RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780176|ref|YP_003064589.1| hypothetical protein
CLIBASIA_00295 [Candidatus Liberibacter asiaticus str. psy62]
         (119 letters)



>d1v5ra1 d.82.4.1 (A:7-91) Growth-arrest-specific protein 2, GAS2
          {Mouse (Mus musculus) [TaxId: 10090]}
          Length = 85

 Score = 23.6 bits (51), Expect = 4.5
 Identities = 5/37 (13%), Positives = 15/37 (40%), Gaps = 1/37 (2%)

Query: 29 IDIARSNAKDKTDLVRIAEAKYKYRSDIVMA-IEKSK 64
           +        K  + R+++ +Y+    I+   +  +K
Sbjct: 12 SEDPPCKCPTKFCVERLSQGRYRVGEKILFIRMLHNK 48


>d1lp9e2 b.1.1.2 (E:118-198) T-cell antigen receptor {Mouse (Mus
           musculus), alpha-chain [TaxId: 10090]}
          Length = 79

 Score = 23.7 bits (51), Expect = 4.9
 Identities = 10/32 (31%), Positives = 18/32 (56%)

Query: 88  NESKDAATIITTATVENTKVVETKEAGKTARS 119
            ++ ++ T IT  TV + K +++K  G  A S
Sbjct: 34  PKTMESGTFITDKTVLDMKAMDSKSNGAIAWS 65


>d1uwka_ e.51.1.1 (A:) Urocanate hydratase HutU {Pseudomonas putida
           [TaxId: 303]}
          Length = 554

 Score = 22.8 bits (49), Expect = 7.7
 Identities = 12/55 (21%), Positives = 21/55 (38%)

Query: 12  DAKIAEAKAKDSGNQAEIDIARSNAKDKTDLVRIAEAKYKYRSDIVMAIEKSKAD 66
           DAK+ E    D+     +D+AR     +    RI       R+ + +A  +    
Sbjct: 374 DAKVKELIPDDAHLHRWLDMARERISFQGLPARICWVGLGLRAKLGLAFNEMVRS 428


>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone
           methyltransferase Dot1l {Baker's yeast (Saccharomyces
           cerevisiae) [TaxId: 4932]}
          Length = 406

 Score = 22.7 bits (48), Expect = 10.0
 Identities = 11/67 (16%), Positives = 22/67 (32%)

Query: 48  AKYKYRSDIVMAIEKSKADAIKTMEDRKAKVGVARQERKANESKDAATIITTATVENTKV 107
           A Y   S+I   IE S    + +    + K  +      + ++ D    +    + N  +
Sbjct: 85  AIYNPMSEIGKLIEYSCLVFLPSPYAEQLKETILPDLNASFDNSDTKGFVNAINLYNKMI 144

Query: 108 VETKEAG 114
            E     
Sbjct: 145 REIPRQR 151


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.302    0.116    0.279 

Gapped
Lambda     K      H
   0.267   0.0474    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 337,304
Number of extensions: 12763
Number of successful extensions: 30
Number of sequences better than 10.0: 1
Number of HSP's gapped: 29
Number of HSP's successfully gapped: 15
Length of query: 119
Length of database: 2,407,596
Length adjustment: 74
Effective length of query: 45
Effective length of database: 1,391,576
Effective search space: 62620920
Effective search space used: 62620920
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 47 (22.5 bits)