HHsearch alignment for GI: 254780170 and conserved domain: PRK12682

>PRK12682 transcriptional regulator CysB-like protein; Reviewed.
Probab=96.44  E-value=0.079  Score=31.90  Aligned_cols=182  Identities=11%  Similarity=0.040  Sum_probs=109.6

Q ss_pred             HCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHCCCEEEEEECCCCCCCCH
Q ss_conf             57949998717898830688989880150999999999967982202599814310026774396279981243253201
Q gi|254780170|r   32 KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLRE  111 (342)
Q Consensus        32 ~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd~~kVe~v~~~~~~rf~aL~sG~vDil~~~~T~T~~Rd  111 (342)
T Consensus        91 ~~G~lrIg~~~~~~~~~lp-----------~~l~~f~~~~--P~v~l~l~~~~~~~~~~~l~~g~~Dl~i~~~~~--~~~  155 (309)
T PRK12682         91 DSGTLTIATTHTQARYVLP-----------RVVAKFRKRY--PKVNLSLHQGSPDEIAQMVISGEADIGIATESL--DDD  155 (309)
T ss_pred             CCCCCCCCCCHHHHHHCCC-----------HHHHHHHHHC--CCCEEEEEECCHHHHHHHHHCCCCCHHHHHCCC--CCC
T ss_conf             7774121243133320386-----------2539999878--983799983782999999976997645650777--789


Q ss_pred             HCCCCCCCCCCCCCCEEEEEECCCC-----CCCHHHHCCCCE-EEEECCCHHHHHHHHHHHCCCCCCEE-EECCHHHHHH
Q ss_conf             1027843532234402346302113-----475364178620-34313426999999998629985078-7479899999
Q gi|254780170|r  112 ISLGLAFRPITYFDGQGFIMHKKKG-----ISSVSQLSGASI-CVQAGTTTELTLADYFKAHNMKYHPI-VFERVEEIDA  184 (342)
Q Consensus       112 ~~~~v~Fs~~~~~dgq~~lVrk~~~-----i~s~~dL~G~~I-~v~~GTT~e~~l~~~~~~~~~~~~~v-~~~~~~~a~~  184 (342)
T Consensus       156 --~~l~~~-~l~~~~~~~v~~~~h~la~~~~i~~~dL~~~p~I~~~~~~~~r~~~~~~~~~~g~~p~~~~~~~~~~~~~~  232 (309)
T PRK12682        156 --PDLVTL-PCYDWTHAVIVPSDHPLAQKERITLEDLAEYPLITYHPGFTGRSAIDKAFAAAGLQPDIVLEAIDSDVIKT  232 (309)
T ss_pred             --CCEEEE-EEECCCEEEEECCCCHHHCCCCCCHHHHCCCCEEEECCCCCHHHHHHHHHHHCCCCCCEEEEECCHHHHHH
T ss_conf             --880899-93315236761699721149999999982899797279986799999999977999626999998999999


Q ss_pred             HHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCC--CCCCCCCCEEEECCCCCHHH
Q ss_conf             987396029982504799999836780010025--64442371010002777579
Q gi|254780170|r  185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVIL--PDIISKSPLAPAIIQGDTEW  237 (342)
Q Consensus       185 al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il--~e~iskEPlg~avr~gD~~w  237 (342)
T Consensus       233 ~v~~G~Gi~~lp~---~~~-~~-~~~-~~Lv~v~~~~~~~~~~~~l~~rk~~~l~  281 (309)
T PRK12682        233 YVRLGLGVGIIAE---MAY-RP-DRD-GDLVALPAGHLFGPNTAWVAVKRGAYLR  281 (309)
T ss_pred             HHHHCCEEEHHHH---HHH-HH-HHC-CCEEEEECCCCCCCCEEEEEEECCCCCC
T ss_conf             9995994242289---983-37-647-9989997988777617999996966118