RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780165|ref|YP_003064578.1| hypothetical protein
CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62]
         (71 letters)



>1x99_A Lectin, XCL lectin; fungal lectin, sugar binding protein;
           HET: MSE; 1.40A {Xerocomus chrysenteron} (A:)
          Length = 145

 Score = 26.4 bits (58), Expect = 1.6
 Identities = 8/40 (20%), Positives = 14/40 (35%), Gaps = 6/40 (15%)

Query: 3   VRMRADE--IKKLERYLKRVFGSGIAVQSRENQSDSVEVL 40
             ++ DE  +    +Y    + +G     RE Q     V 
Sbjct: 84  TGLKPDETALVINPQY----YNNGGRDYVREKQLAEYSVT 119


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
          photosynthetic reaction center, peripheral antenna;
          HET: CL1 PQN; 4.44A {Pisum sativum} (F:1-76)
          Length = 76

 Score = 24.7 bits (53), Expect = 4.1
 Identities = 5/10 (50%), Positives = 7/10 (70%)

Query: 9  EIKKLERYLK 18
           +KKL+  LK
Sbjct: 21 ALKKLQASLK 30


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.317    0.135    0.357 

Gapped
Lambda     K      H
   0.267   0.0715    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 552,526
Number of extensions: 19609
Number of successful extensions: 64
Number of sequences better than 10.0: 1
Number of HSP's gapped: 64
Number of HSP's successfully gapped: 7
Length of query: 71
Length of database: 4,956,049
Length adjustment: 38
Effective length of query: 33
Effective length of database: 3,671,459
Effective search space: 121158147
Effective search space used: 121158147
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.1 bits)