HHsearch alignment for GI: 254780170 and conserved domain: PRK01686

>PRK01686 hisG ATP phosphoribosyltransferase catalytic subunit; Reviewed.
Probab=95.30  E-value=0.059  Score=32.69  Aligned_cols=131  Identities=15%  Similarity=0.093  Sum_probs=83.5

Q ss_pred             EEEEEECCCCCCHHHHHCCCEEEEEECCCCCCCCHHCC----CCCCCCCCCCCCEEEEEECCCCCCCHHHHCCCCEEEEE
Q ss_conf             02599814310026774396279981243253201102----78435322344023463021134753641786203431
Q gi|254780170|r   77 KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISL----GLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQA  152 (342)
Q Consensus        77 kVe~v~~~~~~rf~aL~sG~vDil~~~~T~T~~Rd~~~----~v~Fs~~~~~dgq~~lVrk~~~i~s~~dL~G~~I~v~~  152 (342)
T Consensus        46 ~i~~~~~r~~DIp~~V~~G~~DlGI~G~D~l~E~~~~v~~l~dL~fG~c----~l~vA~p~~--~~~~~~~~~~rIA---  116 (212)
T PRK01686         46 DVRFLLVRATDVPTYVEHGAADLGIVGKDVLMEHGKDLYEPLDLGIGKC----RLSVAVPPG--ASAPDLGARLRVA---  116 (212)
T ss_pred             CEEEEEECHHHHHHHHHCCCCCEEEEEHHHHHCCCCCCEEEECCCCCEE----EEEEEECCC--CCCCCCCCCCEEE---
T ss_conf             9799998768889999779976886158877525899169962686118----999995277--7752004898999---


Q ss_pred             CCCHHHHHHHHHHHCCCCCCEEEECCHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCCCCCCCC
Q ss_conf             342699999999862998507874798999999873960299825047999998367800100256444237
Q gi|254780170|r  153 GTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKS  224 (342)
Q Consensus       153 GTT~e~~l~~~~~~~~~~~~~v~~~~~~~a~~al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~e~iskE  224 (342)
T Consensus       117 -TkYp~it~~yf~~~gi~~~iv~l~GavE--~aP~~G~AD~IvDiv~TG~TLk~-----NgL~~i~~Il~s~  180 (212)
T PRK01686        117 -TKYPNIAREYFAEKGVQVEIIKLYGSVE--LAPLVGLADAIVDLVSTGNTLRA-----NGLVEVEEIMDIS  180 (212)
T ss_pred             -EEHHHHHHHHHHHCCCCEEEEECCCCCC--CCCCCCCCCEEEEEECCHHHHHH-----CCCEEEEEEEEEE
T ss_conf             -8628889999997399614895415223--56778842389998477688998-----7999805888878