Query         gi|254780176|ref|YP_003064589.1| hypothetical protein CLIBASIA_00295 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 119
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Mon May 23 03:03:51 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780176.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1w6sb_ a.137.2.1 (B:) Methano   5.1      87  0.0063   11.1   1.1   31   44-77     22-53  (73)
  2 d2ad6b1 a.137.2.1 (B:1-69) Met   4.7      93  0.0068   10.9   1.1   31   44-77     22-53  (69)
  3 d1lrwb_ a.137.2.1 (B:) Methano   4.3   1E+02  0.0073   10.7   1.1   31   44-77     22-53  (83)
  4 d1ri9a_ b.34.2.1 (A:) Fyn-bind   4.2   1E+02  0.0075   10.7   1.4   27   27-54     45-71  (77)
  5 d1vpua_ g.34.1.1 (A:) HIV-1 VP   3.8      49  0.0036   12.3  -1.6   11   19-29     13-23  (45)
  6 d1v5ra1 d.82.4.1 (A:7-91) Grow   3.3 1.3E+02  0.0091   10.3   1.3   30   35-64     18-48  (85)
  7 d1ogad2 b.1.1.2 (D:118-202) T-   2.9      95  0.0069   10.9  -0.9   31   87-117    28-58  (85)
  8 d1lp9e2 b.1.1.2 (E:118-198) T-   2.3 1.2E+02   0.009   10.3  -0.9   29   89-117    35-63  (79)
  9 d1hnra_ a.155.1.1 (A:) H1 prot   2.3 1.9E+02   0.014    9.4   0.2    8   48-55      5-12  (47)
 10 d2p62a1 e.67.1.1 (A:1-241) Hyp   2.1 1.9E+02   0.014    9.3  -0.1   43   66-108    80-132 (241)

No 1  
>d1w6sb_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylobacterium extorquens [TaxId: 408]}
Probab=5.12  E-value=87  Score=11.06  Aligned_cols=31  Identities=45%  Similarity=0.634  Sum_probs=19.0

Q ss_pred             EEHHHCCCCCCCEEEEEECC-CHHHHHHHHHHHHH
Q ss_conf             00010110012056556100-01355555544432
Q gi|254780176|r   44 RIAEAKYKYRSDIVMAIEKS-KADAIKTMEDRKAK   77 (119)
Q Consensus        44 riaeakykyrsdivmaieks-kadaiktmedrkak   77 (119)
                      .|+-.||.-..|-.   |-+ .+++|+.||.|.++
T Consensus        22 kiaGsKYDPkhdp~---EL~kQ~~si~ame~RN~~   53 (73)
T d1w6sb_          22 KIAGSKYDPKHDPK---ELNKQADSIKQMEERNKK   53 (73)
T ss_dssp             CCTTSTTCCCCCHH---HHTHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCCCCCCHH---HHHHHHHHHHHHHHHHHH
T ss_conf             31377679888989---997789999999998899


No 2  
>d2ad6b1 a.137.2.1 (B:1-69) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
Probab=4.72  E-value=93  Score=10.91  Aligned_cols=31  Identities=45%  Similarity=0.654  Sum_probs=19.0

Q ss_pred             EEHHHCCCCCCCEEEEEECCC-HHHHHHHHHHHHH
Q ss_conf             000101100120565561000-1355555544432
Q gi|254780176|r   44 RIAEAKYKYRSDIVMAIEKSK-ADAIKTMEDRKAK   77 (119)
Q Consensus        44 riaeakykyrsdivmaieksk-adaiktmedrkak   77 (119)
                      .|+-.||.-..|-.   |-+| .++|+.||.|.++
T Consensus        22 kiaGsKYDPkhdp~---EL~kQ~~si~ame~RN~~   53 (69)
T d2ad6b1          22 KIAGSKYDPKHDPV---ELNKQEESIKAMDARNAK   53 (69)
T ss_dssp             CCTTSTTCCCCCHH---HHTHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCCCCCCHH---HHHHHHHHHHHHHHHHHH
T ss_conf             31377679888989---997889999999998899


No 3  
>d1lrwb_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Paracoccus denitrificans [TaxId: 266]}
Probab=4.29  E-value=1e+02  Score=10.74  Aligned_cols=31  Identities=26%  Similarity=0.425  Sum_probs=19.9

Q ss_pred             EEHHHCCCCCCCEEEEEECCC-HHHHHHHHHHHHH
Q ss_conf             000101100120565561000-1355555544432
Q gi|254780176|r   44 RIAEAKYKYRSDIVMAIEKSK-ADAIKTMEDRKAK   77 (119)
Q Consensus        44 riaeakykyrsdivmaieksk-adaiktmedrkak   77 (119)
                      .|+-.||.-..|-   -|-+| +++|+.||.|.++
T Consensus        22 kiaGsKYDPkHdp---~EL~KQ~~si~ame~RN~k   53 (83)
T d1lrwb_          22 KVEGSKYDPQHDP---AELSKQGESLAVMDARNEW   53 (83)
T ss_dssp             CCTTSTTCCCCCH---HHHTHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCCCCCCH---HHHHHHHHHHHHHHHHHHH
T ss_conf             3037767988898---9997789999999998899


No 4  
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]}
Probab=4.16  E-value=1e+02  Score=10.69  Aligned_cols=27  Identities=26%  Similarity=0.441  Sum_probs=20.7

Q ss_pred             EEEEEEECCCCCCHHHEEEHHHCCCCCC
Q ss_conf             1465430356440120000010110012
Q gi|254780176|r   27 AEIDIARSNAKDKTDLVRIAEAKYKYRS   54 (119)
Q Consensus        27 aeidiarsnakdktdlvriaeakykyrs   54 (119)
                      -.|||-|.+..+| -|.|-.+.+|-|-+
T Consensus        45 E~ldVIr~t~~~k-~LcRN~~GkYGYV~   71 (77)
T d1ri9a_          45 ESLEVIQTTDDTK-VLCRNEEGKYGYVL   71 (77)
T ss_dssp             CBCEEEEESSSSE-EEEEETTTEEEEEE
T ss_pred             CEEEEEEECCCCE-EEEECCCCCEEEEE
T ss_conf             8899998089982-99986999678898


No 5  
>d1vpua_ g.34.1.1 (A:) HIV-1 VPU cytoplasmic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
Probab=3.76  E-value=49  Score=12.28  Aligned_cols=11  Identities=55%  Similarity=0.773  Sum_probs=6.3

Q ss_pred             HHCCCCCEEEE
Q ss_conf             10136870146
Q gi|254780176|r   19 KAKDSGNQAEI   29 (119)
Q Consensus        19 kakdsgnqaei   29 (119)
                      .|.||||..|=
T Consensus        13 RAEDSGNESeG   23 (45)
T d1vpua_          13 RAEDSGNESEG   23 (45)
T ss_dssp             TTCHHHHTTTT
T ss_pred             HCCCCCCCCCC
T ss_conf             70257777756


No 6  
>d1v5ra1 d.82.4.1 (A:7-91) Growth-arrest-specific protein 2, GAS2 {Mouse (Mus musculus) [TaxId: 10090]}
Probab=3.30  E-value=1.3e+02  Score=10.28  Aligned_cols=30  Identities=17%  Similarity=0.359  Sum_probs=20.7

Q ss_pred             CCCCCHHHEEEHHHCCCCCCCEEE-EEECCC
Q ss_conf             564401200000101100120565-561000
Q gi|254780176|r   35 NAKDKTDLVRIAEAKYKYRSDIVM-AIEKSK   64 (119)
Q Consensus        35 nakdktdlvriaeakykyrsdivm-aieksk   64 (119)
                      +...+-.+.|+.|.+|.+-+.+++ -|.+++
T Consensus        18 ~C~~~f~i~ri~eGkY~~G~k~i~vRil~~~   48 (85)
T d1v5ra1          18 KCPTKFCVERLSQGRYRVGEKILFIRMLHNK   48 (85)
T ss_dssp             CSSSCCCEEEEETTEEEETTEEEEEEEETTT
T ss_pred             CCCCCCCEEEECCCCEEECCEEEEEEEECCC
T ss_conf             6887415699438828888889999996798


No 7  
>d1ogad2 b.1.1.2 (D:118-202) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
Probab=2.85  E-value=95  Score=10.86  Aligned_cols=31  Identities=29%  Similarity=0.356  Sum_probs=22.9

Q ss_pred             HHHCCCCEEEEEEEEECCCEEEEEHHHCCCC
Q ss_conf             0001241146766531252245402204101
Q gi|254780176|r   87 ANESKDAATIITTATVENTKVVETKEAGKTA  117 (119)
Q Consensus        87 aneskdaatiittatventkvvetkeagkta  117 (119)
                      .+.+++...+++..||-+-|+.+-|.-|-.|
T Consensus        28 v~~~~~s~v~~t~~TVLdMk~m~sKSngava   58 (85)
T d1ogad2          28 VSQSKDSDVYITDKTVLDMRSMDFKSNSAVA   58 (85)
T ss_dssp             CCCCSSTTEEECCCEEEEEGGGTEEEEEEEE
T ss_pred             CCCCCCCCEEECCCEEEEEEHHCCCCCCEEE
T ss_conf             4434565326017846660031576445588


No 8  
>d1lp9e2 b.1.1.2 (E:118-198) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
Probab=2.28  E-value=1.2e+02  Score=10.30  Aligned_cols=29  Identities=31%  Similarity=0.462  Sum_probs=21.3

Q ss_pred             HCCCCEEEEEEEEECCCEEEEEHHHCCCC
Q ss_conf             01241146766531252245402204101
Q gi|254780176|r   89 ESKDAATIITTATVENTKVVETKEAGKTA  117 (119)
Q Consensus        89 eskdaatiittatventkvvetkeagkta  117 (119)
                      .+++...+|+..||-+-|+.+-|.-|-.|
T Consensus        35 ~~~~s~~~~t~~TVLdMk~m~sKSngavA   63 (79)
T d1lp9e2          35 KTMESGTFITDKTVLDMKAMDSKSNGAIA   63 (79)
T ss_dssp             CCCSTTEEECCCEEEEETTTTEEEEEEEE
T ss_pred             CCCCCCCEEECCEEEEEEHHCCCCCCEEE
T ss_conf             65676607506725550021476445588


No 9  
>d1hnra_ a.155.1.1 (A:) H1 protein (H-NS) {Escherichia coli [TaxId: 562]}
Probab=2.25  E-value=1.9e+02  Score=9.42  Aligned_cols=8  Identities=50%  Similarity=0.937  Sum_probs=0.0

Q ss_pred             HCCCCCCC
Q ss_conf             01100120
Q gi|254780176|r   48 AKYKYRSD   55 (119)
Q Consensus        48 akykyrsd   55 (119)
                      +||+|+..
T Consensus         5 ~KY~y~~~   12 (47)
T d1hnra_           5 AKYSYVDE   12 (47)
T ss_dssp             CCBEECCS
T ss_pred             CCCCCCCC
T ss_conf             86433389


No 10 
>d2p62a1 e.67.1.1 (A:1-241) Hypothetical protein PH0156 {Pyrococcus horikoshii [TaxId: 53953]}
Probab=2.10  E-value=1.9e+02  Score=9.33  Aligned_cols=43  Identities=19%  Similarity=0.149  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH----------HCCCCEEEEEEEEECCCEEE
Q ss_conf             35555554443210135543200----------01241146766531252245
Q gi|254780176|r   66 DAIKTMEDRKAKVGVARQERKAN----------ESKDAATIITTATVENTKVV  108 (119)
Q Consensus        66 daiktmedrkakvgvarqerkan----------eskdaatiittatventkvv  108 (119)
                      +|++..+..-.++||||.--..+          .+....+.-..-.++|++|+
T Consensus        80 ~Am~v~~~~v~~iGvA~DvDe~~ev~~~~~s~l~~~e~~~~~g~~~~~~~~i~  132 (241)
T d2p62a1          80 DSVKLGLLNVEEVYVVRDVDEGNDVFEWVLSFLREREVRVDNGAIVTEGVKIY  132 (241)
T ss_dssp             HHHHHTCCCEEEEEEEEESSSSSCHHHHHHTTCTTCCCEEETTEEEETTEEEE
T ss_pred             HHHHHHCCCHHEEEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEECCEEEE
T ss_conf             99997444611168887437607889999998623675446772897466999


Done!