PSIBLAST alignment of GI: 254780170 and protein with PDB id: 1lst

>gi|157831886|pdb|1LST|A Chain A, Three-Dimensional Structures Of The Periplasmic Lysine-, Arginine-, Ornithine-Binding Protein With And Without A Ligand Length = 239
 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 45/245 (18%), Positives = 85/245 (34%), Gaps = 20/245 (8%)

Query: 35  FLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQS 94
            ++ G +T    F+   A G++ GFD+D    +   +     K  ++  +      +L++
Sbjct: 5   TVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRM---QVKCTWVASDFDALIPSLKA 61

Query: 95  KQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS-SVSQLSGASICVQAG 153
           K+ID +  +   T  R     +AF    Y      I  K   I  ++  L G  + V  G
Sbjct: 62  KKIDAIISSLSITDKR--QQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQG 119

Query: 154 TTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSE 213
           +T E    D ++   +    + +   + I +   A R DA   D  A     L      E
Sbjct: 120 STQEAYANDNWRTKGVD--VVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKE 177

Query: 214 HVILPDIISKSPL-----APAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
           +      +             + + DTE                EL       ++++K  
Sbjct: 178 YAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALT------ELRQDGT-YDKMAKKY 230

Query: 269 TNPDV 273
            + +V
Sbjct: 231 FDFNV 235