RPSBLAST alignment for GI: 254780170 and conserved domain: TIGR01096

>gnl|CDD|162200 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-binding periplasmic protein. Length = 250
 Score =  157 bits (400), Expect = 3e-39
 Identities = 58/284 (20%), Positives = 100/284 (35%), Gaps = 56/284 (19%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           K G ++ G  TG   F    ANG   GFDVD  +AL   +    +K +++  N      +
Sbjct: 22  KEGSVRIGTETGYPPFESKDANGKLVGFDVDLAKALCKRMK---AKCKFVEQNFDGLIPS 78

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGI-SSVSQLSGASICV 150
           L++K++D +      ++  +    + F    Y  GQGF++ K   +  ++  L G ++ V
Sbjct: 79  LKAKKVDAIMAT--MSITPKRQKQIDFSDPYYATGQGFVVKKGSDLAKTLEDLDGKTVGV 136

Query: 151 QAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDR 210
           Q+GTT E  L DYFK        + ++  +  +   +A R DA   D S L    L    
Sbjct: 137 QSGTTHEQYLKDYFKP---GVDIVEYDSYDNANMDLKAGRIDAVFTDASVLAEGFLKPPN 193

Query: 211 PSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTN 270
             +   +   ++          GD                    GI  +  +        
Sbjct: 194 GKDFKFVGPSVTDEKY-----FGD------------------GYGIGLRKGDT------- 223

Query: 271 PDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
                             L    +     IR  G Y ++  +  
Sbjct: 224 -----------------ELKAAFNKALAAIRADGTYQKISKKWF 250