PSIBLAST alignment of GI: 254780170 and protein with PDB id: 2ia4

>gi|159794822|pdb|2IA4|B Chain B, Crystal Structure Of Novel Amino Acid Binding Protein From Shigella Flexneri Length = 280
 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 86/241 (35%), Gaps = 6/241 (2%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD---- 74
           +     S L  I K G +  G     V F+         G+  D+  A+  A+       
Sbjct: 1   AAPAAGSTLDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKP 60

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
             +++ +P+ ++ R   LQ+   D    +T   + R+      F    +  G   +  K 
Sbjct: 61  DLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAA--FSDTIFVVGTRLLTKKG 118

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
             I   + L G ++ V +GTT+E+ L    +        I  +   +      + R  A+
Sbjct: 119 GDIKDFADLKGKAVVVTSGTTSEVLLNKLNEEQKXNXRIISAKDHGDSFRTLESGRAVAF 178

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
             D + L   +    +P    I+    S+      + + D ++  +   T   + T+ E 
Sbjct: 179 XXDDALLAGERAKAKKPDNWDIVGKPQSQEAYGCXLRKDDPQFKKLXDDTIAQVQTSGEA 238

Query: 255 G 255
            
Sbjct: 239 E 239