HHsearch alignment for GI: 254780170 and conserved domain: PRK12683

>PRK12683 transcriptional regulator CysB-like protein; Reviewed.
Probab=97.07  E-value=0.026  Score=34.93  Aligned_cols=180  Identities=12%  Similarity=0.031  Sum_probs=111.0

Q ss_pred             HCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHCCCEEEEEECCCCCCCCH
Q ss_conf             57949998717898830688989880150999999999967982202599814310026774396279981243253201
Q gi|254780170|r   32 KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLRE  111 (342)
Q Consensus        32 ~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd~~kVe~v~~~~~~rf~aL~sG~vDil~~~~T~T~~Rd  111 (342)
T Consensus        91 ~~G~l~Ig~~~~~~~~~l-----------p~~l~~f~~~-~-P~v~i~l~~~~~~~~~~~L~~g~~Dl~i~~~~~~~~--  155 (308)
T PRK12683         91 DSGRLTVATTHTQARYAL-----------PKVVRQFTEV-F-PKVHLALRQGSPQEIAEMLLNGEADIGIATEALDRE--  155 (308)
T ss_pred             CCCEEEECCCCHHHHHCC-----------CHHHHHHHHH-C-CCCEEEEEECCHHHHHHHHHCCCCCEEECCCCCCCC--
T ss_conf             776242001320112016-----------8466899987-8-996699960786999999977997788066677888--


Q ss_pred             HCCCCCCCCCCCCCCEEEEEECCCC-----CCCHHHHCCCC-EEEEECCCHHHHHHHHHHHCCCCCCEE-EECCHHHHHH
Q ss_conf             1027843532234402346302113-----47536417862-034313426999999998629985078-7479899999
Q gi|254780170|r  112 ISLGLAFRPITYFDGQGFIMHKKKG-----ISSVSQLSGAS-ICVQAGTTTELTLADYFKAHNMKYHPI-VFERVEEIDA  184 (342)
Q Consensus       112 ~~~~v~Fs~~~~~dgq~~lVrk~~~-----i~s~~dL~G~~-I~v~~GTT~e~~l~~~~~~~~~~~~~v-~~~~~~~a~~  184 (342)
T Consensus       156 --~~l~~~-~l~~~~~~lv~~~~hpla~~~~v~l~dl~~~p~I~~~~~~~~r~~i~~~~~~~g~~p~~~~e~~~~~~i~~  232 (308)
T PRK12683        156 --PDLVSF-PYYSWHHVVVVPKGHPLTGRENLTLEALAEYPIITYDQGFTGRSHIDQAFAEAGAVPDIVLTALDADVIKT  232 (308)
T ss_pred             --CCCEEE-EECCCCEEEEECCCCCCCCCCCCCHHHHCCCCEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCHHHHHH
T ss_conf             --771687-61245158984699953369999999985999896189982999999999977999857999998999999


Q ss_pred             HHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCC--CCCCCCCCEEEECCCCCH
Q ss_conf             987396029982504799999836780010025--644423710100027775
Q gi|254780170|r  185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVIL--PDIISKSPLAPAIIQGDT  235 (342)
Q Consensus       185 al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il--~e~iskEPlg~avr~gD~  235 (342)
T Consensus       233 ~V~~g~Gi~ilp~---~~~~~--~~~~~-lv~l~~~~~~~~~~~~i~~rk~~~  279 (308)
T PRK12683        233 YVELGMGVGIVAA---MAYDP--QRDTG-LVALDTQHLFEANTTRVALRRGAY  279 (308)
T ss_pred             HHHHCCCHHHHHH---HHHHH--HHCCC-EEEEECCCCCCCCEEEEEECCCCC
T ss_conf             9997984707899---99878--86099-799989788766179999909685