BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780176|ref|YP_003064589.1| hypothetical protein
CLIBASIA_00295 [Candidatus Liberibacter asiaticus str. psy62]
         (119 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780176|ref|YP_003064589.1| hypothetical protein CLIBASIA_00295 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 119

 Score =  224 bits (571), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 1   MAELETAQAEADAKIAEAKAKDSGNQAEIDIARSNAKDKTDLVRIAEAKYKYRSDIVMAI 60
           MAELETAQAEADAKIAEAKAKDSGNQAEIDIARSNAKDKTDLVRIAEAKYKYRSDIVMAI
Sbjct: 1   MAELETAQAEADAKIAEAKAKDSGNQAEIDIARSNAKDKTDLVRIAEAKYKYRSDIVMAI 60

Query: 61  EKSKADAIKTMEDRKAKVGVARQERKANESKDAATIITTATVENTKVVETKEAGKTARS 119
           EKSKADAIKTMEDRKAKVGVARQERKANESKDAATIITTATVENTKVVETKEAGKTARS
Sbjct: 61  EKSKADAIKTMEDRKAKVGVARQERKANESKDAATIITTATVENTKVVETKEAGKTARS 119


>gi|254781158|ref|YP_003065571.1| peptidyl prolyl cis-trans isomerase D signal peptide protein
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 631

 Score = 21.2 bits (43), Expect = 6.1,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 25  NQAEIDIARSNAKDKTDLVRIAEAKYKYRSDIVMA 59
           NQ E D A  + K     +++AE + K  SDI + 
Sbjct: 279 NQKEADEAFQSLKKGKKFIQLAEEQGKSLSDISLG 313


>gi|254780903|ref|YP_003065316.1| two-component sensor histidine kinase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 766

 Score = 20.4 bits (41), Expect = 9.4,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 28/59 (47%)

Query: 13  AKIAEAKAKDSGNQAEIDIARSNAKDKTDLVRIAEAKYKYRSDIVMAIEKSKADAIKTM 71
           A++ E+K +      ++  +R   + +   + IA AKY+   +      K+K++ +  M
Sbjct: 492 AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKM 550


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.302    0.116    0.279 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50,824
Number of Sequences: 1233
Number of extensions: 1449
Number of successful extensions: 11
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of query: 119
length of database: 328,796
effective HSP length: 64
effective length of query: 55
effective length of database: 249,884
effective search space: 13743620
effective search space used: 13743620
T: 11
A: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.0 bits)
S2: 33 (17.3 bits)