RPSBLAST alignment of GI: 254780170 and protein with PDBid: 2pvu

>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, thermophilic bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272
 Score = 50.8 bits (120), Expect = 5e-07
 Identities = 43/221 (19%), Positives = 68/221 (30%), Gaps = 9/221 (4%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           ++++S       +  +  G +     F E    G   GFDVD   A+  A        + 
Sbjct: 29  TSSSSGGDGGATKKKVVVGTDAAFAPF-EYMQKGKIVGFDVDLLDAVMKAAGL---DYEL 84

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
             +     F +LQSK++D+       T   E      F    +   Q  ++ +   + + 
Sbjct: 85  KNIGWDPLFASLQSKEVDMGISGITIT--DERKQSYDFSDPYFEATQVILVKQGSPVKNA 142

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
             L G +I VQ  TT +       K      H   FE              DA   D + 
Sbjct: 143 LDLKGKTIGVQNATTGQ---EAAEKLFGKGPHIKKFETTVVAIMELLNGGVDAVITDNAV 199

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIV 241
                  N      VI       S     I   ++E    V
Sbjct: 200 ANEYVKNNPNKKLQVIEDPKNFASEYYGMIFPKNSELKAKV 240