HHsearch results for GI: 254780170 and protein with PDBid: 2pfy_A

>2pfy_A Putative exported protein; extracytoplasmic solute receptor, tripartite ATP independent periplasmic transport, pyroglutamic acid; 1.95A {Bordetella pertussis tohama I}
Probab=97.50  E-value=0.00063  Score=43.81  Aligned_cols=156  Identities=11%  Similarity=-0.036  Sum_probs=97.3

Q ss_pred             HHHHHHHHHHHCCCCCEEEEEEC----CCCCCHHHHHCCCEEEEEECCCCCCCCHHCCCCCCCCCCCCC-----------
Q ss_conf             99999999996798220259981----431002677439627998124325320110278435322344-----------
Q gi|254780170|r   61 VDFCRALSSAIFDDPSKIQYLPL----NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD-----------  125 (342)
Q Consensus        61 VDl~raiAaal~gd~~kVe~v~~----~~~~rf~aL~sG~vDil~~~~T~T~~Rd~~~~v~Fs~~~~~d-----------  125 (342)
                      -.+++.|.++..|+ .+|++.+.    ...+.+.+|++|.+|+.....+....+.-...+ |..|++++           
T Consensus        21 ~~fa~~V~~~t~G~-v~i~~~~~g~L~~~~e~~~~v~~G~vd~~~~~~~~~~~~~P~~~~-~~lP~l~~~~~~~~~~~~~   98 (301)
T 2pfy_A           21 RQFADEVKAATAGA-LEIKVQSNSTLLKRPEVKRGVQQGVVQIGEVLVSALGNEDPLFEI-DSVPFLASSFNESEKLWKA   98 (301)
T ss_dssp             HHHHHHHHHHTTTS-EEEEEECTTSSSCGGGHHHHHHHTSSSEEEEEGGGGTTTCGGGGG-GGSTTTSCSHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCE-EEEEEECCCCCCCHHHHHHHHHCCCCCCCEECHHHHHCCCCCHHC-CCCCCCCCCHHHHHHHHHH
T ss_conf             99999999875990-899995687658879999999769877522104665224730102-5676354779999987744


Q ss_pred             ----------------------CEEEEEECCCCCCCHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEEECCHHHHH
Q ss_conf             ----------------------0234630211347536417862034313426999999998629985078747989999
Q gi|254780170|r  126 ----------------------GQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID  183 (342)
Q Consensus       126 ----------------------gq~~lVrk~~~i~s~~dL~G~~I~v~~GTT~e~~l~~~~~~~~~~~~~v~~~~~~~a~  183 (342)
                                            +...+. .+..|.+++||+|+||-+. |+..    .++++.-|  +.++..+ ..|.+
T Consensus        99 ~~~~~~~~~~~~g~~~l~~~~~~~~~~~-~~~pi~s~~DlkG~kiR~~-~~~~----~~~~~~lG--a~pv~~~-~~evy  169 (301)
T 2pfy_A           99 TRPLLAQRLDKQGIVLVYGSPWPPQGIY-TKKPVAALADLKGTRFRAY-SAST----SHMAALMG--AVPTTVQ-TPEVP  169 (301)
T ss_dssp             HHHHHHHHHHTTTEEEEEEEECCCCEEE-ESSCCSSGGGGTTCEEEEC-SHHH----HHHHHHTT--SEEEECC-GGGHH
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCEEE-ECCCCCCHHHHCCCEEECC-CHHH----HHHHHHCC--CCCCCCC-CCCHH
T ss_conf             4689999997359079775167761367-5799899689769867347-4569----99999758--8510244-42014


Q ss_pred             HHHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCCCCCCCCCEEEEC
Q ss_conf             99873960299825047999998367800100256444237101000
Q gi|254780170|r  184 AAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAI  230 (342)
Q Consensus       184 ~al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~e~iskEPlg~av  230 (342)
                      .+|++|.+|+..+..+.+...+..  .-.+|.+.. .....+..+++
T Consensus       170 ~aLq~G~vDg~~~~~~~~~~~~~~--ev~~~~~~~-~~~~~~~~~~~  213 (301)
T 2pfy_A          170 QAFSTGVIDAMLTSPATGVDSQAW--DYVKYYYDA-QAFIPQSFVIA  213 (301)
T ss_dssp             HHHHTTSCSBEEECHHHHHHTTGG--GTCCEEEEC-CCCCCEEEEEE
T ss_pred             HHHHCCCEECCCCCCCCCCCCCCC--EEEEEEECC-CCCHHHHHHHH
T ss_conf             677658410342473000123342--144577338-85204889998