HHsearch results for GI: 254780170 and protein with PDBid: 1xt8_A

>1xt8_A Putative amino-acid transporter periplasmic solute-binding protein; ABC transport, cysteine uptake, spine, structural genomics; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1
Probab=100.00  E-value=8.1e-43  Score=290.17  Aligned_cols=246  Identities=22%  Similarity=0.299  Sum_probs=208.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHCC----------CCCHHHHHHHHCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHH
Q ss_conf             913899999999999984012----------4421689998579499987178988306889898801509999999999
Q gi|254780170|r    1 MYKDFFVSILCLIILFFTSFS----------TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSA   70 (342)
Q Consensus         1 M~K~~l~~~l~l~~~~~~~~a----------a~a~tLd~Vk~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaa   70 (342)
                      ||..+-.++++++++++.++.          ..+++|++|+++|+|+||+..++|||+|.|++|+++||++|++++||++
T Consensus         1 ~k~~~~~~~~~l~l~~~~~~~a~~~~~~~~~~~~~~l~~i~~~g~l~Vgv~~~~pP~~~~d~~G~~~G~~~Dl~~~ia~~   80 (292)
T 1xt8_A            1 MKYLLPTAAAGLLLLAAQPAMAMASGGNSDSKTLNSLDKIKQNGVVRIGVFGDKPPFGYVDEKGNNQGYDIALAKRIAKE   80 (292)
T ss_dssp             ---------------------------------CCHHHHHHHHSSEEEEECSEETTTEEECTTSCEESHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCCEEEEEECCCCCCCEEECCCCCEEEHHHHHHHHHHHH
T ss_conf             94189999999999999999997257876666557199986099899998589899069999998873068999999998


Q ss_pred             HCCCCCEEEEEECCCCCCHHHHHCCCEEEEEECCCCCCCCHHCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHCCCCEEE
Q ss_conf             67982202599814310026774396279981243253201102784353223440234630211347536417862034
Q gi|254780170|r   71 IFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICV  150 (342)
Q Consensus        71 l~gd~~kVe~v~~~~~~rf~aL~sG~vDil~~~~T~T~~Rd~~~~v~Fs~~~~~dgq~~lVrk~~~i~s~~dL~G~~I~v  150 (342)
                      ++++..+|+|++++|.+++.+|.+|++|+.++++++|++|+.  .++|+.|||.+++.+++++++++++++||+|++|||
T Consensus        81 Lg~~~~~v~~~~~~~~~~~~~l~~g~~d~~~~~~~~t~~R~~--~~~fs~py~~~~~~~~~~~~~~i~~~~dL~g~~V~v  158 (292)
T 1xt8_A           81 LFGDENKVQFVLVEAANRVEFLKSNKVDIILANFTQTPQRAE--QVDFCSPYMKVALGVAVPKDSNITSVEDLKDKTLLL  158 (292)
T ss_dssp             HHSCTTCEEEEECCGGGHHHHHHTTSCSEECSSCBCCHHHHT--TEEECCCCEEEEEEEEEETTCCCCSSGGGTTSEEEE
T ss_pred             HCCCCCEEEEEECCHHHHHHHHHCCCCCCCCCCCCCCCCHHC--CCCCCCCEEECCCEEEEECCCCCCCHHHHHHCEEEE
T ss_conf             558971799996347868999986997711355656711210--246675347415137872245767477770066775


Q ss_pred             EECCCHHHHHHHHHHHCCCCCCEEEECCHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCCCCCCCCCEEEEC
Q ss_conf             31342699999999862998507874798999999873960299825047999998367800100256444237101000
Q gi|254780170|r  151 QAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAI  230 (342)
Q Consensus       151 ~~GTT~e~~l~~~~~~~~~~~~~v~~~~~~~a~~al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~e~iskEPlg~av  230 (342)
                      +.|++.+..+    .++..+++++.|++.++++++|.+|+||+++.|.+.+......  +|+...+.++.++++|++++|
T Consensus       159 ~~g~~~~~~l----~~~~~~~~~v~~~~~~~~~~~l~~G~vDa~~~d~~~~~~~~~~--~~~~~~~~~~~~~~~~~~iav  232 (292)
T 1xt8_A          159 NKGTTADAYF----TQNYPNIKTLKYDQNTETFAALMDKRGDALSHDNTLLFAWVKD--HPDFKMGIKELGNKDVIAPAV  232 (292)
T ss_dssp             ETTSHHHHHH----HHHCTTSEEEEESSHHHHHHHHHTTSSSEEEEEHHHHHHHHHH--CTTEEEEEEEEEEEEEECCEE
T ss_pred             ECCCHHHHHH----HHHHHHHHHEEECCCCCHHHHHHCCCEEEEEECHHHHHHHHHH--CCCCEEECCCCCCCCEEEEEE
T ss_conf             1585899999----9710000000000222011244369369999569999999997--899789414678773399999


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             277757999988774433112123
Q gi|254780170|r  231 IQGDTEWYNIVSWTHYAMVTAEEL  254 (342)
Q Consensus       231 r~gD~~w~d~V~W~~~ali~Aee~  254 (342)
                      |++|++|.+.++..+..|.+-.++
T Consensus       233 ~k~~~~L~~~ln~~l~~l~~~G~~  256 (292)
T 1xt8_A          233 KKGDKELKEFIDNLIIKLGQEQFF  256 (292)
T ss_dssp             ETTCHHHHHHHHHHHHHHHTTTHH
T ss_pred             ECCCHHHHHHHHHHHHHHHHCCHH
T ss_conf             799999999999999999977869