HHsearch alignment for GI: 254780170 and conserved domain: TIGR02122

>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family; InterPro: IPR011852 This family is one of at least three major families of extracytoplasmic solute receptor (ESR) for TRAP (Tripartite ATP-independent Periplasmic Transporter) transporters. The others are the DctP (IPR004682 from INTERPRO) and SmoM (IPR004682 from INTERPRO) families. These transporters are secondary (driven by an ion gradient) but composed of three polypeptides, although in some species the 4-TM and 12-TM integral membrane proteins are fused. Substrates for this transporter family are not fully characterised but, besides C4 dicarboxylates, may include mannitol and other compounds ..
Probab=94.34  E-value=0.14  Score=30.37  Aligned_cols=184  Identities=18%  Similarity=0.175  Sum_probs=97.0

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             91389999999999998401244216899985794999871789883068898988015099999999996798220259
Q gi|254780170|r    1 MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY   80 (342)
Q Consensus         1 M~K~~l~~~l~l~~~~~~~~aa~a~tLd~Vk~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd~~kVe~   80 (342)
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~---------~g~~~~~~~~~~~~~~~~~~~-~~~~~~   61 (319)
T TIGR02122         1 MKKRLALLGAALLIVGAAAAAA---------EPTFVTIGTGGT---------GGVYYPIGGAIAQLINKALGK-VLRVSA   61 (319)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCC---------CCCEEEEECCCC---------CCCCCCCHHHHHHHHHHCCCC-CCEEEE
T ss_conf             9203566776766554443101---------332045521565---------554332013455554210132-202232


Q ss_pred             EE-CCCCCCHHHHHCCCEEEEEECCCCCCCC----------HHCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHCCCCEE
Q ss_conf             98-1431002677439627998124325320----------110278435322344023463021134753641786203
Q gi|254780170|r   81 LP-LNAKERFLALQSKQIDILSRNTDWTLLR----------EISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC  149 (342)
Q Consensus        81 v~-~~~~~rf~aL~sG~vDil~~~~T~T~~R----------d~~~~v~Fs~~~~~dgq~~lVrk~~~i~s~~dL~G~~I~  149 (342)
T Consensus        62 ~~~~~s~~n~~~~~~~~~~~~~~~~~~~~~a~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dl~gk~~~  141 (319)
T TIGR02122        62 QSTGGSVENVNLLEAGEAELAIVQSDVAYYAYEGIGEFEFKGPVEKLRALASLYPEYIQIVVRKDSGIKTVADLKGKRVA  141 (319)
T ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHCCCCCCCCEEEEECCCCCCCHHHHCCCEEC
T ss_conf             11454112333333213455554433344432101110012333200000012454210232011343101220353000


Q ss_pred             EEE-CCCHHHHHHHHHHHCCCCC---CEEEECCHHHHHHHHHCCCEEEEEECCHHHHH
Q ss_conf             431-3426999999998629985---07874798999999873960299825047999
Q gi|254780170|r  150 VQA-GTTTELTLADYFKAHNMKY---HPIVFERVEEIDAAYRAHRCDAYTGDISALYA  203 (342)
Q Consensus       150 v~~-GTT~e~~l~~~~~~~~~~~---~~v~~~~~~~a~~al~~Gr~DA~~~D~s~La~  203 (342)
T Consensus       142 ~~~~~sg~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~g~~~~  199 (319)
T TIGR02122       142 VGAPGSGTELNARAVLKAAGLTYDDIKEAEYLGYAEAADALKDGKIDAAFITAGLPTA  199 (319)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHCCCCCCHHHHHCCCCCEEEECCCCCCC
T ss_conf             2466643013477887650465112001110231000134320231000101344431