HHsearch alignment for GI: 254780170 and conserved domain: COG3221

>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism].
Probab=99.40  E-value=1.2e-11  Score=94.08  Aligned_cols=236  Identities=13%  Similarity=0.092  Sum_probs=141.7

Q ss_pred             CHHHHHHHHHH-HHHHHHHHCCCCCHHHHHHHHCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCCEEE
Q ss_conf             91389999999-99999840124421689998579499987178988306889898801509999999999679822025
Q gi|254780170|r    1 MYKDFFVSILC-LIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQ   79 (342)
Q Consensus         1 M~K~~l~~~l~-l~~~~~~~~aa~a~tLd~Vk~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd~~kVe   79 (342)
T Consensus         1 m~~~~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~~l~~gi~p~e---~~~~~~~~~~pl~~~L~~~l----G---~~V~   70 (299)
T COG3221           1 MKKKKLLLASAAAVLALAGCCGSSESDAPAAEDPKELRVGIVPTE---NPTNLIPAWAPLADYLEKEL----G---IPVE   70 (299)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECCCC---CHHHHHHHHHHHHHHHHHHH----C---CCEE
T ss_conf             942788999999999998632577454322268753599976888---86878876566998988986----9---9543


Q ss_pred             EE-ECCCCCCHHHHHCCCEEEEEECCC-CCCCCHHC-CCCCCCCCCCCCCE-----EEEEECCCCCCCHHHHCCCCEEEE
Q ss_conf             99-814310026774396279981243-25320110-27843532234402-----346302113475364178620343
Q gi|254780170|r   80 YL-PLNAKERFLALQSKQIDILSRNTD-WTLLREIS-LGLAFRPITYFDGQ-----GFIMHKKKGISSVSQLSGASICVQ  151 (342)
Q Consensus        80 ~v-~~~~~~rf~aL~sG~vDil~~~~T-~T~~Rd~~-~~v~Fs~~~~~dgq-----~~lVrk~~~i~s~~dL~G~~I~v~  151 (342)
T Consensus        71 ~~~a~dy~~vieal~~g~~D~A~~~~~a~~~a~~~~~~~e~~~~~~~~dg~~~Y~S~~i~~~ds~i~sl~dlkgk~~af~  150 (299)
T COG3221          71 FFVATDYAAVIEALRAGQVDIAWLGPSAYVEAVDRALAGEPLAQTVQKDGSPGYYSVIIVRADSPIKSLEDLKGKRFAFG  150 (299)
T ss_pred             EEECCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCCCEEEEECCCCCCCEEEEEEEECCCCCCHHHHHCCCEEECC
T ss_conf             57257689999998589610774185778998641245420133212589865178999927997433788269967636


Q ss_pred             ECCCHHHH-H-HHHHHHCC-C----CCCEEEECC-HHHHHHHHHCCCEEEEEECCHHHHHHHHHCCC--CHHHCCCCCCC
Q ss_conf             13426999-9-99998629-9----850787479-89999998739602998250479999983678--00100256444
Q gi|254780170|r  152 AGTTTELT-L-ADYFKAHN-M----KYHPIVFER-VEEIDAAYRAHRCDAYTGDISALYALKLTNDR--PSEHVILPDII  221 (342)
Q Consensus       152 ~GTT~e~~-l-~~~~~~~~-~----~~~~v~~~~-~~~a~~al~~Gr~DA~~~D~s~La~~~~~~~~--p~~~~il~e~i  221 (342)
T Consensus       151 d~~StSG~l~P~~~L~~~g~~d~~~~f~~v~~~G~H~~a~~aV~nG~vDva~~~~~~~~~~~~~~~~~~~~~l~vi~~S~  230 (299)
T COG3221         151 DPDSTSGYLFPLYYLAKEGGIDPDKFFGEVIFSGGHDAAVLAVANGQVDVAAVNSSARGLLKKAAPEGVAEKLRVIWKSP  230 (299)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCHHHHHCEEECCCHHHHHHHHHHCCCCEEEECCHHHHHHHHHHCCCCCHHHCEEEEECC
T ss_conf             99854124768999998438984654226503570799999997488308852288887776404334533426999558


Q ss_pred             CCCCEEEECCCC-CHHHHHHHHHHHH
Q ss_conf             237101000277-7579999887744
Q gi|254780170|r  222 SKSPLAPAIIQG-DTEWYNIVSWTHY  246 (342)
Q Consensus       222 skEPlg~avr~g-D~~w~d~V~W~~~  246 (342)
T Consensus       231 ~iP~~pi~vr~~L~~~~k~kl~~af~  256 (299)
T COG3221         231 LIPNDPIAVRSDLPADLKEKLRDAFL  256 (299)
T ss_pred             CCCCCCEEEECCCCHHHHHHHHHHHH
T ss_conf             98999788837799999999999998