HHsearch alignment for GI: 254780170 and conserved domain: PRK10859

>PRK10859 putative transglycosylase; Provisional.
Probab=99.94  E-value=2.1e-24  Score=174.90  Aligned_cols=229  Identities=15%  Similarity=0.146  Sum_probs=173.3

Q ss_pred             HHHHHHHHHHHHHHH--HC---CCCCHHHHHHHHCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCCEE
Q ss_conf             899999999999984--01---2442168999857949998717898830688989880150999999999967982202
Q gi|254780170|r    4 DFFVSILCLIILFFT--SF---STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI   78 (342)
Q Consensus         4 ~~l~~~l~l~~~~~~--~~---aa~a~tLd~Vk~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd~~kV   78 (342)
T Consensus         8 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~I~~rG~LrV~T~~sp--ttYy~~~~~~~GFEYELak~FA~~LG---V~L   82 (507)
T PRK10859          8 YLFIGIVTLLLAAALWPSIPWFGKQENQIAAIQARGELRVSTIHSP--LTYSTINGKPFGLDYELAKQFADYLG---VKL   82 (507)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCEEEEEEECCC--CEEEECCCCCCCHHHHHHHHHHHHCC---CEE
T ss_conf             1289999999999972058889984747999997896899997589--65994199647799999999999809---917


Q ss_pred             EEEEC-CCCCCHHHHHCCCEEEEEECCCCCCCCHHCCCCCCCCCCCCCCEEEEEECCCC-CCCHHHHCCCCEEEEECCCH
Q ss_conf             59981-43100267743962799812432532011027843532234402346302113-47536417862034313426
Q gi|254780170|r   79 QYLPL-NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKG-ISSVSQLSGASICVQAGTTT  156 (342)
Q Consensus        79 e~v~~-~~~~rf~aL~sG~vDil~~~~T~T~~Rd~~~~v~Fs~~~~~dgq~~lVrk~~~-i~s~~dL~G~~I~v~~GTT~  156 (342)
T Consensus        83 ~i~~~~~~~el~~~L~~G~~DiaAAgLt~t~~R--~~~~~~~p~Y~~v~q~LVyr~g~~rP~~l~DL~G~~I~V~~gSsy  160 (507)
T PRK10859         83 KVTVRQNISQLFDDLDNGNADLLAAGLVYNSER--VKNYQPGPTYYSVSQQLVYRVGQYRPRTLGDLTGEQLTVAPGHVV  160 (507)
T ss_pred             EEEECCCHHHHHHHHHCCCCCEEECCCCCCHHH--HHCCCCCCCCCCEEEEEEEECCCCCCCCHHHCCCCEEEECCCCHH
T ss_conf             999749999999998679988895578778536--740435686503003999958998988977837986998179759


Q ss_pred             HHHHHHHHHHCCCCCC--EEEECCHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCCCCCCCCCEEEECCCCC
Q ss_conf             9999999986299850--78747989999998739602998250479999983678001002564442371010002777
Q gi|254780170|r  157 ELTLADYFKAHNMKYH--PIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGD  234 (342)
Q Consensus       157 e~~l~~~~~~~~~~~~--~v~~~~~~~a~~al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~e~iskEPlg~avr~gD  234 (342)
T Consensus       161 ~e~L~~Lk~~~~P~L~w~~~~~~~teeLL~~V~~g~IdyTVaDS~~~~l~qr~~P~L---~vaf~l~~~~~iaWa~~k~~  237 (507)
T PRK10859        161 VNDLQTLKETKFPELSWKVDDKKGSAELLEQVIEGKLDYTIADSVAISLFQRVHPEL---AVALDVTDEQPVTWFSPLDD  237 (507)
T ss_pred             HHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEECCHHHHHHHHHCCCH---HCCCCCCCCCCEEEEECCCC
T ss_conf             999999885348971599558999999999997598776885548899877648440---12245688751378845899


Q ss_pred             HH-HHHHHH
Q ss_conf             57-999988
Q gi|254780170|r  235 TE-WYNIVS  242 (342)
Q Consensus       235 ~~-w~d~V~  242 (342)
T Consensus       238 d~sL~~al~  246 (507)
T PRK10859        238 DNTLSAALL  246 (507)
T ss_pred             CHHHHHHHH
T ss_conf             789999999