Query gi|254780169|ref|YP_003064582.1| hypothetical protein CLIBASIA_00260 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 54 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 23 01:42:22 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780169.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 COG4821 Uncharacterized protei 68.5 3.9 9.8E-05 22.2 2.3 37 5-42 195-240 (243) 2 PRK02947 hypothetical protein; 53.5 16 0.00041 19.0 3.3 39 5-44 198-245 (247) 3 TIGR01229 rocF_arginase argina 37.5 26 0.00067 18.0 2.3 32 6-37 232-265 (337) 4 pfam10835 DUF2573 Protein of u 26.3 42 0.0011 16.9 1.8 13 30-42 7-19 (82) 5 TIGR01849 PHB_depoly_PhaZ poly 25.4 19 0.00049 18.6 -0.1 34 14-47 254-287 (414) 6 PRK08491 NADH dehydrogenase su 20.2 92 0.0024 15.1 2.6 27 27-54 29-55 (263) 7 pfam09711 Cas_Csn2 CRISPR-asso 19.7 79 0.002 15.5 2.1 30 16-45 96-125 (188) 8 PRK10198 formate hydrogenlyase 17.4 1.1E+02 0.0027 14.8 3.2 17 32-48 113-129 (153) 9 TIGR01230 agmatinase agmatinas 14.1 68 0.0017 15.8 0.7 19 16-34 211-229 (296) 10 pfam08490 DUF1744 Domain of un 13.1 1.4E+02 0.0036 14.2 2.1 27 4-30 314-340 (396) No 1 >COG4821 Uncharacterized protein containing SIS (Sugar ISomerase) phosphosugar binding domain [General function prediction only] Probab=68.52 E-value=3.9 Score=22.24 Aligned_cols=37 Identities=46% Similarity=0.789 Sum_probs=25.7 Q ss_pred HHHHHHHHHH--HHHCCCCCCEEEEEEEHHH-------HHHHHHHHH Q ss_conf 8899976027--7740233470377851547-------999999999 Q gi|254780169|r 5 LMKKIFVENK--KVFKGFKAQPLFLSFNIDG-------LFEKYLEII 42 (54) Q Consensus 5 lmkkifvenk--kvfkgfkaqplflsfnidg-------lfekyleii 42 (54) +...+|+|.- -|-+||. .|.|+|-|||| |++||-+-| T Consensus 195 ilqa~faeai~~mv~~g~~-pPvf~S~Nidgad~~N~~l~dky~~ri 240 (243) T COG4821 195 ILQATFAEAIELMVEKGYT-PPVFLSANIDGADEYNQALVDKYADRI 240 (243) T ss_pred HHHHHHHHHHHHHHHCCCC-CCEEEECCCCCHHHHHHHHHHHHHHHC T ss_conf 9999999999999857999-984664578871578899999987543 No 2 >PRK02947 hypothetical protein; Provisional Probab=53.49 E-value=16 Score=19.05 Aligned_cols=39 Identities=49% Similarity=0.802 Sum_probs=24.8 Q ss_pred HHHHHHHHHHH--HHCCCCCCEEEEEEEHHH-------HHHHHHHHHHH Q ss_conf 88999760277--740233470377851547-------99999999999 Q gi|254780169|r 5 LMKKIFVENKK--VFKGFKAQPLFLSFNIDG-------LFEKYLEIIQQ 44 (54) Q Consensus 5 lmkkifvenkk--vfkgfkaqplflsfnidg-------lfekyleiiqq 44 (54) ++.-+++|--+ +-+|+.. |.|.|-|+|| |++||-+-|.. T Consensus 198 i~n~i~~e~~~~L~~~G~~p-Pv~~S~N~~ggde~N~~l~~~Y~~ri~~ 245 (247) T PRK02947 198 ILNAIFAEAAEELVERGIDP-PVFLSANIDGGDEHNRALVEKYRERIPH 245 (247) T ss_pred HHHHHHHHHHHHHHHCCCCC-CEEECCCCCCCHHHHHHHHHHHHHHHHC T ss_conf 99999999999999779999-8676278888389999999999875350 No 3 >TIGR01229 rocF_arginase arginase; InterPro: IPR014033 L-Arginine is converted to nitric oxide and citrulline by the enzyme nitric oxide synthase and by the enzyme arginase as a part of the hepatic urea cycle. Arginase is a manganese metalloenzyme containing a metal-activated hydroxide ion, a critical nucleophile in metalloenzymes that catalyze hydrolysis or hydration reactions. A hydrogen bond formed by the metal-bound hydroxide holds the enzyme in the proper orientation for catalysis however non-metal substrate-binding sites are also implicated in the enzyme mechanism. Regeneration of metal-bound hydroxide ion from a metal-bound water molecule requires proton transfer to bulk solvent mediated by a histidine proton shuttle residue. . Probab=37.53 E-value=26 Score=17.95 Aligned_cols=32 Identities=28% Similarity=0.476 Sum_probs=22.9 Q ss_pred HHHHHHHHHHHHCCCC--CCEEEEEEEHHHHHHH Q ss_conf 8999760277740233--4703778515479999 Q gi|254780169|r 6 MKKIFVENKKVFKGFK--AQPLFLSFNIDGLFEK 37 (54) Q Consensus 6 mkkifvenkkvfkgfk--aqplflsfnidglfek 37 (54) |.++.-+.++-.++-+ ..|++|||.+|+|=-+ T Consensus 232 i~~V~e~tl~~l~a~dg~~~pihlSlDvD~lDP~ 265 (337) T TIGR01229 232 IGKVVEETLEYLKAEDGLKRPIHLSLDVDGLDPS 265 (337) T ss_pred HHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCC T ss_conf 8999999998603232798656888412354767 No 4 >pfam10835 DUF2573 Protein of unknown function (DUF2573). Some members in this bacterial family of proteins are annotated as YusU however no function is currently known. This family of proteins appears to be restricted to Bacillus spp. Probab=26.32 E-value=42 Score=16.88 Aligned_cols=13 Identities=54% Similarity=1.109 Sum_probs=10.6 Q ss_pred EHHHHHHHHHHHH Q ss_conf 1547999999999 Q gi|254780169|r 30 NIDGLFEKYLEII 42 (54) Q Consensus 30 nidglfekyleii 42 (54) .+|||.|||-|.. T Consensus 7 qldgL~eKytELL 19 (82) T pfam10835 7 QLDGLLEKYTELL 19 (82) T ss_pred HHHHHHHHHHHHH T ss_conf 9999999999998 No 5 >TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular; InterPro: IPR010915 This entry represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting.. Probab=25.37 E-value=19 Score=18.63 Aligned_cols=34 Identities=26% Similarity=0.487 Sum_probs=30.2 Q ss_pred HHHHCCCCCCEEEEEEEHHHHHHHHHHHHHHHHH Q ss_conf 7774023347037785154799999999999999 Q gi|254780169|r 14 KKVFKGFKAQPLFLSFNIDGLFEKYLEIIQQLLS 47 (54) Q Consensus 14 kkvfkgfkaqplflsfnidglfekyleiiqqlls 47 (54) .+|+-||---.=|+|.|.|--.+-..|.++.|++ T Consensus 254 R~VYPGFlQLagF~SmN~dRH~~aH~~~~~~Lvk 287 (414) T TIGR01849 254 RKVYPGFLQLAGFISMNLDRHVKAHKDFFAHLVK 287 (414) T ss_pred CCCCCHHHHHHHHHHHCHHHHHHHHHHHHHHHHC T ss_conf 5437138888868840656679999999998623 No 6 >PRK08491 NADH dehydrogenase subunit C; Provisional Probab=20.23 E-value=92 Score=15.14 Aligned_cols=27 Identities=26% Similarity=0.524 Sum_probs=23.1 Q ss_pred EEEEHHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 7851547999999999999999997509 Q gi|254780169|r 27 LSFNIDGLFEKYLEIIQQLLSVIASYVE 54 (54) Q Consensus 27 lsfnidglfekyleiiqqllsviasyve 54 (54) ++.+ |+.|+.-++.+++-..+..||+| T Consensus 29 ~~v~-~~~f~~d~~~L~~~~~i~~syie 55 (263) T PRK08491 29 SYVE-GSVFEDDLNVLKTKVEILDSYVE 55 (263) T ss_pred CCCC-CHHHHHHHHHHHHHHHHHHHHHC T ss_conf 5454-13679999997423668887741 No 7 >pfam09711 Cas_Csn2 CRISPR-associated protein (Cas_Csn2). CRISPR loci appear to be mobile elements with a wide host range. This entry represents proteins found only in CRISPR-containing species, near other CRISPR-associated proteins (cas). The species range so far for these proteins is pathogenic bacteria only. Clusters of short DNA repeats with nonhomologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). Probab=19.69 E-value=79 Score=15.47 Aligned_cols=30 Identities=30% Similarity=0.410 Sum_probs=22.3 Q ss_pred HHCCCCCCEEEEEEEHHHHHHHHHHHHHHH Q ss_conf 740233470377851547999999999999 Q gi|254780169|r 16 VFKGFKAQPLFLSFNIDGLFEKYLEIIQQL 45 (54) Q Consensus 16 vfkgfkaqplflsfnidglfekyleiiqql 45 (54) +..-|||-.+-.+-.-|.+|||-+||.|-. T Consensus 96 ilel~KAlgvKIetksdtifek~~eilqv~ 125 (188) T pfam09711 96 ILELIKALGVKIETQSDTIFEKCFEILQVY 125 (188) T ss_pred HHHHHHHHCEEEEECCHHHHHHHHHHHHHH T ss_conf 999999856277533237999999999999 No 8 >PRK10198 formate hydrogenlyase regulatory protein HycA; Provisional Probab=17.44 E-value=1.1e+02 Score=14.79 Aligned_cols=17 Identities=29% Similarity=0.532 Sum_probs=13.0 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 47999999999999999 Q gi|254780169|r 32 DGLFEKYLEIIQQLLSV 48 (54) Q Consensus 32 dglfekyleiiqqllsv 48 (54) ++.+|.||+.|+.+..- T Consensus 113 ~~VleHYL~kI~~vYd~ 129 (153) T PRK10198 113 EQVLEHYLEKIAGVYDS 129 (153) T ss_pred HHHHHHHHHHHHHHHHH T ss_conf 99999999999999999 No 9 >TIGR01230 agmatinase agmatinase, putative; InterPro: IPR005925 Members of this family include known and predicted examples of agmatinase (agmatine ureohydrolase, 3.5.3.11 from EC) and members of archaea, for which no definitive agmatinase sequence has yet been made available. However, archaeal sequences are phylogenetically close to the experimentally verified B. subtilis sequence. One species of Halobacterium has been demonstrated in vitro to produce agmatine from arginine, but no putrescine from ornithine, suggesting that arginine decarboxylase and agmatinase, rather than arginase and ornithine decarboxylase, lead from arginine to polyamine biosynthesis.; GO: 0008783 agmatinase activity, 0006596 polyamine biosynthetic process. Probab=14.13 E-value=68 Score=15.82 Aligned_cols=19 Identities=26% Similarity=0.588 Sum_probs=14.1 Q ss_pred HHCCCCCCEEEEEEEHHHH Q ss_conf 7402334703778515479 Q gi|254780169|r 16 VFKGFKAQPLFLSFNIDGL 34 (54) Q Consensus 16 vfkgfkaqplflsfnidgl 34 (54) +..-.-.||.|+++.||+| T Consensus 211 ~~~~~~d~pvYvTiDiD~l 229 (296) T TIGR01230 211 VLAKVLDKPVYVTIDIDVL 229 (296) T ss_pred HHHHHCCCCEEEEEEECCC T ss_conf 7877658876899740566 No 10 >pfam08490 DUF1744 Domain of unknown function (DUF1744). This domain is found on the epsilon catalytic subunit of DNA polymerase. It is found C terminal to pfam03104 and pfam00136. Probab=13.08 E-value=1.4e+02 Score=14.16 Aligned_cols=27 Identities=37% Similarity=0.581 Sum_probs=22.7 Q ss_pred HHHHHHHHHHHHHHCCCCCCEEEEEEE Q ss_conf 888999760277740233470377851 Q gi|254780169|r 4 PLMKKIFVENKKVFKGFKAQPLFLSFN 30 (54) Q Consensus 4 plmkkifvenkkvfkgfkaqplflsfn 30 (54) -||||.|..----||-+.++-.|-+|| T Consensus 314 ~LmkK~flqLlaEfkrLGs~vVyA~~~ 340 (396) T pfam08490 314 NLMKKAFLQLIAEFRRLGAQVIYADFN 340 (396) T ss_pred HHHHHHHHHHHHHHHHHCCEEEEECCC T ss_conf 999999999999999719889997487 Done!