RPSBLAST alignment of GI: 254780170 and protein with PDBid: 2a5s

>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* Length = 284
 Score = 44.2 bits (103), Expect = 4e-05
 Identities = 22/200 (11%), Positives = 55/200 (27%), Gaps = 20/200 (10%)

Query: 53  NGDWKGFDVDFCRALSSAI--------FDDPSKIQYLPLNAKERFLALQSKQIDILSRNT 104
               KGF +D  + LS  +          +    + +          +  ++  +   + 
Sbjct: 54  KKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSL 113

Query: 105 DWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGAS---------ICVQAGTT 155
                 E S  + F       G   ++ +   ++ +S                      +
Sbjct: 114 TIN--EERSEVVDFSVPFVETGISVMVSRGTQVTGLSDKKFQRPHDYSPPFRFGTVPNGS 171

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGD-ISALYALKLTNDRPSEH 214
           TE  + + +   +          VE+   + +  + DA+  D     Y            
Sbjct: 172 TERNIRNNYPYMHQYMTRFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVT 231

Query: 215 VILPDIISKSPLAPAIIQGD 234
           +    I + +    A+ +G 
Sbjct: 232 IGSGYIFATTGYGIALQKGS 251