Query         gi|254780176|ref|YP_003064589.1| hypothetical protein CLIBASIA_00295 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 119
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Mon May 23 01:04:01 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780176.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >1dqu_A Isocitrate lyase; beta   9.3      69  0.0021   13.5  -0.3   69   15-83    177-258 (390)
  2 >1v5r_A Growth-arrest-specific   7.7 1.5E+02  0.0044   11.8   1.3   30   34-63     23-53  (97)
  3 >1vbg_A Pyruvate,orthophosphat   5.9 1.2E+02  0.0035   12.3  -0.4   27   54-82     30-56  (83)
  4 >3d6w_A Methyl-accepting/DNA r   5.6 1.5E+02  0.0044   11.8  -0.0   21   25-45     18-38  (40)
  5 >1h70_A NG, NG-dimethylarginin   5.3 1.9E+02  0.0056   11.3   0.4   38   50-87      1-38  (72)
  6 >2ad6_B Methanol dehydrogenase   5.1 2.2E+02  0.0064   11.0   1.1   31   44-77     22-53  (69)
  7 >1w6s_B Methanol dehydrogenase   4.9 2.2E+02  0.0065   11.0   1.1   31   44-77     22-53  (74)
  8 >2khk_A ATP synthase subunit B   4.7 2.3E+02  0.0068   10.9   0.7   19    3-21     24-42  (53)
  9 >2q8k_A Proliferation-associat   4.3 2.5E+02  0.0073   10.8   0.5   17   67-83     41-58  (67)
 10 >1bd2_D T cell receptor alpha;   3.9 2.5E+02  0.0074   10.7   0.2   32   86-117    31-62  (92)

No 1  
>>1dqu_A Isocitrate lyase; beta barrel; 2.80A {Emericella nidulans} (A:49-259,A:360-538)
Probab=9.28  E-value=69  Score=13.47  Aligned_cols=69  Identities=25%  Similarity=0.279  Sum_probs=43.4

Q ss_pred             HHHHHHCCCCCEEEEEEEECC---------CCCCHHHEEEHHHCCCCCCCEEEEEECCCHHHH----HHHHHHHHHHHHH
Q ss_conf             443210136870146543035---------644012000001011001205655610001355----5555444321013
Q gi|254780176|r   15 IAEAKAKDSGNQAEIDIARSN---------AKDKTDLVRIAEAKYKYRSDIVMAIEKSKADAI----KTMEDRKAKVGVA   81 (119)
Q Consensus        15 iaeakakdsgnqaeidiarsn---------akdktdlvriaeakykyrsdivmaiekskadai----ktmedrkakvgva   81 (119)
                      ++.+++-|..+-.-|-++|..         +-|..|+.|..|.-|.||..+-.+|....+-+-    --||-.+..+..+
T Consensus       177 ~aa~~A~d~~G~d~iViARTDa~la~~iteaIdRad~~r~~eg~y~~~~g~~~~i~r~~a~ap~adl~w~et~~p~~~~a  256 (390)
T 1dqu_A          177 VAIRAQADIMGTDLLAIARTDSEAATLITSTIDHREAPRTREGYYRYQGGTQCAINRAVAYAPFADLIWMESKLPDYKQA  256 (390)
T ss_dssp             HHHHHHHHHTTCCCEEEEECCGGGEEEESCTTCGGTSSCCTTCCEEECCSHHHHHHHHHHHTTSCSEEECCCSSCCHHHH
T ss_pred             HHHHHHHHHCCCCCEEEEEECHHHCCCCCCCCCCCCCCCCCCCCEEECCCCHHHHHHHHHCCCCCCEEEEECCCCCHHHH
T ss_conf             99999997359982589740122204543445622888786643022585299999998418777777760799999999


Q ss_pred             HH
Q ss_conf             55
Q gi|254780176|r   82 RQ   83 (119)
Q Consensus        82 rq   83 (119)
                      ++
T Consensus       257 ~~  258 (390)
T 1dqu_A          257 KE  258 (390)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             99


No 2  
>>1v5r_A Growth-arrest-specific protein 2; GAS2 domain, zinc binding domain, apoptosis, cell cycle, structural genomics; NMR {Mus musculus} (A:)
Probab=7.67  E-value=1.5e+02  Score=11.81  Aligned_cols=30  Identities=13%  Similarity=0.322  Sum_probs=20.5

Q ss_pred             CCCCCCHHHEEEHHHCCCCCCCEEEE-EECC
Q ss_conf             35644012000001011001205655-6100
Q gi|254780176|r   34 SNAKDKTDLVRIAEAKYKYRSDIVMA-IEKS   63 (119)
Q Consensus        34 snakdktdlvriaeakykyrsdivma-ieks   63 (119)
                      .+...+....||.|.||++-+.+++- |-.|
T Consensus        23 c~C~~~f~i~ri~eGkY~~GdklifvRiLr~   53 (97)
T 1v5r_A           23 CKCPTKFCVERLSQGRYRVGEKILFIRMLHN   53 (97)
T ss_dssp             CCSSSCCCEEEEETTEEEETTEEEEEEEETT
T ss_pred             CCCCCCCCEEEECCCCEEECCEEEEEEEECC
T ss_conf             7688840669943880877888899999579


No 3  
>>1vbg_A Pyruvate,orthophosphate dikinase; transferase, maize, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Zea mays} (A:116-198)
Probab=5.88  E-value=1.2e+02  Score=12.33  Aligned_cols=27  Identities=26%  Similarity=0.405  Sum_probs=19.6

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             20565561000135555554443210135
Q gi|254780176|r   54 SDIVMAIEKSKADAIKTMEDRKAKVGVAR   82 (119)
Q Consensus        54 sdivmaiekskadaiktmedrkakvgvar   82 (119)
                      +++||.|++..-+.+  ++..|.+.|+..
T Consensus        30 g~vV~gi~~~~Fe~~--l~~~k~~~g~~~   56 (83)
T 1vbg_A           30 GNVVMDIPRSLFEEK--LEHMKESKGLKN   56 (83)
T ss_dssp             HHHTSCCCHHHHHHH--HHHHHHHHTCSS
T ss_pred             HHHHCCCCHHHHHHH--HHHHHHHCCCCC
T ss_conf             466448875768999--999998649864


No 4  
>>3d6w_A Methyl-accepting/DNA response regulator; structural genomics, APC7590, lyttr DNA-binding domain, PSI-2, protein structure initiative; 2.40A {Bacillus cereus atcc 10987} (A:72-111)
Probab=5.55  E-value=1.5e+02  Score=11.84  Aligned_cols=21  Identities=19%  Similarity=0.234  Sum_probs=14.2

Q ss_pred             CEEEEEEEECCCCCCHHHEEE
Q ss_conf             701465430356440120000
Q gi|254780176|r   25 NQAEIDIARSNAKDKTDLVRI   45 (119)
Q Consensus        25 nqaeidiarsnakdktdlvri   45 (119)
                      ++.+|.+.||++|+--.+..+
T Consensus        18 d~~~IpVSRs~vk~~k~~lgl   38 (40)
T 3d6w_A           18 NGERVPVSQSYASYFRKLLGF   38 (40)
T ss_dssp             TSCEEEECTTTHHHHHHHHTC
T ss_pred             CCEEEEECHHHHHHHHHHHCC
T ss_conf             995999956689999998479


No 5  
>>1h70_A NG, NG-dimethylarginine dimethylaminohydrolase; DDAH, nitric oxide synthase inhibitor; HET: CIR; 1.8A {Pseudomonas aeruginosa} (A:1-61,A:245-255)
Probab=5.32  E-value=1.9e+02  Score=11.33  Aligned_cols=38  Identities=16%  Similarity=0.208  Sum_probs=26.7

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             10012056556100013555555444321013554320
Q gi|254780176|r   50 YKYRSDIVMAIEKSKADAIKTMEDRKAKVGVARQERKA   87 (119)
Q Consensus        50 ykyrsdivmaiekskadaiktmedrkakvgvarqerka   87 (119)
                      |+|..-||-.+-.|-++.+...+-.+--+..|+++..+
T Consensus         1 ~~ft~AIvR~p~~Sl~~gLt~~~~~~~D~e~A~~QH~~   38 (72)
T 1h70_A            1 FMFKHIIARTPARSLVDGLTSSHLGKPDYAKALEQHNA   38 (72)
T ss_dssp             CCCCEEEEECCCGGGGGCCCSCCSCCCCHHHHHHHHHH
T ss_pred             CCCCEEEECCCCHHHHHCCCCCCCCCCCHHHHHHHHHH
T ss_conf             97678998689977742412236799999999999999


No 6  
>>2ad6_B Methanol dehydrogenase subunit 2; PQQ configuration, native, oxidoreductase; HET: PQQ; 1.50A {Methylophilus methylotrophus W3A1} (B:)
Probab=5.07  E-value=2.2e+02  Score=11.05  Aligned_cols=31  Identities=42%  Similarity=0.636  Sum_probs=19.3

Q ss_pred             EEHHHCCCCCCCEEEEEECC-CHHHHHHHHHHHHH
Q ss_conf             00010110012056556100-01355555544432
Q gi|254780176|r   44 RIAEAKYKYRSDIVMAIEKS-KADAIKTMEDRKAK   77 (119)
Q Consensus        44 riaeakykyrsdivmaieks-kadaiktmedrkak   77 (119)
                      .|+-.||.-..|-.   |-+ ..++|+.||.|.++
T Consensus        22 kiaGsKYDPkhdp~---El~kQ~~s~kame~RN~~   53 (69)
T 2ad6_B           22 KIAGSKYDPKHDPV---ELNKQEESIKAMDARNAK   53 (69)
T ss_dssp             CCTTSTTCCCCCHH---HHTHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCCCCCCHH---HHHHHHHHHHHHHHHHHH
T ss_conf             31377679888989---997889999999998899


No 7  
>>1w6s_B Methanol dehydrogenase subunit 2; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} (B:)
Probab=4.92  E-value=2.2e+02  Score=10.99  Aligned_cols=31  Identities=48%  Similarity=0.652  Sum_probs=19.4

Q ss_pred             EEHHHCCCCCCCEEEEEECCC-HHHHHHHHHHHHH
Q ss_conf             000101100120565561000-1355555544432
Q gi|254780176|r   44 RIAEAKYKYRSDIVMAIEKSK-ADAIKTMEDRKAK   77 (119)
Q Consensus        44 riaeakykyrsdivmaieksk-adaiktmedrkak   77 (119)
                      .|+-.||.-..|-.   |-+| .++|+.||.|.++
T Consensus        22 kiaGsKYDPkHdp~---EL~KQ~~si~ame~RN~k   53 (74)
T 1w6s_B           22 KIAGSKYDPKHDPK---ELNKQADSIKQMEERNKK   53 (74)
T ss_dssp             CCTTSTTCCCCCHH---HHTHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCCCCCCHH---HHHHHHHHHHHHHHHHHH
T ss_conf             31377679888989---997789999999998899


No 8  
>>2khk_A ATP synthase subunit B; F1FO ATP synthase, spectroscopy, ATP synthesis, cell inner membrane, cell membrane, CF(0), hydrogen ION transport; NMR {Escherichia coli k-12} (A:)
Probab=4.70  E-value=2.3e+02  Score=10.91  Aligned_cols=19  Identities=37%  Similarity=0.545  Sum_probs=11.2

Q ss_pred             CHHHHHHHHHHHHHHHHHC
Q ss_conf             0122232211134432101
Q gi|254780176|r    3 ELETAQAEADAKIAEAKAK   21 (119)
Q Consensus         3 eletaqaeadakiaeakak   21 (119)
                      +|+.+|..+...+.++|.+
T Consensus        24 eLelA~~~a~~~L~eAK~~   42 (53)
T 2khk_A           24 DLDLAKASATDQLKKAKAE   42 (53)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999


No 9  
>>2q8k_A Proliferation-associated protein 2G4; EBP1, PA2G4, methionine aminopeptidase, PITA-bread, transcription; 1.60A {Homo sapiens} PDB: 2v6c_A (A:246-312)
Probab=4.31  E-value=2.5e+02  Score=10.75  Aligned_cols=17  Identities=35%  Similarity=0.732  Sum_probs=11.7

Q ss_pred             HHHHHHH-HHHHHHHHHH
Q ss_conf             5555554-4432101355
Q gi|254780176|r   67 AIKTMED-RKAKVGVARQ   83 (119)
Q Consensus        67 aiktmed-rkakvgvarq   83 (119)
                      .++.+|| ++|+.||.--
T Consensus        41 ~lr~ledekkarlGv~Ec   58 (67)
T 2q8k_A           41 TLRAFEDEKKARMGVVEC   58 (67)
T ss_dssp             EGGGCC--HHHHHHHHHH
T ss_pred             CHHHCCCCHHHHHHHHHH
T ss_conf             665417716778999999


No 10 
>>1bd2_D T cell receptor alpha; complex (MHC/viral peptide/receptor); 2.50A {Homo sapiens} (D:113-204)
Probab=3.94  E-value=2.5e+02  Score=10.71  Aligned_cols=32  Identities=28%  Similarity=0.353  Sum_probs=25.0

Q ss_pred             HHHHCCCCEEEEEEEEECCCEEEEEHHHCCCC
Q ss_conf             20001241146766531252245402204101
Q gi|254780176|r   86 KANESKDAATIITTATVENTKVVETKEAGKTA  117 (119)
Q Consensus        86 kaneskdaatiittatventkvvetkeagkta  117 (119)
                      ..+.+++...+++..||-+-|+.+-|.-|-.|
T Consensus        31 nv~~~~~s~v~~t~~TVLdMk~m~sKSngavA   62 (92)
T 1bd2_D           31 NVSQSKDSDVYITDKTVLDMRSMDFKSNSAVA   62 (92)
T ss_dssp             CCCCCSSTTSEECCCEEEECC---CEEEEEEE
T ss_pred             CEEEEECCCEEECCCEEEEECCCCEEEEEEEE
T ss_conf             25999469877357468877169800888999


Done!