BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780179|ref|YP_003064592.1| hypothetical protein
CLIBASIA_00310 [Candidatus Liberibacter asiaticus str. psy62]
         (75 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780179|ref|YP_003064592.1| hypothetical protein CLIBASIA_00310 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 75

 Score =  151 bits (381), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 75/75 (100%), Positives = 75/75 (100%)

Query: 1  MLLLHQNSHKEEEIIDFNSNHLLSSLSYCHYGKRLSTQYKTLRKGILIPVVFSILYFTIS 60
          MLLLHQNSHKEEEIIDFNSNHLLSSLSYCHYGKRLSTQYKTLRKGILIPVVFSILYFTIS
Sbjct: 1  MLLLHQNSHKEEEIIDFNSNHLLSSLSYCHYGKRLSTQYKTLRKGILIPVVFSILYFTIS 60

Query: 61 KSIFPLSHFKKHYRF 75
          KSIFPLSHFKKHYRF
Sbjct: 61 KSIFPLSHFKKHYRF 75


>gi|254780474|ref|YP_003064887.1| ubiquinol oxidase, subunit II [Candidatus Liberibacter asiaticus
          str. psy62]
          Length = 332

 Score = 22.7 bits (47), Expect = 1.2,   Method: Composition-based stats.
 Identities = 8/12 (66%), Positives = 11/12 (91%)

Query: 46 ILIPVVFSILYF 57
          I++PV FSIL+F
Sbjct: 60 IVVPVFFSILFF 71


>gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter
            asiaticus str. psy62]
          Length = 1386

 Score = 21.9 bits (45), Expect = 2.2,   Method: Composition-based stats.
 Identities = 10/17 (58%), Positives = 11/17 (64%)

Query: 6    QNSHKEEEIIDFNSNHL 22
            +NS K EEI DFN   L
Sbjct: 1369 KNSAKMEEIPDFNKCEL 1385


>gi|254780761|ref|YP_003065174.1| probable FAD-dependent oxidoreductase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 473

 Score = 21.2 bits (43), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 9/16 (56%)

Query: 23  LSSLSYCHYGKRLSTQ 38
           L S  YCH G  L+T 
Sbjct: 137 LPSEKYCHIGGNLATN 152


>gi|254781141|ref|YP_003065554.1| hypothetical protein CLIBASIA_05225 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 196

 Score = 20.0 bits (40), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 8/23 (34%), Positives = 13/23 (56%)

Query: 10  KEEEIIDFNSNHLLSSLSYCHYG 32
           ++EE++D   + LLS   Y   G
Sbjct: 116 QKEEMVDITDHRLLSLAYYAQIG 138


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.327    0.140    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50,994
Number of Sequences: 1233
Number of extensions: 1712
Number of successful extensions: 7
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of query: 75
length of database: 328,796
effective HSP length: 45
effective length of query: 30
effective length of database: 273,311
effective search space:  8199330
effective search space used:  8199330
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 31 (16.5 bits)