BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780177|ref|YP_003064590.1| lipoyltransferase [Candidatus Liberibacter asiaticus str. psy62] (257 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780177|ref|YP_003064590.1| lipoyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Score = 525 bits (1351), Expect = e-151, Method: Compositional matrix adjust. Identities = 257/257 (100%), Positives = 257/257 (100%) Query: 1 MELLSRNALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLE 60 MELLSRNALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLE Sbjct: 1 MELLSRNALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLE 60 Query: 61 HPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFV 120 HPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFV Sbjct: 61 HPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFV 120 Query: 121 AALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISF 180 AALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISF Sbjct: 121 AALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISF 180 Query: 181 HGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILH 240 HGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILH Sbjct: 181 HGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILH 240 Query: 241 EYANINDVISTKQSEKK 257 EYANINDVISTKQSEKK Sbjct: 241 EYANINDVISTKQSEKK 257 >gi|254780808|ref|YP_003065221.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Candidatus Liberibacter asiaticus str. psy62] Length = 626 Score = 26.2 bits (56), Expect = 0.53, Method: Compositional matrix adjust. Identities = 18/80 (22%), Positives = 37/80 (46%), Gaps = 15/80 (18%) Query: 134 LGIVGERREDRVGIWVVRLNKTRD--NQLLLIEEKIAAIGIRIRK---------WISFHG 182 LG +GERR+ R ++ N R L+L + +++ I ++ ++S+ Sbjct: 453 LGCIGERRQKRFAKYIQEYNFLRSLLKSLVLTSKNLSSTSISFKQDGKTRTAYEFLSYPD 512 Query: 183 LSL----NISPDLSYYTGIV 198 S+ +I PD ++ +V Sbjct: 513 FSIQNLFSICPDARKFSSLV 532 >gi|254781055|ref|YP_003065468.1| glutathione reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 25.0 bits (53), Expect = 1.5, Method: Compositional matrix adjust. Identities = 12/21 (57%), Positives = 14/21 (66%) Query: 73 SDDLLSPKSLPVYTTGRGGGY 93 SD++ S KSLP T GGGY Sbjct: 158 SDEIFSLKSLPQSTLIIGGGY 178 >gi|254780182|ref|YP_003064595.1| DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 910 Score = 24.6 bits (52), Expect = 1.7, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 17/53 (32%) Query: 116 LRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIA 168 L+ FVA EEV++R K L LNK RD +L+ IA Sbjct: 358 LKAFVAFREEVVVRRTKYL-----------------LNKARDRAHVLVGLAIA 393 >gi|254780181|ref|YP_003064594.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 182 Score = 22.3 bits (46), Expect = 7.5, Method: Compositional matrix adjust. Identities = 8/15 (53%), Positives = 13/15 (86%) Query: 178 ISFHGLSLNISPDLS 192 ISF GL++N++ D+S Sbjct: 74 ISFEGLAVNLAKDIS 88 >gi|254780451|ref|YP_003064864.1| aconitate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 896 Score = 22.3 bits (46), Expect = 7.6, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 88 GRGGGYTYHGPGQRIIYI 105 G+ GGYT H P + ++I Sbjct: 739 GKKGGYTIHYPSKEELFI 756 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.138 0.409 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 168,132 Number of Sequences: 1233 Number of extensions: 6909 Number of successful extensions: 17 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 7 length of query: 257 length of database: 328,796 effective HSP length: 72 effective length of query: 185 effective length of database: 240,020 effective search space: 44403700 effective search space used: 44403700 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 37 (18.9 bits)