BLAST/PSIBLAST alignment of GI: 254780170 and GI: 327190790 at iteration 1
>gi|327190790|gb|EGE57858.1| general L-amino acid ABC transporter, substrate-binding protein [Rhizobium etli CNPAF512] Length = 341
 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 264/342 (77%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M      + +   +L   + + +A+ LGD+K +GF++CG+NTGL GFA   A+G+W GFD
Sbjct: 1   MKNKLLSAAIGAAVLALGAPAASATTLGDVKAKGFVQCGVNTGLAGFAAPDASGNWAGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFC+A++SA+F DP+K+++ PL+A  RF ALQS +ID+L+RNT W++ R+ +LGL FR 
Sbjct: 61  VDFCKAVASAVFGDPTKVKFTPLSAANRFPALQSGEIDVLARNTTWSINRDTALGLNFRF 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K   + S  +LSGAS+CVQ+GTTTEL LADYFKA+N++Y+P+VFE+++
Sbjct: 121 VNYYDGQGFMVRKSLNVKSALELSGASVCVQSGTTTELNLADYFKANNLQYNPVVFEKLD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT   P EH ILP+IISK PLAPA+ QGD +W++I
Sbjct: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHAILPEIISKEPLAPAVRQGDDQWFDI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSW  YAM+ AEE GITQ N++ + K++ NPD++RFLG++  + IG  LGLT +W Y II
Sbjct: 241 VSWVGYAMINAEEFGITQANVDDM-KNSPNPDIKRFLGVEADTKIGTDLGLTNEWAYNII 299

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +++GNYGE+F+RN+G  S LKI RG NALW+KGG+ YAPP+R
Sbjct: 300 KNVGNYGEVFERNIGQGSPLKIARGLNALWNKGGIQYAPPVR 341