE 59 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 60 MAILAEDL 67 >gi|254419200|ref|ZP_05032924.1| hypothetical protein BBAL3_1510 [Brevundimonas sp. BAL3] gi|196185377|gb|EDX80353.1| hypothetical protein BBAL3_1510 [Brevundimonas sp. BAL3] Length = 69 Score = 87.2 bits (215), Expect = 7e-16, Method: Composition-based stats. Identities = 31/68 (45%), Positives = 50/68 (73%), Gaps = 2/68 (2%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M+ ++K++E +LKR F +G I V++R Q+DS EV + EFIG+V+ ++DE E S+ F+ Sbjct: 1 MKDTDLKRIEAHLKRTFNTGGIIVKARPKQNDSAEVYVGDEFIGIVFEDEDE-EGSFMFE 59 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 60 MAILAEDL 67 >gi|221235668|ref|YP_002518105.1| hypothetical protein CCNA_02732 [Caulobacter crescentus NA1000] gi|220964841|gb|ACL96197.1| hypothetical protein CCNA_02732 [Caulobacter crescentus NA1000] Length = 68 Score = 87.2 bits (215), Expect = 7e-16, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 2/68 (2%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A + KLE++LKR FG+ I V+ R Q DS EV + EFIG+V++++DE+ S+ F+ Sbjct: 1 MDATTVAKLEKHLKRTFGNPHIQVKPRPKQKDSAEVEVAGEFIGVVFQDEDEDG-SFMFE 59 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 60 MAILGEDL 67 >gi|114799391|ref|YP_760550.1| hypothetical protein HNE_1849 [Hyphomonas neptunium ATCC 15444] gi|114739565|gb|ABI77690.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444] Length = 70 Score = 86.8 bits (214), Expect = 8e-16, Method: Composition-based stats. Identities = 28/67 (41%), Positives = 45/67 (67%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M +E +LE YLK G+ + +R+ DSVEV + +EFI +VY+++DE E SY F M Sbjct: 1 MEREETLRLEAYLKEKLHPGLRLLARQKTDDSVEVYLGAEFIAVVYKDEDEGETSYQFMM 60 Query: 65 SILEDDL 71 ++L++D+ Sbjct: 61 TVLKEDI 67 >gi|295688483|ref|YP_003592176.1| hypothetical protein Cseg_1053 [Caulobacter segnis ATCC 21756] gi|295430386|gb|ADG09558.1| conserved hypothetical protein [Caulobacter segnis ATCC 21756] Length = 68 Score = 86.4 bits (213), Expect = 1e-15, Method: Composition-based stats. Identities = 30/68 (44%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A+ I K+E++LKR FG+ I ++ R Q DS EV + EFIG++++++DE+ S+ F+ Sbjct: 1 MDANTIAKIEKHLKRTFGNPHIQLKPRPKQKDSAEVEVAGEFIGVIFQDEDEDG-SFMFE 59 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 60 MAILAEDL 67 >gi|329115259|ref|ZP_08244014.1| Hypothetical protein APO_2075 [Acetobacter pomorum DM001] gi|326695702|gb|EGE47388.1| Hypothetical protein APO_2075 [Acetobacter pomorum DM001] Length = 76 Score = 86.0 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 22/72 (30%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Query: 1 MEVRMRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEIS 59 M + EI +L+ L+R+ GS + + SVE+ + E IG ++R+D++ ++S Sbjct: 1 MSGSISPSEITRLQTALRRLLGSEKLTINPAPRAGMSVELAADGEVIGTIHRDDEDGDVS 60 Query: 60 YHFDMSILEDDL 71 Y ++ +LE+DL Sbjct: 61 YAVNIVVLEEDL 72 >gi|288957387|ref|YP_003447728.1| hypothetical protein AZL_005460 [Azospirillum sp. B510] gi|288909695|dbj|BAI71184.1| hypothetical protein AZL_005460 [Azospirillum sp. B510] Length = 77 Score = 85.6 bits (211), Expect = 2e-15, Method: Composition-based stats. Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M EI +++ YL++ G+ I ++ S EV ++ EF G + R++DE E+SY + Sbjct: 1 MSDTEIARVQMYLRKTLGNPKIVIEPPAKAGQSAEVTVDGEFFGTLNRDEDEGEVSYALN 60 Query: 64 MSILEDDL 71 + ILE+DL Sbjct: 61 VVILEEDL 68 >gi|258541709|ref|YP_003187142.1| hypothetical protein APA01_06120 [Acetobacter pasteurianus IFO 3283-01] gi|256632787|dbj|BAH98762.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01] gi|256635844|dbj|BAI01813.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03] gi|256638899|dbj|BAI04861.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07] gi|256641953|dbj|BAI07908.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22] gi|256645008|dbj|BAI10956.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26] gi|256648063|dbj|BAI14004.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32] gi|256651116|dbj|BAI17050.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C] gi|256654107|dbj|BAI20034.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12] Length = 76 Score = 85.3 bits (210), Expect = 2e-15, Method: Composition-based stats. Identities = 22/72 (30%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Query: 1 MEVRMRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEIS 59 M + EI +L+ L+R+ GS + + SVE+ + E IG ++R+D++ ++S Sbjct: 1 MSGSISPSEISRLQTALRRLLGSEKLTINPAPRAGMSVELAADGEVIGTIHRDDEDGDVS 60 Query: 60 YHFDMSILEDDL 71 Y ++ +LE+DL Sbjct: 61 YAVNIVVLEEDL 72 >gi|58040671|ref|YP_192635.1| hypothetical protein GOX2245 [Gluconobacter oxydans 621H] gi|58003085|gb|AAW61979.1| Hypothetical protein GOX2245 [Gluconobacter oxydans 621H] Length = 74 Score = 85.3 bits (210), Expect = 2e-15, Method: Composition-based stats. Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E+ +L+ L+R+ GS + V + SVE+ + E IG V+R++DE E+SY Sbjct: 4 MTPSEVTRLQTTLQRLLGSPKLTVNKPSRKGMSVELAVAGEVIGTVHRDEDEGEVSYAIH 63 Query: 64 MSILEDDL 71 +++LE+DL Sbjct: 64 ITVLEEDL 71 >gi|167647698|ref|YP_001685361.1| hypothetical protein Caul_3736 [Caulobacter sp. K31] gi|167350128|gb|ABZ72863.1| conserved hypothetical protein [Caulobacter sp. K31] Length = 69 Score = 85.3 bits (210), Expect = 3e-15, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 2/68 (2%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A I KLE +LKR FG+ IA+++R Q DS EV + EFIG+++ ++DE+ S+ F+ Sbjct: 1 MDAATIAKLEGHLKRTFGNPHIALKARPKQKDSAEVEVKGEFIGVIFEDEDEDG-SFMFE 59 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 60 MAILAEDL 67 >gi|114329052|ref|YP_746209.1| hypothetical protein GbCGDNIH1_2388 [Granulibacter bethesdensis CGDNIH1] gi|114317226|gb|ABI63286.1| hypothetical protein GbCGDNIH1_2388 [Granulibacter bethesdensis CGDNIH1] Length = 88 Score = 85.3 bits (210), Expect = 3e-15, Method: Composition-based stats. Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Query: 3 VRMRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYH 61 + M +I +++ YL+R+ G+ I + SVEV + E IG ++++ D+ E SY Sbjct: 4 MSMTRTDIDRVQTYLRRLLGTDRIQLIVPPKAGLSVEVAVQDEVIGTIHKDTDDGETSYS 63 Query: 62 FDMSILEDDL 71 ++ILE+DL Sbjct: 64 VHLTILEEDL 73 >gi|315498842|ref|YP_004087646.1| hypothetical protein Astex_1831 [Asticcacaulis excentricus CB 48] gi|315416854|gb|ADU13495.1| Protein of unknown function DUF3126 [Asticcacaulis excentricus CB 48] Length = 66 Score = 83.7 bits (206), Expect = 7e-15, Method: Composition-based stats. Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 3/68 (4%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M EI K++ YL + FG+ G+ V++R Q DS EV + +F+G+VY ++DE E SY F+ Sbjct: 1 MTPAEITKVQAYLTQTFGTKGLEVRAR-KQKDSAEVYIGEDFVGVVYVDEDE-EGSYMFE 58 Query: 64 MSILEDDL 71 M+IL++DL Sbjct: 59 MAILKEDL 66 >gi|312113810|ref|YP_004011406.1| hypothetical protein Rvan_1033 [Rhodomicrobium vannielii ATCC 17100] gi|311218939|gb|ADP70307.1| hypothetical protein Rvan_1033 [Rhodomicrobium vannielii ATCC 17100] Length = 70 Score = 83.3 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E K LE+YL++ F I V+ R+ + DSVEV + EF+G++Y++D++ E+SY F Sbjct: 1 MTPAETKALEKYLRKTFSLEAIEVKKRQKKQDSVEVFVKEEFVGVIYKDDEDNEVSYQFQ 60 Query: 64 MSILEDDL 71 M+ILEDDL Sbjct: 61 MAILEDDL 68 >gi|197105686|ref|YP_002131063.1| hypothetical protein PHZ_c2224 [Phenylobacterium zucineum HLK1] gi|196479106|gb|ACG78634.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1] Length = 68 Score = 82.9 bits (204), Expect = 1e-14, Method: Composition-based stats. Identities = 26/68 (38%), Positives = 44/68 (64%), Gaps = 2/68 (2%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M I+K+E +L+ F + I + R Q DS EV + EF+G+V++++DE+ S+ F+ Sbjct: 1 MDEKTIRKIEGHLRGTFANARITLVPRPKQKDSAEVYIGEEFVGVVFQDEDEDG-SFMFE 59 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 60 MAILAEDL 67 >gi|329851928|ref|ZP_08266609.1| hypothetical protein ABI_46980 [Asticcacaulis biprosthecum C19] gi|328839777|gb|EGF89350.1| hypothetical protein ABI_46980 [Asticcacaulis biprosthecum C19] Length = 66 Score = 81.8 bits (201), Expect = 3e-14, Method: Composition-based stats. Identities = 31/68 (45%), Positives = 47/68 (69%), Gaps = 3/68 (4%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M EI K++ YL R FG+ G+ +++R Q DS EV + EF+G+VY ++DE SY F+ Sbjct: 1 MTPAEITKVQDYLTRTFGTKGLEIKAR-KQKDSAEVFIGEEFVGVVYVDEDEAG-SYLFE 58 Query: 64 MSILEDDL 71 M+IL++DL Sbjct: 59 MAILKEDL 66 >gi|294086062|ref|YP_003552822.1| hypothetical protein SAR116_2495 [Candidatus Puniceispirillum marinum IMCC1322] gi|292665637|gb|ADE40738.1| hypothetical protein SAR116_2495 [Candidatus Puniceispirillum marinum IMCC1322] Length = 72 Score = 81.0 bits (199), Expect = 5e-14, Method: Composition-based stats. Identities = 27/68 (39%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A + K++RYL++ FG+ +++ REN+ DS ++++ EFIG+V++++++ E YH Sbjct: 1 MNASDTAKVQRYLRQRFGNNKLSIARRENKEDSADLMLEDEFIGVVFQDNEDGETCYHVQ 60 Query: 64 MSILEDDL 71 +SILE+DL Sbjct: 61 ISILEEDL 68 >gi|296536319|ref|ZP_06898430.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957] gi|296263354|gb|EFH09868.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957] Length = 82 Score = 81.0 bits (199), Expect = 5e-14, Method: Composition-based stats. Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M A ++ +++ YL+R+FG+ I + SVEV + E IG ++R+ ++ EISY Sbjct: 1 MDASDLTRVQTYLRRLFGTDRINLIRPARPGLSVEVAVEDEVIGTLHRDTEDGEISYSVH 60 Query: 64 MSILEDDL 71 ++ILE+DL Sbjct: 61 LTILEEDL 68 >gi|304321157|ref|YP_003854800.1| hypothetical protein PB2503_08014 [Parvularcula bermudensis HTCC2503] gi|303300059|gb|ADM09658.1| hypothetical protein PB2503_08014 [Parvularcula bermudensis HTCC2503] Length = 143 Score = 80.6 bits (198), Expect = 7e-14, Method: Composition-based stats. Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Query: 4 RMRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHF 62 ++ A EI +L++ L VF + + V+ R N+ DS EV + EFIG+++ + +E+E F Sbjct: 68 KISAWEISRLQQILAEVFRTEELRVEHRPNKDDSAEVYIGEEFIGVLFLDTEEDETIVSF 127 Query: 63 DMSILEDDL 71 +M IL+ DL Sbjct: 128 NMGILDIDL 136 Score = 50.6 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E+ KL R+LK F S + +++ Q + V SEF+GL+ R++DE EIS+ F Sbjct: 1 MSPTELDKLSRFLKARFRSETVTLKAVPGQG-AAGVYDESEFLGLLTRDEDEGEISFDFV 59 Query: 64 M 64 M Sbjct: 60 M 60 >gi|83945646|ref|ZP_00957992.1| hypothetical protein OA2633_15150 [Oceanicaulis alexandrii HTCC2633] gi|83851012|gb|EAP88871.1| hypothetical protein OA2633_15150 [Oceanicaulis alexandrii HTCC2633] Length = 75 Score = 79.9 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 24/66 (36%), Positives = 42/66 (63%) Query: 6 RADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMS 65 A E KK+E +L+ +AV+ R+ + E+ ++SE +G+V +N +E E+SY F++ Sbjct: 7 TAAEAKKVETFLRSKLNPKLAVRLRQRADECAEIYIDSELLGVVSKNVEEGEVSYSFEIV 66 Query: 66 ILEDDL 71 IL+ DL Sbjct: 67 ILDIDL 72 >gi|329889225|ref|ZP_08267568.1| c [Brevundimonas diminuta ATCC 11568] gi|328844526|gb|EGF94090.1| c [Brevundimonas diminuta ATCC 11568] Length = 68 Score = 75.6 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 29/68 (42%), Positives = 48/68 (70%), Gaps = 3/68 (4%) Query: 5 MRADEIKKLERYLKRVFG-SGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M +++K++E +LKR F GI V++R +DS EV ++ EFIG+V+ ++DE S+ F+ Sbjct: 1 MTENDLKRVETHLKRTFNHGGIKVKAR-KVADSAEVYVDDEFIGVVFEDEDEAG-SFMFE 58 Query: 64 MSILEDDL 71 M+IL +DL Sbjct: 59 MAILAEDL 66 >gi|254561300|ref|YP_003068395.1| hypothetical protein METDI2879 [Methylobacterium extorquens DM4] gi|254268578|emb|CAX24535.1| conserved hypothetical protein [Methylobacterium extorquens DM4] Length = 102 Score = 75.6 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 21/67 (31%), Positives = 36/67 (53%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 + E+ KL+ YL+R F + DS EV + E IG++ + ++ + S+ F M Sbjct: 32 VTKTEVAKLQDYLRRKFANASIRVVAMKTGDSAEVFIGDESIGVLADDKEDGDDSFTFRM 91 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 92 AILDIDL 98 >gi|163851533|ref|YP_001639576.1| hypothetical protein Mext_2110 [Methylobacterium extorquens PA1] gi|188581315|ref|YP_001924760.1| hypothetical protein Mpop_2062 [Methylobacterium populi BJ001] gi|218530343|ref|YP_002421159.1| hypothetical protein Mchl_2386 [Methylobacterium chloromethanicum CM4] gi|163663138|gb|ABY30505.1| conserved hypothetical protein [Methylobacterium extorquens PA1] gi|179344813|gb|ACB80225.1| conserved hypothetical protein [Methylobacterium populi BJ001] gi|218522646|gb|ACK83231.1| conserved hypothetical protein [Methylobacterium chloromethanicum CM4] Length = 71 Score = 71.4 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 36/67 (53%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M E+ KL+ YL+R F + DS EV + E IG++ + ++ + S+ F M Sbjct: 1 MTKTEVAKLQDYLRRKFANASIRVVAMKTGDSAEVFIGDESIGVLADDKEDGDDSFTFRM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDIDL 67 >gi|114569619|ref|YP_756299.1| hypothetical protein Mmar10_1068 [Maricaulis maris MCS10] gi|114340081|gb|ABI65361.1| conserved hypothetical protein [Maricaulis maris MCS10] Length = 74 Score = 71.4 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 23/71 (32%), Positives = 37/71 (52%) Query: 1 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 M M E KL+ +L+ + VQ R + E+ + E +G+V + DE E SY Sbjct: 1 MNKNMTMLEAAKLQMFLQAKLNPEMVVQCRNRPDECAEIHIGDECLGVVAKIIDEGETSY 60 Query: 61 HFDMSILEDDL 71 F+++IL+ DL Sbjct: 61 SFEITILDIDL 71 >gi|23012188|ref|ZP_00052335.1| hypothetical protein Magn03006728 [Magnetospirillum magnetotacticum MS-1] Length = 80 Score = 70.2 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 21/67 (31%), Positives = 36/67 (53%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 + E+ KL+ YL+R F + DS EV + E IG++ + ++ + S+ F M Sbjct: 10 VTKTEVAKLQDYLRRKFANANIRVVAMKTGDSAEVFIGDESIGVLADDKEDGDDSFTFRM 69 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 70 AILDIDL 76 >gi|170750173|ref|YP_001756433.1| hypothetical protein Mrad2831_3775 [Methylobacterium radiotolerans JCM 2831] gi|170656695|gb|ACB25750.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM 2831] Length = 71 Score = 68.7 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 35/67 (52%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 M E KL+ YL+R F + DS EV + E IG++ + ++ + S+ F M Sbjct: 1 MTKAETAKLQDYLRRKFANNNIRLMAMKTGDSAEVFIGEESIGVIADDKEDGDDSFVFRM 60 Query: 65 SILEDDL 71 +IL+ DL Sbjct: 61 AILDIDL 67 >gi|182677919|ref|YP_001832065.1| hypothetical protein Bind_0927 [Beijerinckia indica subsp. indica ATCC 9039] gi|182633802|gb|ACB94576.1| hypothetical protein Bind_0927 [Beijerinckia indica subsp. indica ATCC 9039] Length = 131 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 2/66 (3%) Query: 7 ADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMS 65 E L+ YL+R+F + + R ++DSVE+ +F+G++ +D + + S+ F M+ Sbjct: 64 PVERPVLQDYLRRLFENDRLKIIPRPKKNDSVELNSGDDFLGVISADDAKGK-SFTFQMA 122 Query: 66 ILEDDL 71 IL+ DL Sbjct: 123 ILDIDL 128 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ +L++ FG+ GI V D +VL+ IG + +D++ + S+ F Sbjct: 1 MEKSELQKLQGFLRQSFGNQGIKVTQARKNPDDADVLLGERQIGEIMVDDEDGDRSFAFA 60 Query: 64 MSI 66 M + Sbjct: 61 MKV 63 >gi|304391879|ref|ZP_07373821.1| conserved hypothetical protein [Ahrensia sp. R2A130] gi|303296108|gb|EFL90466.1| conserved hypothetical protein [Ahrensia sp. R2A130] Length = 143 Score = 64.5 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Query: 13 LERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL 71 L +K +F S + V+ R N+SDS E+ EF+G++Y +DD + F+M+IL+ DL Sbjct: 72 LNASVKEIFNSQAVEVRRRPNKSDSAEIYKGEEFLGVLYDDDDAGDGMQIFNMAILDIDL 131 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 ++ DEI KL YL +F S IAV + + V + F + R++DE E+SY+F Sbjct: 2 LKQDEIDKLTDYLSTLFSSDSIAVLQHPEEDNVALVAKDQNFFARIDRDEDEGELSYNFS 61 Query: 64 MSILE 68 I + Sbjct: 62 KEIPD 66 >gi|217976273|ref|YP_002360420.1| hypothetical protein Msil_0075 [Methylocella silvestris BL2] gi|217501649|gb|ACK49058.1| conserved hypothetical protein [Methylocella silvestris BL2] Length = 131 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Query: 7 ADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMS 65 E L+ YL+R+F + + + R ++DSVE+ +F+G++ +D + S+ M+ Sbjct: 64 PVERPVLQDYLRRLFETDKLKIVPRAKKTDSVELNRGDDFLGVISADDPKG-RSFTLQMA 122 Query: 66 ILEDDL 71 IL+ DL Sbjct: 123 ILDLDL 128 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 5 MRADEIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E+ KL+ +L+ FG+ GI V ++ D +V + IG++ +D++ + S+ F Sbjct: 1 MDKTELHKLQGFLREAFGNDGIKVAQGKHNPDDADVFFGQKQIGVITVDDEDGDRSFAFA 60 Query: 64 MSI 66 M I Sbjct: 61 MPI 63 >gi|323139805|ref|ZP_08074839.1| hypothetical protein Met49242DRAFT_4227 [Methylocystis sp. ATCC 49242] gi|322394941|gb|EFX97508.1| hypothetical protein Met49242DRAFT_4227 [Methylocystis sp. ATCC 49242] Length = 131 Score = 60.6 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ +L+R FG+ + V + D+ V + I + +D++ + S+ F+ Sbjct: 1 MDKSELRKLQAFLRRSFGNDDVRVTADPKNPDNAAVHLGERKIASISVDDEDGDRSFAFE 60 Query: 64 MSI 66 M I Sbjct: 61 MKI 63 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Query: 13 LERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL 71 L+ YL+++F +++ +R ++DSVE+ + EF+G++ + D + S+ ++IL+ DL Sbjct: 70 LQSYLRKLFENDRLSIVARGRKTDSVELNTDGEFLGVISAD-DAKLSSFTLQIAILDFDL 128 >gi|296446812|ref|ZP_06888750.1| conserved hypothetical protein [Methylosinus trichosporium OB3b] gi|296255687|gb|EFH02776.1| conserved hypothetical protein [Methylosinus trichosporium OB3b] Length = 131 Score = 56.4 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 5 MRADEIKKLERYLKRVFGSG-IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 M E++KL+ +L++ G+ I V D V + I + +D++ + S+ F Sbjct: 1 MDKSELRKLQAFLRQSLGNEEIRVTPDPKNPDDGAVHLGERKIAAISVDDEDGDRSFAFS 60 Query: 64 M 64 M Sbjct: 61 M 61 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Query: 13 LERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL 71 L+ YL+++F + + ++DSVE+ +F+G++ +D + + S+ ++IL+ DL Sbjct: 70 LQSYLRKLFENDKLTLAPHGRKTDSVELNSGEDFLGVISADDAKRQ-SFTLQIAILDFDL 128 >gi|218670636|ref|ZP_03520307.1| hypothetical protein RetlG_02784 [Rhizobium etli GR56] Length = 49 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 20/29 (68%) Query: 5 MRADEIKKLERYLKRVFGSGIAVQSRENQ 33 M+ +EIKKL+ Y KR+F + V++R + Sbjct: 1 MKPEEIKKLDAYFKRMFNPQMIVKARPRK 29 >gi|171742599|ref|ZP_02918406.1| hypothetical protein BIFDEN_01712 [Bifidobacterium dentium ATCC 27678] gi|283456317|ref|YP_003360881.1| hypothetical protein BDP_1457 [Bifidobacterium dentium Bd1] gi|171278213|gb|EDT45874.1| hypothetical protein BIFDEN_01712 [Bifidobacterium dentium ATCC 27678] gi|283102951|gb|ADB10057.1| Conserved hypothetical protein [Bifidobacterium dentium Bd1] Length = 251 Score = 36.7 bits (84), Expect = 0.95, Method: Composition-based stats. Identities = 9/44 (20%), Positives = 24/44 (54%) Query: 21 FGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64 F S +A+ +R + + + + E+I L + + ++ + SY ++ Sbjct: 85 FASALALGARPSTPTAALLYVRGEYIRLAHMSGEDGDASYWLEL 128 >gi|218506774|ref|ZP_03504652.1| hypothetical protein RetlB5_03769 [Rhizobium etli Brasil 5] Length = 97 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 7/16 (43%), Positives = 13/16 (81%) Query: 52 NDDEEEISYHFDMSIL 67 +D++ + SY+F M+IL Sbjct: 41 DDEDGDRSYNFSMAIL 56 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.310 0.159 0.452 Lambda K H 0.267 0.0485 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,447,403,939 Number of Sequences: 13984884 Number of extensions: 55820958 Number of successful extensions: 134846 Number of sequences better than 10.0: 98 Number of HSP's better than 10.0 without gapping: 186 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 134496 Number of HSP's gapped (non-prelim): 202 length of query: 71 length of database: 4,792,584,752 effective HSP length: 43 effective length of query: 28 effective length of database: 4,191,234,740 effective search space: 117354572720 effective search space used: 117354572720 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.0 bits) S2: 76 (33.6 bits)