HHsearch results for GI: 254780170 and protein with PDBid: 2vd3_A

>2vd3_A ATP phosphoribosyltransferase; metal-binding, glycosyltransferase, HISG, cytoplasm, histidine, magnesium; HET: HIS; 2.45A {Methanobacterium thermoautotrophicum}
Probab=96.47  E-value=0.0046  Score=38.36  Aligned_cols=182  Identities=15%  Similarity=0.096  Sum_probs=110.8

Q ss_pred             EEEEEECCCCCCHHHHHCCCEEEEEECCCCCCCCHHC----CCCCCCCCCCCCCEEEEEECCCCCCCHHHH-CCCCEEEE
Q ss_conf             0259981431002677439627998124325320110----278435322344023463021134753641-78620343
Q gi|254780170|r   77 KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREIS----LGLAFRPITYFDGQGFIMHKKKGISSVSQL-SGASICVQ  151 (342)
Q Consensus        77 kVe~v~~~~~~rf~aL~sG~vDil~~~~T~T~~Rd~~----~~v~Fs~~~~~dgq~~lVrk~~~i~s~~dL-~G~~I~v~  151 (342)
                      .+++.-+-.++.-..+..|.+|+.+.+.-|-.|....    +.+.|...    .-.+.++++..+.+++|| .|++|+  
T Consensus        46 ~i~~~~~R~~DIp~~V~~G~~DlGItG~D~l~E~~~~v~~l~dLgfG~c----rlvvAvP~~~~~~~~~dl~~~~rIA--  119 (289)
T 2vd3_A           46 QIEVMFSRAADIPEFVADGAADLGITGYDLIVERGSDVEILEDLKYGRA----SLVLAAPEDSTIRGPEDIPRGAVIA--  119 (289)
T ss_dssp             TEEEEEECTTTHHHHHHHTSSSEEEEEHHHHHHHTCCCEEEEECSCSCE----EEEEEEETTSSCCSGGGCCTTCEEE--
T ss_pred             CEEEEEECHHHHHHHHHCCCCCCCEEEHHHHHHCCCCCEEEECCCCCCE----EEEEEECCCCCCCCHHHHCCCCEEE--
T ss_conf             8799998889999999859866135430443340267157102487767----9999952766547876833584898--


Q ss_pred             ECCCHHHHHHHHHHHCCCCCCEEEECCHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCCCCCCCCCEEEECC
Q ss_conf             13426999999998629985078747989999998739602998250479999983678001002564442371010002
Q gi|254780170|r  152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAII  231 (342)
Q Consensus       152 ~GTT~e~~l~~~~~~~~~~~~~v~~~~~~~a~~al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~e~iskEPlg~avr  231 (342)
                        |.+....++||.++|++++++......|..  -.-|-+|+++.=.+.=..++..     ..+++.+.+..+..=++=+
T Consensus       120 --TkYp~it~~~~~~~gi~~~iv~l~GavE~a--P~lG~AD~IvDivsTG~TLr~N-----gL~~i~~il~ssa~LI~n~  190 (289)
T 2vd3_A          120 --TEFPGITENYLREHGIDAEVVELTGSTEIA--PFIGVADLITDLSSTGTTLRMN-----HLRVIDTILESSVKLIANR  190 (289)
T ss_dssp             --ESCHHHHHHHHHHTTCCCEEEECSSCGGGT--TTTTSCSEEEEEESSTHHHHHT-----TEEEEEEEEEECEEEEECH
T ss_pred             --EEHHHHHHHHHHHCCCEEEEEECCCCCCCC--CCCCCCCEEEEECCCHHHHHHC-----CCEECCCEEHEEHHHEECC
T ss_conf             --514669999999819537999657875468--7878441768861788889987-----6987402000136231656


Q ss_pred             C---CCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHH
Q ss_conf             7---775799998877443311212330152089886226717788762
Q gi|254780170|r  232 Q---GDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFL  277 (342)
Q Consensus       232 ~---gD~~w~d~V~W~~~ali~Aee~git~~nv~~~~~~s~~p~i~r~l  277 (342)
                      +   ...+..+..---+.+.+.|+++-.-.-|+.    .+.-.++..+|
T Consensus       191 ~s~~~k~~~i~~l~~rl~~vl~a~~~~~i~~n~p----~~~l~~v~~~l  235 (289)
T 2vd3_A          191 ESYATKSGIIEELRTGIRGVIDAEGKRLVMLNID----RKNLDRVRALM  235 (289)
T ss_dssp             HHHHHSHHHHHHHHHHHHHHHHTTTEEEEEEEEE----GGGHHHHHHHC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCEEEEEEECC----HHHHHHHHHHC
T ss_conf             4432348999999999853774530899999687----76699999857