PSIBLAST alignment of GI: 254780170 and protein with PDB id: 2q2a

>gi|165761002|pdb|2Q2A|A Chain A, Crystal Structures Of The Arginine-, Lysine-, Histidine- Binding Protein Artj From The Thermophilic Bacterium Geobacillus Stearothermophilus Length = 243
>gi|165761003|pdb|2Q2A|B Chain B, Crystal Structures Of The Arginine-, Lysine-, Histidine- Binding Protein Artj From The Thermophilic Bacterium Geobacillus Stearothermophilus Length = 243
 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 41/223 (18%), Positives = 70/223 (31%), Gaps = 11/223 (4%)

Query: 33  RGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLAL 92
           +  +  G +     F  ++  G   GFDVD   A+  A   D        +     F +L
Sbjct: 10  KKKVVVGTDAAFAPFEYMQ-KGKIVGFDVDLLDAVMKAAGLDYE---LKNIGWDPLFASL 65

Query: 93  QSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQA 152
           QSK++D+       T  R+      F    +   Q  ++ +   + +   L G +I VQ 
Sbjct: 66  QSKEVDMGISGITITDERK--QSYDFSDPYFEATQVILVKQGSPVKNALDLKGKTIGVQN 123

Query: 153 GTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPS 212
            TT +      F       H   FE              DA   D +        N    
Sbjct: 124 ATTGQEAAEKLF---GKGPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNKK 180

Query: 213 EHVIL-PDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
             VI  P   +         + ++E    V      ++ + + 
Sbjct: 181 LQVIEDPKNFASEYYGMIFPK-NSELKAKVDEALKNVINSGKY 222