BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780166|ref|YP_003064579.1| hydrolase protein [Candidatus Liberibacter asiaticus str. psy62] (261 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780166|ref|YP_003064579.1| hydrolase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 261 Score = 535 bits (1378), Expect = e-154, Method: Compositional matrix adjust. Identities = 261/261 (100%), Positives = 261/261 (100%) Query: 1 MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60 MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI Sbjct: 1 MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60 Query: 61 AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120 AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP Sbjct: 61 AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120 Query: 121 SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA 180 SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA Sbjct: 121 SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA 180 Query: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLL 240 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLL Sbjct: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLL 240 Query: 241 AVGDKQFKQGVVNFYANELRA 261 AVGDKQFKQGVVNFYANELRA Sbjct: 241 AVGDKQFKQGVVNFYANELRA 261 >gi|254780274|ref|YP_003064687.1| lysophospholipase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 317 Score = 27.3 bits (59), Expect = 0.28, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 20/39 (51%) Query: 93 EHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131 E G + V + GYS+G IA S +L YP + L + Sbjct: 99 EKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALWNL 137 >537021.9.peg.410_1 Length = 952 Score = 25.8 bits (55), Expect = 0.81, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 18/31 (58%) Query: 74 YIENDYRLVFMAADAVSLLEHLGISKVHVMG 104 +++NDY++ + D L +HL I + +G Sbjct: 395 FLKNDYKISVVGNDRFILTDHLAIKDLMALG 425 >537021.9.peg.753_1 Length = 1033 Score = 23.5 bits (49), Expect = 3.5, Method: Compositional matrix adjust. Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 132 GSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFAD 171 G ++Y V+ L+ + L D ++ +GKK ++ D Sbjct: 687 GVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726 >gi|254781022|ref|YP_003065435.1| hypothetical protein CLIBASIA_04620 [Candidatus Liberibacter asiaticus str. psy62] Length = 163 Score = 22.3 bits (46), Expect = 7.6, Method: Compositional matrix adjust. Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 13/69 (18%) Query: 125 SVILGGVGSVLYDSDVVDWQSLID----SFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA 180 SVIL + L +W +++ S LLP ID ++ + K+F+ L Sbjct: 13 SVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKT---------LSL 63 Query: 181 LASCLSMIR 189 L SC+S R Sbjct: 64 LTSCISSHR 72 >gi|254780455|ref|YP_003064868.1| nicotinate phosphoribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 418 Score = 22.3 bits (46), Expect = 8.9, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 15/36 (41%) Query: 4 EVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSV 39 E KF +Q YD+ K +L HGL V Sbjct: 93 EPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDV 128 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.141 0.429 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 174,731 Number of Sequences: 1233 Number of extensions: 7290 Number of successful extensions: 26 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 11 length of query: 261 length of database: 328,796 effective HSP length: 72 effective length of query: 189 effective length of database: 240,020 effective search space: 45363780 effective search space used: 45363780 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 37 (18.9 bits)