BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780169|ref|YP_003064582.1| hypothetical protein CLIBASIA_00260 [Candidatus Liberibacter asiaticus str. psy62] (54 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780169|ref|YP_003064582.1| hypothetical protein CLIBASIA_00260 [Candidatus Liberibacter asiaticus str. psy62] Length = 54 Score = 108 bits (270), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 54/54 (100%), Positives = 54/54 (100%) Query: 1 MCTPLMKKIFVENKKVFKGFKAQPLFLSFNIDGLFEKYLEIIQQLLSVIASYVE 54 MCTPLMKKIFVENKKVFKGFKAQPLFLSFNIDGLFEKYLEIIQQLLSVIASYVE Sbjct: 1 MCTPLMKKIFVENKKVFKGFKAQPLFLSFNIDGLFEKYLEIIQQLLSVIASYVE 54 >gi|254781165|ref|YP_003065578.1| pyridoxamine 5'-phosphate oxidase [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 20.8 bits (42), Expect = 4.3, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Query: 3 TPLMKKIFVENKKVFKGFKAQPLFLSFNIDGLFEKYLEI 41 +P K+I +EN K F + L + GL EKY ++ Sbjct: 68 SPKGKEI-LENPKASLCFHWKSLARQLRVRGLVEKYCDL 105 >gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] Length = 789 Score = 20.4 bits (41), Expect = 5.8, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 12 ENKKVFKGFKAQPLFLSFN 30 ++K++ KG K +P F S + Sbjct: 761 KSKRIIKGLKLKPAFESVD 779 >gi|254780755|ref|YP_003065168.1| octaprenyl-diphosphate synthase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 322 Score = 20.0 bits (40), Expect = 7.3, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 25 LFLSFNIDGLFEKYLEIIQQLLSVIAS 51 L LS N+D E YL +I+ +V+ S Sbjct: 148 LSLSKNLDVTEEDYLHVIKSKTAVLFS 174 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.328 0.144 0.409 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,797 Number of Sequences: 1233 Number of extensions: 959 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 54 length of database: 328,796 effective HSP length: 26 effective length of query: 28 effective length of database: 296,738 effective search space: 8308664 effective search space used: 8308664 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 31 (16.5 bits)