BLAST/PSIBLAST alignment of GI: 254780167 and GI: 254689012 at iteration 1
>gi|254689012|ref|ZP_05152266.1| hypothetical protein Babob68_02286 [Brucella abortus bv. 6 str. 870] Length = 84
>gi|256257262|ref|ZP_05462798.1| hypothetical protein Babob9C_07873 [Brucella abortus bv. 9 str. C68] Length = 84
>gi|260754505|ref|ZP_05866853.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] Length = 84
>gi|260883534|ref|ZP_05895148.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] Length = 84
>gi|297248107|ref|ZP_06931825.1| hypothetical protein BAYG_01045 [Brucella abortus bv. 5 str. B3196] Length = 84
>gi|260674613|gb|EEX61434.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] Length = 84
>gi|260873062|gb|EEX80131.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] Length = 84
>gi|297175276|gb|EFH34623.1| hypothetical protein BAYG_01045 [Brucella abortus bv. 5 str. B3196] Length = 84
 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 47/75 (62%), Positives = 61/75 (81%)

Query: 1  MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60
          M DH IPHFQND GH+ I+IGVK+FMC G +PP DHPHV+I+MG+E+E  CPYCSTLY +
Sbjct: 1  MSDHIIPHFQNDAGHNAIEIGVKEFMCVGANPPFDHPHVYIDMGDESEIVCPYCSTLYRY 60

Query: 61 DSSLDSKETLPVGCL 75
          ++ L + ET+P GC+
Sbjct: 61 NAKLHADETIPAGCV 75