RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780165|ref|YP_003064578.1| hypothetical protein CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >gnl|CDD|34395 COG4784, COG4784, Putative Zn-dependent protease [General function prediction only]. Length = 479 Score = 25.0 bits (54), Expect = 5.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Query: 12 KLERYLKRVFGSGIAVQSRENQSDSVEVL 40 KLER + R+ G+ AV Q+ + +L Sbjct: 65 KLERMVARIVGALTAVSENPQQTYRITIL 93 >gnl|CDD|37247 KOG2036, KOG2036, KOG2036, Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]. Length = 1011 Score = 24.1 bits (52), Expect = 9.5 Identities = 16/64 (25%), Positives = 27/64 (42%), Gaps = 7/64 (10%) Query: 6 RADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMS 65 R KK+++ +KR N D + ++S I Y + E+ + F M Sbjct: 68 RKKRAKKIKKAIKRG-------TLDPNSEDPFSLFISSTNIRYCYYKESEKILGNTFGMC 120 Query: 66 ILED 69 IL+D Sbjct: 121 ILQD 124 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.135 0.357 Gapped Lambda K H 0.267 0.0731 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 856,667 Number of extensions: 34581 Number of successful extensions: 119 Number of sequences better than 10.0: 1 Number of HSP's gapped: 119 Number of HSP's successfully gapped: 9 Length of query: 71 Length of database: 6,263,737 Length adjustment: 42 Effective length of query: 29 Effective length of database: 5,356,159 Effective search space: 155328611 Effective search space used: 155328611 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.4 bits)