RPSBLAST alignment of GI: 254780170 and protein with PDBid: 1lst

>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Length = 239
 Score = 79.6 bits (195), Expect = 1e-15
 Identities = 36/211 (17%), Positives = 72/211 (34%), Gaps = 11/211 (5%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++ G +T    F+   A G++ GFD+D    +   +     K  ++  +      +L++K
Sbjct: 6   VRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQV---KCTWVASDFDALIPSLKAK 62

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           +ID +  +   T  R+  +      +   D +           ++  L G  + V  G+T
Sbjct: 63  KIDAIISSLSITDKRQQEI-AFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGST 121

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
            E    D ++   +      +   + I +   A R DA   D  A     L      E+ 
Sbjct: 122 QEAYANDNWRTKGVDVVA--YANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYA 179

Query: 216 ILPDIISKSP-----LAPAIIQGDTEWYNIV 241
                +             + + DTE     
Sbjct: 180 FAGPSVKDKKYFGDGTGVGLRKDDTELKAAF 210