BLAST/PSIBLAST alignment of GI: 254780170 and GI: 209549162 at iteration 1
>gi|209549162|ref|YP_002281079.1| cationic amino acid ABC transporter periplasmic binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 341
>gi|209534918|gb|ACI54853.1| cationic amino acid ABC transporter, periplasmic binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 341
 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 191/342 (55%), Positives = 262/342 (76%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M      +++   +    + + +A+ LGD+K +GF++CG+NTGL GFA   A+G+W GFD
Sbjct: 1   MKNKLLSAVIGAAVFALGTSAASATTLGDVKAKGFVQCGVNTGLTGFAAPDASGNWAGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFC+A++SA+F DP+K++Y P NAKERF ALQS +ID+LSRNT WT+ R+ +LG  FRP
Sbjct: 61  VDFCKAVASAVFGDPTKVKYTPTNAKERFTALQSGEIDVLSRNTTWTINRDTALGFNFRP 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DGQGF++ K   + S  +LSGA+ICVQ+GTTTEL LADYFK +N++Y+P+VFE + 
Sbjct: 121 VTYYDGQGFMVRKSLNVKSALELSGAAICVQSGTTTELNLADYFKTNNLQYNPVVFENLP 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT   P EHVILP+IISK PL PA+ QGD +W++I
Sbjct: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHVILPEIISKEPLGPAVRQGDDQWFDI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSWT YA++ AEE GITQ N++++ K++ NPD++RFLG +  + IG  LGLT DW   +I
Sbjct: 241 VSWTAYALINAEEFGITQANVDEM-KNSPNPDIKRFLGSETDTKIGTDLGLTNDWAANVI 299

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RN+G  S LKI RG NALW+KGG+ YAPP+R
Sbjct: 300 KGVGNYGEIFERNIGQGSPLKIARGLNALWNKGGIQYAPPVR 341