RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780167|ref|YP_003064580.1| hypothetical protein
CLIBASIA_00250 [Candidatus Liberibacter asiaticus str. psy62]
         (78 letters)



>gnl|CDD|34098 COG4391, COG4391, Uncharacterized protein conserved in bacteria
          [Function unknown].
          Length = 62

 Score = 75.8 bits (186), Expect = 3e-15
 Identities = 34/61 (55%), Positives = 39/61 (63%)

Query: 1  MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60
          M    IPHFQND GH  I+IG    MC G  PP DHP VF++MG+E E  CPYCST Y  
Sbjct: 1  MAGMIIPHFQNDGGHETIEIGDLPLMCPGPEPPNDHPRVFLDMGDEGEVVCPYCSTRYRL 60

Query: 61 D 61
          +
Sbjct: 61 N 61


>gnl|CDD|38666 KOG3456, KOG3456, KOG3456, NADH:ubiquinone oxidoreductase,
           NDUFS6/13 kDa subunit [Energy production and
           conversion].
          Length = 120

 Score = 33.9 bits (77), Expect = 0.009
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 27  CAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFD 61
           C G +P L HP V+IN+ +     C YC   +  D
Sbjct: 83  CDGGTPALGHPKVYINLDKPGPHICGYCGLRFVQD 117


>gnl|CDD|31472 COG1281, COG1281, Disulfide bond chaperones of the HSP33 family
           [Posttranslational modification, protein turnover,
           chaperones].
          Length = 286

 Score = 30.2 bits (68), Expect = 0.12
 Identities = 9/24 (37%), Positives = 11/24 (45%), Gaps = 3/24 (12%)

Query: 43  MGEENEK---HCPYCSTLYHFDSS 63
           M EE+      C +C T Y FD  
Sbjct: 258 MLEEDGGIEVTCEFCGTKYLFDEE 281


>gnl|CDD|144868 pfam01430, HSP33, Hsp33 protein.  Hsp33 is a molecular chaperone,
           distinguished from all other known chaperones by its
           mode of functional regulation. Its activity is redox
           regulated. Hsp33 is a cytoplasmically localized protein
           with highly reactive cysteines that respond quickly to
           changes in the redox environment. Oxidising conditions
           like H2O2 cause disulfide bonds to form in Hsp33, a
           process that leads to the activation of its chaperone
           function.
          Length = 274

 Score = 28.3 bits (64), Expect = 0.48
 Identities = 9/22 (40%), Positives = 11/22 (50%), Gaps = 3/22 (13%)

Query: 43  MGEENEK---HCPYCSTLYHFD 61
           M EE+ K    C +C   Y FD
Sbjct: 252 MIEEDGKIEVTCEFCGKKYRFD 273


>gnl|CDD|29605 cd00498, Hsp33, Heat shock protein 33 (Hsp33):  Cytosolic protein
           that acts as a molecular chaperone under oxidative
           conditions.  In normal (reducing) cytosolic conditions,
           four conserved Cys residues are coordinated by a Zn ion.
            Under oxidative stress (such as heat shock), the Cys
           are reversibly oxidized to disulfide bonds, which causes
           the chaperone activity to be turned on.  Hsp33 is
           homodimeric in its functional form..
          Length = 275

 Score = 27.1 bits (60), Expect = 1.2
 Identities = 8/21 (38%), Positives = 9/21 (42%)

Query: 41  INMGEENEKHCPYCSTLYHFD 61
           I      E  C +C   YHFD
Sbjct: 255 IEEDGGIEVTCEFCGEKYHFD 275


>gnl|CDD|30564 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal
           structure and biogenesis].
          Length = 464

 Score = 24.4 bits (53), Expect = 7.5
 Identities = 9/24 (37%), Positives = 11/24 (45%)

Query: 2   VDHPIPHFQNDRGHSRIKIGVKKF 25
            D   PH +N+   S    GVK F
Sbjct: 229 SDLIFPHHENEIAQSEAATGVKPF 252


>gnl|CDD|145637 pfam02598, DUF171, Uncharacterized ACR, COG2106. 
          Length = 283

 Score = 24.2 bits (53), Expect = 8.9
 Identities = 11/26 (42%), Positives = 11/26 (42%)

Query: 23  KKFMCAGTSPPLDHPHVFINMGEENE 48
                AG  PPLD PH      EE E
Sbjct: 88  PYLKYAGLLPPLDAPHHMSRSPEEGE 113


>gnl|CDD|146710 pfam04216, FdhE, Protein involved in formate dehydrogenase
           formation.  The function of these proteins is unknown.
           They may possibly be involved in the formation of
           formate dehydrogenase.
          Length = 287

 Score = 23.9 bits (52), Expect = 9.5
 Identities = 6/11 (54%), Positives = 7/11 (63%)

Query: 50  HCPYCSTLYHF 60
           HC  C T +HF
Sbjct: 197 HCSLCETEWHF 207


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.322    0.140    0.461 

Gapped
Lambda     K      H
   0.267   0.0702    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 1,011,097
Number of extensions: 42418
Number of successful extensions: 102
Number of sequences better than 10.0: 1
Number of HSP's gapped: 102
Number of HSP's successfully gapped: 10
Length of query: 78
Length of database: 6,263,737
Length adjustment: 48
Effective length of query: 30
Effective length of database: 5,226,505
Effective search space: 156795150
Effective search space used: 156795150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (23.5 bits)