RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780174|ref|YP_003064587.1| putative oxidoreductase protein [Candidatus Liberibacter asiaticus str. psy62] (78 letters) >2jya_A AGR_C_3324P, uncharacterized protein ATU1810; protein with unknown function ATU1810, ontario centre for structural proteomics; NMR {Agrobacterium tumefaciens str} (A:) Length = 106 Score = 105 bits (265), Expect = 2e-24 Identities = 38/78 (48%), Positives = 52/78 (66%) Query: 1 MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQK 60 +LEF+ P I+P++GYTSS D QQVKL F + E AE YA GI+Y VI + ++K Sbjct: 27 VLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRK 86 Query: 61 ELSYQRNFSYDRLEPWTH 78 +SY NF ++R +PWTH Sbjct: 87 VVSYTDNFRFNRTQPWTH 104 >1t57_A Conserved protein MTH1675; structural genomics, FMN, methanobacterium thermoautotrophicum, PSI; HET: FMN; 2.30A {Methanothermobacterthermautotrophicus} (A:) Length = 206 Score = 28.2 bits (63), Expect = 0.38 Identities = 7/22 (31%), Positives = 10/22 (45%) Query: 35 LEAAEKYASDHGIQYCVIPSCK 56 LE + A GI+ V+ S Sbjct: 40 LELVGERADQLGIRNFVVASVS 61 >3fkq_A NTRC-like two-domain protein; RER070207001320, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: ATP 2PE; 2.10A {Eubacterium rectale} (A:1-138) Length = 138 Score = 25.2 bits (55), Expect = 3.6 Identities = 7/42 (16%), Positives = 17/42 (40%) Query: 11 YIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVI 52 Y++ L G ++K + F + A + ++ I + Sbjct: 33 YLDRLTGVFNTKYADKLEVYSFTDEKNAIESVKEYRIDVLIA 74 >3f2g_A Alkylmercury lyase; MERB, organomercurial lyase, mercury resistance, mercuric resistance, plasmid; 1.78A {Escherichia coli} PDB: 3f2h_A 3fn8_A 1s6l_A 3f0o_A 3f0p_A 3f2f_A (A:) Length = 220 Score = 24.8 bits (54), Expect = 4.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 31 FFPSLEAAEKYASDH 45 FF S+ AE +AS H Sbjct: 164 FFASVPTAEDWASKH 178 >3bsu_A Ribonuclease H1, RNAse H1; RNAse H, RNA/DNA hybrid; HET: DNA 5IU; 2.10A {Homo sapiens} (A:) Length = 53 Score = 23.4 bits (51), Expect = 9.7 Identities = 5/36 (13%), Positives = 11/36 (30%), Gaps = 7/36 (19%) Query: 18 YTSSKDTLQQVKLF-------FPSLEAAEKYASDHG 46 + + + QV F F + + A + Sbjct: 17 FLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSA 52 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.133 0.406 Gapped Lambda K H 0.267 0.0633 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 593,425 Number of extensions: 20378 Number of successful extensions: 70 Number of sequences better than 10.0: 1 Number of HSP's gapped: 70 Number of HSP's successfully gapped: 6 Length of query: 78 Length of database: 4,956,049 Length adjustment: 43 Effective length of query: 35 Effective length of database: 3,502,434 Effective search space: 122585190 Effective search space used: 122585190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.2 bits)