BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780165|ref|YP_003064578.1| hypothetical protein CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780165|ref|YP_003064578.1| hypothetical protein CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 141 bits (356), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY Sbjct: 1 MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY 60 Query: 61 HFDMSILEDDL 71 HFDMSILEDDL Sbjct: 61 HFDMSILEDDL 71 >gi|254780332|ref|YP_003064745.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 504 Score = 23.5 bits (49), Expect = 0.64, Method: Compositional matrix adjust. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 12 KLERYLKRVFGSG--IAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63 K + LKRV G I + R + +V + +EF +D + HFD Sbjct: 449 KWQEDLKRVKGIADIIIAKQRHGPTGTVTLAFQAEFTRFSALSDSSYQTGEHFD 502 >gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Score = 20.8 bits (42), Expect = 5.1, Method: Composition-based stats. Identities = 8/21 (38%), Positives = 14/21 (66%) Query: 9 EIKKLERYLKRVFGSGIAVQS 29 EI +LE+Y+ + S I+V + Sbjct: 239 EINRLEKYISKYKESAISVAT 259 >gi|254780451|ref|YP_003064864.1| aconitate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 896 Score = 19.6 bits (39), Expect = 9.4, Method: Composition-based stats. Identities = 6/15 (40%), Positives = 10/15 (66%) Query: 55 EEEISYHFDMSILED 69 E E+SY F +++D Sbjct: 79 ESEVSYRFSRVLMQD 93 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.135 0.357 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,793 Number of Sequences: 1233 Number of extensions: 1376 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 71 length of database: 328,796 effective HSP length: 42 effective length of query: 29 effective length of database: 277,010 effective search space: 8033290 effective search space used: 8033290 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.7 bits) S2: 31 (16.5 bits)