RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780167|ref|YP_003064580.1| hypothetical protein
CLIBASIA_00250 [Candidatus Liberibacter asiaticus str. psy62]
         (78 letters)



>d1xjha_ g.81.1.1 (A:) HSP33, C-terminal domain {Escherichia coli
          [TaxId: 562]}
          Length = 62

 Score = 25.4 bits (56), Expect = 1.3
 Identities = 7/23 (30%), Positives = 12/23 (52%), Gaps = 3/23 (13%)

Query: 42 NMGEENEK---HCPYCSTLYHFD 61
          ++  E+ +   HC YC   Y F+
Sbjct: 28 SILAEDGEIDMHCDYCGNHYLFN 50


>d1vzya2 g.81.1.1 (A:234-290) HSP33, C-terminal domain {Bacillus
          subtilis [TaxId: 1423]}
          Length = 57

 Score = 23.9 bits (52), Expect = 3.6
 Identities = 7/22 (31%), Positives = 11/22 (50%), Gaps = 3/22 (13%)

Query: 43 MGEENEK---HCPYCSTLYHFD 61
          M EE+ +    C +C+  Y F 
Sbjct: 24 MIEEDGQAEAVCHFCNEKYLFT 45


>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas
           aeruginosa [TaxId: 287]}
          Length = 290

 Score = 23.7 bits (51), Expect = 4.2
 Identities = 3/11 (27%), Positives = 6/11 (54%)

Query: 50  HCPYCSTLYHF 60
            C  C+  +H+
Sbjct: 192 SCSLCACEWHY 202


>d1dfma_ c.52.1.5 (A:) Restriction endonuclease BglII {Bacillus
           subtilis [TaxId: 1423]}
          Length = 223

 Score = 22.9 bits (49), Expect = 7.9
 Identities = 7/30 (23%), Positives = 10/30 (33%)

Query: 29  GTSPPLDHPHVFINMGEENEKHCPYCSTLY 58
                 D P   + + E+ E      ST Y
Sbjct: 156 AEYNVFDVPIRLVGLIEDFETDIDIVSTTY 185


>d1vq0a2 g.81.1.1 (A:231-287) HSP33, C-terminal domain {Thermotoga
          maritima [TaxId: 2336]}
          Length = 57

 Score = 22.7 bits (49), Expect = 9.8
 Identities = 6/14 (42%), Positives = 8/14 (57%)

Query: 48 EKHCPYCSTLYHFD 61
          E  C +C+T Y F 
Sbjct: 30 EVVCKWCNTRYVFS 43


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.322    0.140    0.461 

Gapped
Lambda     K      H
   0.267   0.0601    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 304,320
Number of extensions: 11865
Number of successful extensions: 32
Number of sequences better than 10.0: 1
Number of HSP's gapped: 32
Number of HSP's successfully gapped: 9
Length of query: 78
Length of database: 2,407,596
Length adjustment: 45
Effective length of query: 33
Effective length of database: 1,789,746
Effective search space: 59061618
Effective search space used: 59061618
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.2 bits)